Protein MLP2 - Saccharomyces cerevisiae S288C

Protein MLP2 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Protein MLP2
Accession Code	P40457
Gene	MLP2
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 1679)
MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKRVKEEYDIWQS RDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKD TASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLED FILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVN ELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENKANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQC KKKTTLEDFENFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKI KELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALI ELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKEGALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLY SAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEV TQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDAS KKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTANSSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIE TLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLTFLDNKGSGEDAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVTNKEN NIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQPEVAVKAAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSSDPDTKKVKESPANDQASNE

Subcellular Location

Description
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body. Nucleus, nuclear pore complex {Experimental EvidencePubMed:24152732}. Note=Nuclear periphery, excluded from nuclear envelope adjacent to nucleolus.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Mitochondrion (GO:0005739) Nuclear Envelope (GO:0005635) Nuclear Pore (GO:0005643) Nuclear Pore Nuclear Basket (GO:0044615) Nucleoplasm (GO:0005654) Spindle Pole Body (GO:0005816)

Biology & Function

Description
Together with the closely related MLP1, involved in the structural and functional organization of perinuclear chromatin (PubMed:10638763). MLP1/MLP2 associate with the nuclear pore complex and form filamentous structures along the nuclear periphery (PubMed:10085285, PubMed:24152732, PubMed:10617624). Has a role in the localization of Esc1 to nucleolar regions (PubMed:24152732). Together with MLP1, mediates tethering of the some telomeres to the nuclear periphery, probably mediated by YKU70/YKU80 (HDF1/HDF2) heterodimer and show perinuclear location dependent silencing (PubMed:11862215). MLP1 and MLP2 are involved in telomere length regulation but not silencing or telomere anchoring (PubMed:12490156). Plays a role in the incorporation of components into the spindle pole body (PubMed:10617624, PubMed:14718167, PubMed:16027220). Involved in double-strand break repair, probably also mediated by the YKU70/YKU80 (HDF1/HDF2) heterodimer (PubMed:10638763, PubMed:14718167, PubMed:16027220). {Experimental EvidencePubMed:10085285, Experimental EvidencePubMed:10617624, Experimental EvidencePubMed:10638763, Experimental EvidencePubMed:11862215, Experimental EvidencePubMed:12490156, Experimental EvidencePubMed:14718167, Experimental EvidencePubMed:16027220, Experimental EvidencePubMed:24152732}.
Assigned Ontology terms

Biological Process	MRNA Export From Nucleus (GO:0006406) Negative Regulation Of Protein Import Into Nucleus During Spindle Assembly Checkpoint (GO:1901925) Nucleocytoplasmic Transport (GO:0006913) Poly(A)+ MRNA Export From Nucleus (GO:0016973) Post-Transcriptional Tethering Of RNA Polymerase II Gene DNA At Nuclear Periphery (GO:0000973) Protein Import Into Nucleus (GO:0006606) Regulation Of DNA-Templated Transcription (GO:0006355) Spindle Pole Body Organization (GO:0051300) Telomere Tethering At Nuclear Periphery (GO:0034398) Transcription-Dependent Tethering Of RNA Polymerase II Gene DNA At Nuclear Periphery (GO:0000972)
Molecular Function	Ribonucleoprotein Complex Binding (GO:0043021) Structural Constituent Of Nuclear Pore (GO:0017056)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (6 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P14906	Protein translocation protein SEC63	EBI-3769975	0.35
P30822	Exportin-1	EBI-11611503	0.35
P53159	Monopolar spindle protein 2	EBI-2212931	0.40
P06704	Cell division control protein 31	EBI-2212931	0.40
P25491	Mitochondrial protein import protein MAS5	EBI-3765175	0.35
Q02455	Protein MLP1	EBI-2212926	0.40
Interactions with other proteins (25 interactors)

Partner (UniProt)		IntAct	Confidence score
Q06411	Pre-mRNA-splicing factor SPP382 (CLF1 complex factor 8) (Nineteen complex-related protein 1) (NTC-related protein 1) (Suppressor of PRP38 protein 2)	EBI-857722	0.00
Q06512	Nucleolar complex protein 4 (U three protein 19) (U3 small nucleolar RNA-associated protein 19) (U3 snoRNA-associated protein 19)	EBI-7126570	0.40
P36106	Transcription factor BYE1 (Bypass of ESS1 protein 1)	EBI-8221031	0.22
P38863	Spindle pole body component SPC97	EBI-2212931	0.40
P53540	Spindle pole body component SPC98	EBI-2212931	0.40
P33419	Spindle pole component 29	EBI-2212931	0.52
P36094	Spindle pole body component SPC42	EBI-2212931	0.52
P39723	Spindle pole component SPC72	EBI-2212931	0.40
P32380	Spindle pole body component 110 (Extragenic suppressor of CMD1-1 mutant protein 1) (Nuclear filament-related protein 1) (Spindle pole body spacer protein SPC110)	EBI-2212931	0.52
Q12365	Spindle pole component BBP1 (BFR1-binding protein 1)	EBI-2212931	0.40
P06787	Calmodulin (CaM)	EBI-2212931	0.40
P53865	Chaotic nuclear migration protein 67	EBI-2212931	0.40
Q06677	Auxilin-like clathrin uncoating factor SWA2 (Bud site selection protein 24) (DnaJ-related protein SWA2) (J protein SWA2) (Synthetic lethal with ARF1 protein 2)	EBI-3758629	0.35
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-3772417	0.35
P09435	Heat shock protein SSA3	EBI-3775422	0.35
P32590	Heat shock protein homolog SSE2	EBI-3776771	0.35
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-3781048	0.35
P39987	Heat shock protein SSC3, mitochondrial (Extracellular mutant protein 10)	EBI-3787834	0.35
P38788	Ribosome-associated complex subunit SSZ1 (DnaK-related protein SSZ1) (Heat shock protein 70 homolog SSZ1) (Pleiotropic drug resistance protein 13)	EBI-3790519	0.35
P10592	Heat shock protein SSA2	EBI-3794434	0.35
P40150	Ribosome-associated molecular chaperone SSB2 (EC 3.6.4.10) (Heat shock protein SSB2) (Hsp70 chaperone Ssb)	EBI-3799310	0.35
P32589	Heat shock protein homolog SSE1 (Chaperone protein MSI3)	EBI-3806012	0.35
P02829	ATP-dependent molecular chaperone HSP82 (82 kDa heat shock protein) (Heat shock protein Hsp90 heat-inducible isoform)	EBI-3812471	0.35
P20081	FK506-binding protein 1 (FKBP) (12-kDa cytosolic FK506-binding protein) (FKBP-12) (Peptidyl-prolyl cis-trans isomerase) (PPIase) (EC 5.2.1.8) (Rapamycin-binding protein)	EBI-16269289	0.35
P53916	Probable phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TEP1 (EC 3.1.3.67)	EBI-16285181	0.35

Cross-References

Database	Links
UNIPROT	P40457 D6VVD8

Protein MLP2 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (6 interactors)

Interactions with other proteins (25 interactors)

Cross-References

Database

Links

Description

Description