Importin subunit beta-2 - Saccharomyces cerevisiae S288C

Importin subunit beta-2 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Importin subunit beta-2
Accession Code	P38217
Gene	KAP104
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 918)
MASTWKPAEDYVLQLATLLQNCMSPNPEIRNNAMEAMENFQLQPEFLNYLCYILIEGESDDVLKQHYSLQDLQNNRATAGMLLKNSMLGGNNLIKSNSHDLGYVKSNIIHGLYNSNNNLVSNVTGIVITT LFSTYYRQHRDDPTGLQMLYQLLELTSNGNEPSIKALSKIMEDSAQFFQLEWSGNTKPMEALLDSFFRFISNPNFSPVIRSESVKCINTVIPLQTQSFIVRLDKFLEIIFQLAQNDENDLVRAQICISFS FLLEFRPDKLVSHLDGIVQFMLHLITTVNEEKVAIEACEFLHAFATSPNIPEHILQPYVKDIVPILLSKMVYNEESIVLLEASNDDDAFLEDKDEDIKPIAPRIVKKKEAGNGEDADDNEDDDDDDDDED GDVDTQWNLRKCSAATLDVMTNILPHQVMDIAFPFLREHLGSDRWFIREATILALGAMAEGGMKYFNDGLPALIPFLVEQLNDKWAPVRKMTCWTLSRFSPWILQDHTEFLIPVLEPIINTLMDKKKDVQ EAAISSVAVFIENADSELVETLFYSQLLTSFDKCLKYYKKKNLIILYDAIGRFAEKCALDETAMQIILPPLIEKWALLSDSDKELWPLLECLSCVASSLGERFMPMAPEVYNRAFRILCHCVELEAKSHQ DPTIVVPEKDFIITSLDLIDGLVQGLGAHSQDLLFPQGTKDLTILKIMLECLQDPVHEVRQSCFALLGDIVYFFNSELVIGNLEDFLKLIGTEIMHNDDSDGTPAVINAIWALGLISERIDLNTYIIDMS RIILDLFTTNTQIVDSSVMENLSVTIGKMGLTHPEVFSSGAFANDSNWNKWCLSVNALDDVEEKSSAYMGFLKIINLTSTEVTMSNDTIHKIVTGLSSNVEANVFAQEIYTFLMNHSAQISAINFTPDEI SFLQQFTS

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:8849456}. Nucleus, nuclear pore complex {Experimental EvidencePubMed:8849456}. Nucleus {Experimental EvidencePubMed:8849456}. Note=Predominantly cytoplasmic. {Experimental EvidencePubMed:8849456}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cellular Bud Neck (GO:0005935) Cellular Bud Tip (GO:0005934) Cytosol (GO:0005829) Nuclear Pore (GO:0005643) Nucleus (GO:0005634)

Biology & Function

Description
Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for arginine/glycine-rich nuclear localization signals (rg-NLS) and PY-NLS in cargo substrates. Its predominant cargo substrate seems to be mRNA-binding proteins. Required for nuclear transport of NAB2, HRP1/NAB4 and TFG2. Mediates docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to repeat-containing nucleoporins (PubMed:8849456, PubMed:9488461, PubMed:10506153, PubMed:19366694). The complex is subsequently translocated through the pore by an energy requiring, Ran- dependent mechanism (PubMed:11423015). At the nucleoplasmic side of the NPC, GTP-Ran binding leads to release of the cargo. Efficient GTP-Ran- mediated substrate release requires RNA (PubMed:10506153). The importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (PubMed:11423015). {Experimental EvidencePubMed:10506153, Experimental EvidencePubMed:19366694, Experimental EvidencePubMed:8849456, Experimental EvidencePubMed:9488461, Curator InferencePubMed:11423015}.
Assigned Ontology terms

Biological Process	Exit From Mitosis (GO:0010458) MRNA Transport (GO:0051028) Protein Import Into Nucleus (GO:0006606)
Molecular Function	Nuclear Import Signal Receptor Activity (GO:0061608) Nuclear Localization Sequence Binding (GO:0008139)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P22147	5'-3' exoribonuclease 1	EBI-810745	0.35
P25491	Mitochondrial protein import protein MAS5	EBI-3663671	0.35
P40069	Importin subunit beta-4	EBI-810745	0.35
Interactions with other proteins (119 interactors)

Partner (UniProt)		IntAct	Confidence score
P53755	Bypass of stop codon protein 5	EBI-390534	0.37
P28004	Pre-mRNA-processing protein 45	EBI-393432	0.37
P32505	Nuclear polyadenylated RNA-binding protein NAB2	EBI-7096661	0.85
P23641	Mitochondrial phosphate carrier protein (Mitochondrial import receptor) (Phosphate transport protein) (PTP) (mPic 1) (p32) [Cleaved into: Mitochondrial phosphate carrier protein, N-terminally processed]	EBI-787315	0.53
Q99190	Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Enoyl reductase TSC13) (Temperature-sensitive CSG2 suppressor protein 13) (Trans-2-enoyl-CoA reductase)	EBI-787497	0.35
P18414	ER lumen protein-retaining receptor (Endoplasmic reticulum retention defective protein 2) (HDEL receptor)	EBI-787591	0.35
P50085	Prohibitin-2	EBI-789689	0.35
P53045	C-4 methylsterol oxidase ERG25 (EC 1.14.18.-) (Ergosterol biosynthetic protein 25) (Sterol-C4-methyl oxidase ERG25) (SMO)	EBI-790631	0.35
P04840	Mitochondrial outer membrane protein porin 1 (Voltage-dependent anion-selective channel protein 1) (VDAC-1)	EBI-793754	0.35
P53217	Uncharacterized membrane protein YGR026W	EBI-795519	0.35
Q04182	ATP-dependent permease PDR15	EBI-802063	0.35
P40035	Mitochondrial phosphate carrier protein 2 (Phosphate transport protein 2) (PTP 2) (Pi carrier isoform 2) (mPic 2)	EBI-805054	0.35
P40970	Serine palmitoyltransferase 2 (SPT 2) (EC 2.3.1.50) (Long chain base biosynthesis protein 2)	EBI-805812	0.35
P32340	Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial (EC 1.6.5.9) (Internal NADH dehydrogenase) (NADH:ubiquinone reductase (non-electrogenic))	EBI-807081	0.35
P16140	V-type proton ATPase subunit B (V-ATPase subunit B) (V-ATPase 57 kDa subunit) (Vacuolar proton pump subunit B)	EBI-810745	0.53
P07259	Protein URA2 [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)]	EBI-810745	0.35
P02557	Tubulin beta chain (Beta-tubulin)	EBI-810745	0.53
P09733	Tubulin alpha-1 chain (EC 3.6.5.-)	EBI-810745	0.53
P02994	Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A)	EBI-810745	0.35
P10592	Heat shock protein SSA2	EBI-810745	0.35
P05753	40S ribosomal protein S4-B (RP5) (S7) (Small ribosomal subunit protein eS4-B) (YS6)	EBI-810745	0.35
P05756	40S ribosomal protein S13 (S27a) (Small ribosomal subunit protein uS15) (YS15)	EBI-810745	0.35
P46654	40S ribosomal protein S0-B (Nucleic acid-binding protein NAB1B) (Small ribosomal subunit protein uS2-B)	EBI-810745	0.35
P05317	60S acidic ribosomal protein P0 (A0) (L10e) (Large ribosomal subunit protein uL10)	EBI-810745	0.35
P26321	60S ribosomal protein L5 (L1) (L1a) (Large ribosomal subunit protein uL18) (Ribosomal 5S RNA-binding protein) (YL3)	EBI-810745	0.35
P17079	60S ribosomal protein L12-A (L15) (Large ribosomal subunit protein uL11-A) (YL23)	EBI-810745	0.35
P41940	Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1-phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP-hexose pyrophosphorylase)	EBI-810745	0.35
Q99383	Nuclear polyadenylated RNA-binding protein 4 (Cleavage factor IB) (CFIB) (Heterogeneous nuclear ribonucleoprotein 1)	EBI-810745	0.74
P33892	eIF-2-alpha kinase activator GCN1 (General control non-derepressible protein 1) (Translational activator GCN1)	EBI-810745	0.44
P38737	Proteasome component ECM29 (Extracellular mutant protein 29)	EBI-810745	0.44
Q03690	Clustered mitochondria protein 1 (Translation initiation factor 31) (eIF3-associated protein p135)	EBI-810745	0.44
P19414	Aconitate hydratase, mitochondrial (Aconitase) (EC 4.2.1.3) (Citrate hydro-lyase)	EBI-819157	0.27
P37898	Alanine/arginine aminopeptidase (EC 3.4.11.-)	EBI-819689	0.27
Q06417	Uncharacterized oxidoreductase TDA5 (EC 1.-.-.-) (Topoisomerase I damage affected protein 5)	EBI-7172788	0.40
P46367	Potassium-activated aldehyde dehydrogenase, mitochondrial (EC 1.2.1.-) (EC 1.2.1.4) (K(+)-activated acetaldehyde dehydrogenase) (K(+)-ACDH)	EBI-7211426	0.59
P05755	40S ribosomal protein S9-B (RP21) (S13) (Small ribosomal subunit protein uS4-B) (YP28) (YS11)	EBI-7381628	0.40
P25303	DnaJ-related protein SCJ1 (J protein SCJ1)	EBI-3659291	0.35
P32589	Heat shock protein homolog SSE1 (Chaperone protein MSI3)	EBI-3726134	0.35
P46988	Prefoldin subunit 1 (Genes involved in microtubule biogenesis protein 6) (Gim complex subunit 6) (GimC subunit 6)	EBI-3737859	0.35
P33416	Heat shock protein 78, mitochondrial	EBI-3745075	0.35
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-3752383	0.35
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-3780543	0.53
P40150	Ribosome-associated molecular chaperone SSB2 (EC 3.6.4.10) (Heat shock protein SSB2) (Hsp70 chaperone Ssb)	EBI-3798846	0.35
Q00916	U1 small nuclear ribonucleoprotein 70 kDa homolog (U1 70K) (U1 snRNP 70 kDa homolog) (U1-70K) (U1 small nuclear ribonucleoprotein SNP1) (U1 snRNP protein SNP1)	EBI-15707559	0.44
P04821	Cell division control protein 25	EBI-15707580	0.44
Q03497	Serine/threonine-protein kinase STE20 (EC 2.7.11.1)	EBI-15707601	0.44
P53919	H/ACA ribonucleoprotein complex non-core subunit NAF1 (Nuclear assembly factor 1)	EBI-15707664	0.44
P10080	Single-stranded nucleic acid-binding protein	EBI-15707685	0.44
P52272	Heterogeneous nuclear ribonucleoprotein M (hnRNP M)	EBI-15707706	0.44
P41896	Transcription initiation factor IIF subunit beta (TFIIF medium subunit) (TFIIF-beta) (Transcription factor G 54 kDa subunit)	EBI-15707727	0.59
P09232	Cerevisin (EC 3.4.21.48) (Proteinase YSCB) (Vacuolar protease B) (PrB)	EBI-15707748	0.44
Q03063	Down-regulator of invasive growth 1 (Regulator of STE12 protein 1) (Regulator of sterile twelve 1)	EBI-15707769	0.44
P32611	54S ribosomal protein RML2, mitochondrial (L2) (Mitochondrial large ribosomal subunit protein uL2m)	EBI-15707811	0.44
P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	EBI-15707790	0.44
P38333	Essential nuclear protein 1	EBI-15707890	0.59
Q12386	Actin-like protein ARP8	EBI-15707911	0.44
P04173	3-isopropylmalate dehydrogenase (3-IPM-DH) (IMDH) (EC 1.1.1.85) (Beta-IPM dehydrogenase)	EBI-16271726	0.35
P41920	Ran-specific GTPase-activating protein 1 (Chromosome stability protein 20) (Perinuclear array-localized protein) (Ran-binding protein 1) (RANBP1)	EBI-16271726	0.35
P53962	Uncharacterized WD repeat-containing protein YNL035C	EBI-16271726	0.35
P40215	External NADH-ubiquinone oxidoreductase 1, mitochondrial (EC 1.6.5.9) (External NADH dehydrogenase 1)	EBI-16271726	0.35
P36139	Protein PET10 (Petite colonies protein 10)	EBI-16271726	0.35
P38708	Putative proline--tRNA ligase YHR020W (EC 6.1.1.15) (Prolyl-tRNA synthetase) (ProRS)	EBI-16271726	0.35
Q04013	Citrate/oxoglutarate carrier protein (Coc1p) (Mitochondrial DNA replication protein YHM2)	EBI-16271726	0.35
Q12447	Polyamine N-acetyltransferase 1 (EC 2.3.1.-) (Arylalkylamine N-acetyltransferase homolog) (scAANAT)	EBI-16271726	0.35
Q12443	Reticulon-like protein 2	EBI-16271726	0.35
Q07395	Synchronized import protein 1 (Symportin 1)	EBI-16271726	0.35
P32610	V-type proton ATPase subunit D (V-ATPase subunit D) (Vacuolar proton pump subunit D)	EBI-16271726	0.35
P07806	Valine--tRNA ligase, mitochondrial (EC 6.1.1.9) (Valyl-tRNA synthetase) (ValRS)	EBI-16271726	0.35
P28274	CTP synthase 1 (EC 6.3.4.2) (CTP synthetase 1) (UTP--ammonia ligase 1)	EBI-16271726	0.35
P09734	Tubulin alpha-3 chain (EC 3.6.5.-)	EBI-16271726	0.35
P00358	Glyceraldehyde-3-phosphate dehydrogenase 2 (GAPDH 2) (EC 1.2.1.12)	EBI-16271726	0.35
P00360	Glyceraldehyde-3-phosphate dehydrogenase 1 (GAPDH 1) (EC 1.2.1.12)	EBI-16271726	0.35
P0CS90	Import motor subunit, mitochondrial (EC 3.6.4.10) (Endonuclease SceI 75 kDa subunit) (Endo.SceI 75 kDa subunit) (mtHSP70)	EBI-16271726	0.35
P09435	Heat shock protein SSA3	EBI-16271726	0.35
P32368	Phosphatidylinositol-3-phosphatase SAC1 (EC 3.1.3.64) (Phosphatidylinositol-4-phosphate phosphatase) (Recessive suppressor of secretory defect)	EBI-16271726	0.35
Q03940	RuvB-like protein 1 (RUVBL1) (EC 3.6.4.12) (TIP49-homology protein 1) (TIP49a homolog)	EBI-16271726	0.35
P53549	26S proteasome subunit RPT4 (26S protease subunit SUG2) (Proteasomal cap subunit)	EBI-16271726	0.35
P33298	26S proteasome regulatory subunit 6B homolog (Protein YNT1) (Tat-binding homolog 2)	EBI-16271726	0.35
P39006	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase 1 beta chain; Phosphatidylserine decarboxylase 1 alpha chain]	EBI-16271726	0.35
P05030	Plasma membrane ATPase 1 (EC 7.1.2.1) (Proton pump 1)	EBI-16271726	0.35
P37012	Phosphoglucomutase 2 (PGM 2) (EC 5.4.2.2) (D-glucose-1,6-diphosphate:D-glucose-1-phosphate phosphotransferase) (Glucose phosphomutase 2)	EBI-16271726	0.35
P12709	Glucose-6-phosphate isomerase (GPI) (EC 5.3.1.9) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI)	EBI-16271726	0.35
P18239	ADP,ATP carrier protein 2 (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) (Petite colonies protein 9)	EBI-16271726	0.35
P06169	Pyruvate decarboxylase isozyme 1 (EC 4.1.1.-) (EC 4.1.1.43) (EC 4.1.1.72) (EC 4.1.1.74) (Thiamine pyrophosphate-dependent 2-oxo-acid decarboxylase) (2ODC)	EBI-16271726	0.35
P04147	Polyadenylate-binding protein, cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein)	EBI-16271726	0.35
P32332	Mitochondrial oxaloacetate transport protein (Mitochondrial carrier protein PMT)	EBI-16271726	0.35
P33201	Ribosome assembly factor MRT4 (mRNA turnover protein 4)	EBI-16271726	0.35
P39692	Sulfite reductase [NADPH] flavoprotein component (EC 1.8.1.2)	EBI-16271726	0.35
P40495	Homoisocitrate dehydrogenase, mitochondrial (HIcDH) (EC 1.1.1.87)	EBI-16271726	0.35
P38130	Probable mannosyltransferase KTR3 (EC 2.4.1.-)	EBI-16271726	0.35
P06168	Ketol-acid reductoisomerase, mitochondrial (EC 1.1.1.86) (Acetohydroxy-acid reductoisomerase) (Alpha-keto-beta-hydroxylacyl reductoisomerase) (Isoleucine-plus-valine requiring protein 5)	EBI-16271726	0.35
P07342	Acetolactate synthase catalytic subunit, mitochondrial (EC 2.2.1.6) (Acetohydroxy-acid synthase catalytic subunit) (AHAS) (ALS)	EBI-16271726	0.35
P28834	Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial (EC 1.1.1.41) (Isocitric dehydrogenase) (NAD(+)-specific ICDH)	EBI-16271726	0.35
P04806	Hexokinase-1 (EC 2.7.1.1) (Hexokinase PI) (Hexokinase-A)	EBI-16271726	0.35
P04912	Histone H2A.2	EBI-16271726	0.35
P02829	ATP-dependent molecular chaperone HSP82 (82 kDa heat shock protein) (Heat shock protein Hsp90 heat-inducible isoform)	EBI-16271726	0.35
P19882	Heat shock protein 60, mitochondrial (CPN60) (P66) (Stimulator factor I 66 kDa component)	EBI-16271726	0.35
P15992	Heat shock protein 26 (26 kDa heat shock protein)	EBI-16271726	0.35
P16622	Ferrochelatase, mitochondrial (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase)	EBI-16271726	0.35
P32836	GTP-binding nuclear protein GSP2/CNR2	EBI-16271726	0.35
P32835	GTP-binding nuclear protein GSP1/CNR1 (Chromosome stability protein 17) (GTPase Ran homolog) (Genetic suppressor of PRP20-1)	EBI-16271726	0.35
P14742	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (GFAT) (EC 2.6.1.16) (D-fructose-6-phosphate amidotransferase) (Hexosephosphate aminotransferase)	EBI-16271726	0.35
P07262	NADP-specific glutamate dehydrogenase 1 (NADP-GDH 1) (EC 1.4.1.4) (NADP-dependent glutamate dehydrogenase 1)	EBI-16271726	0.35
P28007	H/ACA ribonucleoprotein complex subunit GAR1 (Glycine/arginine-rich protein 1) (snoRNP protein GAR1)	EBI-16271726	0.35
P04397	Bifunctional protein GAL10 [Includes: UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)]	EBI-16271726	0.35
P14540	Fructose-bisphosphate aldolase (FBP aldolase) (FBPA) (EC 4.1.2.13) (Fructose-1,6-bisphosphate aldolase)	EBI-16271726	0.35
P30624	Long-chain-fatty-acid--CoA ligase 1 (EC 6.2.1.3) (Fatty acid activator 1) (Fatty acyl-CoA synthetase) (ACS) (FACS) (Long-chain acyl-CoA synthetase 1)	EBI-16271726	0.35
P00924	Enolase 1 (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase 1) (2-phosphoglycerate dehydratase 1)	EBI-16271726	0.35
P04802	Aspartate--tRNA ligase, cytoplasmic (EC 6.1.1.12) (Aspartyl-tRNA synthetase) (AspRS)	EBI-16271726	0.35
P41819	Dimethyladenosine transferase (EC 2.1.1.183) (18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase) (18S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase)	EBI-16271726	0.35
P07253	Cytochrome B pre-mRNA-processing protein 6	EBI-16271726	0.35
P29311	Protein BMH1	EBI-16271726	0.35
P15703	Glucan 1,3-beta-glucosidase (EC 3.2.1.58) (Exo-1,3-beta-glucanase) (GP29) (Soluble cell wall protein 9)	EBI-16271726	0.35
P40471	NADPH-dependent 1-acyldihydroxyacetone phosphate reductase (ADR) (EC 1.1.1.101) (1-acyl DHAP reductase) (Acyl/alkyl DHAP reductase) (Acylglycerone-phosphate reductase) (Triacylglycerol lipase AYR1) (TAG lipase) (EC 3.1.1.3)	EBI-16271726	0.35
P07251	ATP synthase subunit alpha, mitochondrial	EBI-16271726	0.35
P08566	Pentafunctional AROM polypeptide [Includes: 3-dehydroquinate synthase (DHQS) (EC 4.2.3.4); 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS); Shikimate kinase (SK) (EC 2.7.1.71); 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10); Shikimate dehydrogenase (EC 1.1.1.25)]	EBI-16271726	0.35
P46672	tRNA-aminoacylation cofactor ARC1 (Acyl-RNA-complex protein 1) (GU4 nucleic-binding protein 1) (G4p1 protein) (P42) (tRNA-interacting factor ARC1)	EBI-16271726	0.35
P07248	Regulatory protein ADR1	EBI-16271726	0.35
P10127	Alcohol dehydrogenase 4 (EC 1.1.1.1) (Alcohol dehydrogenase IV) (ADHIV)	EBI-16271726	0.35

Cross-References

Database	Links
UNIPROT	P38217 D6VQ19
Pfam	PF02985

Importin subunit beta-2 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Interactions with other proteins (119 interactors)

Cross-References

Database

Links

Description

Description