Monopolar spindle protein 2 - Saccharomyces cerevisiae S288C

Monopolar spindle protein 2 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Monopolar spindle protein 2
Accession Code	P53159
Gene	MPS2
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 387)
MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSEINKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLNSPSKFLVENK NKNTEGAGISTPRKKLTESPIKLLSRNNIGKALEVQVEELKRELTAKQSLLQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQKAILEEFRRRLQRQTDTISF LKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISAVPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWFFEDQTDLETEYRSNANVDDAYSRVFGI

Subcellular Location

Description
Nucleus membrane {Experimental EvidencePubMed:10397772}; Single-pass membrane protein {Experimental EvidencePubMed:10397772}. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body {Experimental EvidencePubMed:10397772}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Endoplasmic Reticulum (GO:0005783) Meiotic Nuclear Membrane Microtubule Tethering Complex (GO:0034993) Membrane (GO:0016020) Mitotic Nuclear Membrane Microtubule Tethering Complex (GO:0106084) Nuclear Envelope (GO:0005635) Nuclear Outer Membrane (GO:0005640) Spindle Pole Body (GO:0005816)

Biology & Function

Description
Component of the spindle pole body (SPB) required for insertion of the nascent SPB into the nuclear envelope and for the proper execution of spindle pole body (SPB) duplication. {Experimental EvidencePubMed:10397772, Experimental EvidencePubMed:10654940, Experimental EvidencePubMed:11952896, Experimental EvidencePubMed:12399372, Experimental EvidencePubMed:16436507, Experimental EvidencePubMed:16923827, Experimental EvidencePubMed:1869587, Experimental EvidencePubMed:9060463}.
Assigned Ontology terms

Biological Process	Karyogamy (GO:0000741) Mitotic Spindle Pole Body Localization (GO:1990608) Protein Localization To Spindle Pole Body (GO:0071988) Spindle Pole Body Duplication (GO:0030474)
Molecular Function	Cytoskeleton-Nuclear Membrane Anchor Activity (GO:0140444) Structural Molecule Activity (GO:0005198)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P47069	Spindle pole body assembly component MPS3	EBI-2212852	0.59
P53159	Self	EBI-3870981	0.37
P25491	Mitochondrial protein import protein MAS5	EBI-3765215	0.35
P40457	Protein MLP2	EBI-2212931	0.40
Interactions with other proteins (12 interactors)

Partner (UniProt)		IntAct	Confidence score
Q04477	Kinetochore protein SPC24	EBI-598164	0.78
P47149	Kinetochore-associated protein NNF1	EBI-599182	0.37
Q12365	Spindle pole component BBP1 (BFR1-binding protein 1)	EBI-1007115	0.72
P53930	Protein AF-9 homolog	EBI-1007124	0.37
P36094	Spindle pole body component SPC42	EBI-2133025	0.35
P52919	NAP1-binding protein	EBI-2132982	0.51
P14832	Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) (Cyclophilin) (CPH) (Cyclosporin A-binding protein) (PPI-II) (Rotamase)	EBI-2882919	0.00
P32472	Peptidyl-prolyl cis-trans isomerase FPR2 (PPIase FPR2) (EC 5.2.1.8) (13-kDa membrane-associated FK506-binding protein) (FKBP-13) (FK506-binding protein 2) (FKBP proline rotamase 2) (FKBP-15)	EBI-2883301	0.00
P38265	Inner kinetochore subunit IML3 (CENP-L homolog) (Constitutive centromere-associated network protein IML3) (Increased minichromosome loss protein 3) (Minichromosome maintenance protein 19)	EBI-2885494	0.00
P27692	Transcription elongation factor SPT5 (Chromatin elongation factor SPT5)	EBI-2888169	0.00
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-3781150	0.35
P40150	Ribosome-associated molecular chaperone SSB2 (EC 3.6.4.10) (Heat shock protein SSB2) (Hsp70 chaperone Ssb)	EBI-3799382	0.35

Cross-References

Database	Links
UNIPROT	P53159 D6VU69
Pfam	PF17060

Monopolar spindle protein 2 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Interactions with other proteins (12 interactors)

Cross-References

Database

Links

Description

Description