Protein Information |
|
---|---|
Protein Name | Nucleoprotein |
Accession Code | P59595 |
Gene | N |
Organism | Severe acute respiratory syndrome-related coronavirus (Taxonomy: 694009) |
Part of Reference Proteome? | Yes |
Sequence (Length: 422) | |
MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSG PDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVL QLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQ QQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSR IGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAAD MDDFSRQLQNSMSGASADSTQA |
Structure Viewer (PDB: 2OFZ) |
---|
Description |
||
---|---|---|
Virion {Sequence AnalysisHAMAP-Rule:MF_04096, Experimental EvidencePubMed:17210170, Experimental EvidencePubMed:19106108}. Host endoplasmic reticulum-Golgi intermediate compartment {Sequence AnalysisHAMAP-Rule:MF_04096, Experimental EvidencePubMed:17210170}. Host Golgi apparatus {Sequence AnalysisHAMAP-Rule:MF_04096, Experimental EvidencePubMed:17210170}. Host cytoplasm, host perinuclear region {Experimental EvidencePubMed:17210170}. Note=Located inside the virion, complexed with the viral RNA. Probably associates with ER-derived membranes where it participates in viral RNA synthesis and virus budding. {Sequence AnalysisHAMAP-Rule:MF_04096}. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Host Perinuclear Region | SL-0382 | The host perinuclear region is the host cytoplasmic region just around the host nucleus. Note: This location is defined for viral proteins that appear in the perinuclear region of infected host cells | Membrane Topology |
Topology | Source | Annotation Type |
Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
Cellular Component | Host Cell Endoplasmic Reticulum-Golgi Intermediate Compartment (GO:0044172) Host Cell Golgi Apparatus (GO:0044177) Host Cell Perinuclear Region Of Cytoplasm (GO:0044220) Plasma Membrane (GO:0005886) Ribonucleoprotein Complex (GO:1990904) Viral Capsid (GO:0019028) Viral Nucleocapsid (GO:0019013) |
Description |
|
---|---|
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication (PubMed:17210170). May modulate transforming growth factor-beta signaling by binding host SMAD3 (PubMed:18055455). {Sequence AnalysisHAMAP- Rule:MF_04096, Experimental EvidencePubMed:17210170, Experimental EvidencePubMed:18055455}. | Assigned Ontology terms |
Biological Process | Viral RNA Genome Packaging (GO:0019074) |
Molecular Function | DNA Binding (GO:0003677) Identical Protein Binding (GO:0042802) Molecular Adaptor Activity (GO:0060090) RNA Binding (GO:0003723) |
Interactions with Nuclear Envelope proteins (15 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
O75569 | Interferon-inducible double-stranded RNA-dependent protein kinase activator A | EBI-25639357 | 0.54 |
P63165 | Small ubiquitin-related modifier 1 | EBI-7602710 | 0.54 |
P59595 | Self | EBI-7602801 | 0.98 |
P63279 | SUMO-conjugating enzyme UBC9 | EBI-25497306 | 0.75 |
Q8NEF9 | Serum response factor-binding protein 1 | EBI-27129966 | 0.35 |
Q8NDT2 | Putative RNA-binding protein 15B | EBI-27129966 | 0.35 |
Q9BVI4 | Nucleolar complex protein 4 homolog | EBI-27129966 | 0.35 |
Q9Y224 | RNA transcription, translation and transport factor protein | EBI-27129966 | 0.35 |
Q9H6S0 | 3'-5' RNA helicase YTHDC2 | EBI-27129966 | 0.35 |
O43709 | Probable 18S rRNA (guanine-N(7))-methyltransferase | EBI-27129966 | 0.35 |
P24385 | G1/S-specific cyclin-D1 | EBI-25746873 | 0.58 |
Q96C57 | Protein CUSTOS | EBI-27129966 | 0.35 |
P19525 | Interferon-induced, double-stranded RNA-activated protein kinase | EBI-26984718 | 0.40 |
Q9UII4 | E3 ISG15--protein ligase HERC5 | EBI-27129966 | 0.35 |
Q14244 | Ensconsin | EBI-27129966 | 0.35 | Interactions with other proteins (240 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed] | EBI-7613676 | 0.60 |
P61769 | Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3] | EBI-25487169 | 0.52 |
P59596 | Membrane protein (M protein) (E1 glycoprotein) (Matrix glycoprotein) (Membrane glycoprotein) | EBI-25493215 | 0.91 |
Q05639 | Elongation factor 1-alpha 2 (EF-1-alpha-2) (Eukaryotic elongation factor 1 A-2) (eEF1A-2) (Statin-S1) | EBI-25498109 | 0.69 |
P62937 | Peptidyl-prolyl cis-trans isomerase A (PPIase A) (EC 5.2.1.8) (Cyclophilin A) (Cyclosporin A-binding protein) (Rotamase A) [Cleaved into: Peptidyl-prolyl cis-trans isomerase A, N-terminally processed] | EBI-25499625 | 0.68 |
P13645 | Keratin, type I cytoskeletal 10 (Cytokeratin-10) (CK-10) (Keratin-10) (K10) | EBI-25635560 | 0.35 |
P04264 | Keratin, type II cytoskeletal 1 (67 kDa cytokeratin) (Cytokeratin-1) (CK-1) (Hair alpha protein) (Keratin-1) (K1) (Type-II keratin Kb1) | EBI-25635560 | 0.35 |
P62333 | 26S proteasome regulatory subunit 10B (26S proteasome AAA-ATPase subunit RPT4) (Proteasome 26S subunit ATPase 6) (Proteasome subunit p42) | EBI-25635560 | 0.56 |
Q9HC16 | DNA dC->dU-editing enzyme APOBEC-3G (EC 3.5.4.38) (APOBEC-related cytidine deaminase) (APOBEC-related protein) (ARCD) (APOBEC-related protein 9) (ARP-9) (CEM-15) (CEM15) (Deoxycytidine deaminase) (A3G) | EBI-25641899 | 0.40 |
P59637 | Envelope small membrane protein (E protein) (sM protein) | EBI-25668008 | 0.57 |
P84022 | Mothers against decapentaplegic homolog 3 (MAD homolog 3) (Mad3) (Mothers against DPP homolog 3) (hMAD-3) (JV15-2) (SMAD family member 3) (SMAD 3) (Smad3) (hSMAD3) | EBI-25682920 | 0.40 |
P84025 | Mothers against decapentaplegic homolog 3 (MAD homolog 3) (Mad3) (Mothers against DPP homolog 3) (SMAD family member 3) (SMAD 3) (Smad3) | EBI-25683178 | 0.52 |
P24941 | Cyclin-dependent kinase 2 (EC 2.7.11.22) (Cell division protein kinase 2) (p33 protein kinase) | EBI-25746912 | 0.35 |
P20248 | Cyclin-A2 (Cyclin-A) (Cyclin A) | EBI-25746912 | 0.35 |
P59594 | Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) [Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2'] | EBI-25823635 | 0.27 |
Q9Y3U8 | 60S ribosomal protein L36 (Large ribosomal subunit protein eL36) | EBI-26376911 | 0.35 |
Q9HCE1 | Helicase MOV-10 (EC 3.6.4.13) (Armitage homolog) (Moloney leukemia virus 10 protein) | EBI-26376911 | 0.35 |
P68400 | Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1) | EBI-26376911 | 0.35 |
P11940 | Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1) | EBI-26376911 | 0.53 |
O76021 | Ribosomal L1 domain-containing protein 1 (CATX-11) (Cellular senescence-inhibited gene protein) (Protein PBK1) | EBI-26376911 | 0.35 |
Q9UN86 | Ras GTPase-activating protein-binding protein 2 (G3BP-2) (GAP SH3 domain-binding protein 2) | EBI-26376911 | 0.74 |
Q9BQ75 | Protein CMSS1 (Cms1 ribosomal small subunit homolog) | EBI-26376911 | 0.53 |
Q8TAD8 | Smad nuclear-interacting protein 1 (FHA domain-containing protein SNIP1) | EBI-26376911 | 0.53 |
Q8NCA5 | Protein FAM98A | EBI-26376911 | 0.53 |
Q86U42 | Polyadenylate-binding protein 2 (PABP-2) (Poly(A)-binding protein 2) (Nuclear poly(A)-binding protein 1) (Poly(A)-binding protein II) (PABII) (Polyadenylate-binding nuclear protein 1) | EBI-26376911 | 0.35 |
Q6PKG0 | La-related protein 1 (La ribonucleoprotein domain family member 1) | EBI-26376911 | 0.53 |
Q13310 | Polyadenylate-binding protein 4 (PABP-4) (Poly(A)-binding protein 4) (Activated-platelet protein 1) (APP-1) (Inducible poly(A)-binding protein) (iPABP) | EBI-26376911 | 0.53 |
Q13283 | Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1) | EBI-26376911 | 0.89 |
P67870 | Casein kinase II subunit beta (CK II beta) (Phosvitin) (Protein G5a) | EBI-26376911 | 0.35 |
P19784 | Casein kinase II subunit alpha' (CK II alpha') (EC 2.7.11.1) | EBI-26376911 | 0.35 |
P16989 | Y-box-binding protein 3 (Cold shock domain-containing protein A) (DNA-binding protein A) (Single-strand DNA-binding protein NF-GMB) | EBI-26376911 | 0.53 |
O75683 | Surfeit locus protein 6 | EBI-26376911 | 0.53 |
O43818 | U3 small nucleolar RNA-interacting protein 2 (RRP9 homolog) (U3 small nucleolar ribonucleoprotein-associated 55 kDa protein) (U3 snoRNP-associated 55 kDa protein) (U3-55K) | EBI-26376911 | 0.35 |
Q92831 | Histone acetyltransferase KAT2B (EC 2.3.1.48) (Histone acetyltransferase PCAF) (Histone acetylase PCAF) (Lysine acetyltransferase 2B) (P300/CBP-associated factor) (P/CAF) (Spermidine acetyltransferase KAT2B) (EC 2.3.1.57) | EBI-26971417 | 0.44 |
Q92830 | Histone acetyltransferase KAT2A (EC 2.3.1.48) (General control of amino acid synthesis protein 5-like 2) (Histone acetyltransferase GCN5) (hGCN5) (Histone glutaryltransferase KAT2A) (EC 2.3.1.-) (Histone succinyltransferase KAT2A) (EC 2.3.1.-) (Lysine acetyltransferase 2A) (STAF97) | EBI-26971428 | 0.44 |
Q14258 | E3 ubiquitin/ISG15 ligase TRIM25 (EC 6.3.2.n3) (Estrogen-responsive finger protein) (RING finger protein 147) (RING-type E3 ubiquitin transferase) (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIM25) (Tripartite motif-containing protein 25) (Ubiquitin/ISG15-conjugating enzyme TRIM25) (Zinc finger protein 147) | EBI-27086792 | 0.46 |
P23249 | Putative helicase MOV-10 (EC 3.6.4.13) (Moloney leukemia virus 10 protein) | EBI-27090990 | 0.40 |
Q14011 | Cold-inducible RNA-binding protein (A18 hnRNP) (Glycine-rich RNA-binding protein CIRP) | EBI-27129966 | 0.35 |
Q8WU68 | Splicing factor U2AF 26 kDa subunit (U2 auxiliary factor 26) (U2 small nuclear RNA auxiliary factor 1-like protein 4) (U2AF1-like 4) (U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3) (U2 small nuclear RNA auxiliary factor 1-like protein 3) (U2AF1-like protein 3) | EBI-27129966 | 0.35 |
Q13585 | Melatonin-related receptor (G protein-coupled receptor 50) (H9) | EBI-27129966 | 0.35 |
Q8TBB5 | Kelch domain-containing protein 4 | EBI-27129966 | 0.35 |
Q9Y388 | RNA-binding motif protein, X-linked 2 | EBI-27129966 | 0.35 |
P20719 | Homeobox protein Hox-A5 (Homeobox protein Hox-1C) | EBI-27129966 | 0.35 |
Q9NWT1 | p21-activated protein kinase-interacting protein 1 (PAK/PLC-interacting protein 1) (hPIP1) (PAK1-interacting protein 1) (WD repeat-containing protein 84) | EBI-27129966 | 0.35 |
E9PRG8 | Uncharacterized protein C11orf98 | EBI-27129966 | 0.35 |
Q96G21 | U3 small nucleolar ribonucleoprotein protein IMP4 (U3 snoRNP protein IMP4) (Brix domain-containing protein 4) | EBI-27129966 | 0.35 |
Q96EU6 | Ribosomal RNA processing protein 36 homolog | EBI-27129966 | 0.35 |
Q96P11 | 28S rRNA (cytosine-C(5))-methyltransferase (EC 2.1.1.-) (NOL1-related protein) (NOL1R) (NOL1/NOP2/Sun domain family member 5) (Williams-Beuren syndrome chromosomal region 20A protein) | EBI-27129966 | 0.35 |
Q9P2D0 | Inhibitor of Bruton tyrosine kinase (IBtk) | EBI-27129966 | 0.35 |
Q8WY91 | Peroxynitrite isomerase THAP4 (EC 5.99.-.-) (Ferric Homo sapiens nitrobindin) (Hs-Nb(III)) (THAP domain-containing protein 4) | EBI-27129966 | 0.35 |
Q9NQV6 | PR domain zinc finger protein 10 (EC 2.1.1.-) (PR domain-containing protein 10) (Tristanin) | EBI-27129966 | 0.35 |
Q32NC0 | UPF0711 protein C18orf21 (HBV X-transactivated gene 13 protein) (HBV XAg-transactivated protein 13) | EBI-27129966 | 0.35 |
Q9BY49 | Peroxisomal trans-2-enoyl-CoA reductase (TERP) (EC 1.3.1.38) (2,4-dienoyl-CoA reductase-related protein) (DCR-RP) (HPDHase) (Short chain dehydrogenase/reductase family 29C member 1) (pVI-ARL) | EBI-27129966 | 0.35 |
Q9Y6Y1 | Calmodulin-binding transcription activator 1 | EBI-27129966 | 0.35 |
Q86XN8 | RNA-binding protein MEX3D (RING finger and KH domain-containing protein 1) (RING finger protein 193) (TINO) | EBI-27129966 | 0.35 |
Q9NP64 | Zinc finger CCHC domain-containing protein 17 (Nucleolar protein of 40 kDa) (pNO40) (Pnn-interacting nucleolar protein) (Putative S1 RNA-binding domain protein) (PS1D protein) | EBI-27129966 | 0.35 |
Q9Y3A2 | Probable U3 small nucleolar RNA-associated protein 11 (U3 snoRNA-associated protein 11) (UTP11-like protein) | EBI-27129966 | 0.35 |
Q03188 | Centromere protein C (CENP-C) (Centromere autoantigen C) (Centromere protein C 1) (CENP-C 1) (Interphase centromere complex protein 7) | EBI-27129966 | 0.35 |
A6NFI3 | Zinc finger protein 316 | EBI-27129966 | 0.35 |
Q8WUQ7 | Cactin (Renal carcinoma antigen NY-REN-24) | EBI-27129966 | 0.35 |
O15213 | WD repeat-containing protein 46 (WD repeat-containing protein BING4) | EBI-27129966 | 0.35 |
Q5T280 | Putative methyltransferase C9orf114 (EC 2.1.1.-) (Centromere protein 32) (CENP-32) (Kinetochore-associated protein) (SPOUT domain-containing methyltransferase 1) | EBI-27129966 | 0.35 |
Q96EZ8 | Microspherule protein 1 (58 kDa microspherule protein) (Cell cycle-regulated factor p78) (INO80 complex subunit J) (MCRS2) | EBI-27129966 | 0.35 |
O14647 | Chromodomain-helicase-DNA-binding protein 2 (CHD-2) (EC 3.6.4.12) (ATP-dependent helicase CHD2) | EBI-27129966 | 0.35 |
A8MTY0 | Zinc finger protein 724 | EBI-27129966 | 0.35 |
Q8IUH3 | RNA-binding protein 45 (Developmentally-regulated RNA-binding protein 1) (RB-1) (RNA-binding motif protein 45) | EBI-27129966 | 0.35 |
Q8IYN0 | Zinc finger protein 100 | EBI-27129966 | 0.35 |
Q86Y79 | Probable peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | EBI-27129966 | 0.35 |
Q15397 | Pumilio homolog 3 (HBV X-transactivated gene 5 protein) (HBV XAg-transactivated protein 5) (Minor histocompatibility antigen HA-8) (HLA-HA8) | EBI-27129966 | 0.35 |
Q14191 | Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN (DNA helicase, RecQ-like type 3) (RecQ protein-like 2) (Werner syndrome protein) [Includes: 3'-5' exonuclease (EC 3.1.-.-); ATP-dependent helicase (EC 3.6.4.12)] | EBI-27129966 | 0.35 |
Q8TF76 | Serine/threonine-protein kinase haspin (EC 2.7.11.1) (Germ cell-specific gene 2 protein) (H-haspin) (Haploid germ cell-specific nuclear protein kinase) | EBI-27129966 | 0.35 |
Q8NB50 | Zinc finger protein 62 homolog (Zfp-62) | EBI-27129966 | 0.35 |
O95251 | Histone acetyltransferase KAT7 (EC 2.3.1.48) (Histone acetyltransferase binding to ORC1) (Lysine acetyltransferase 7) (MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2) (MYST-2) | EBI-27129966 | 0.35 |
Q9BY12 | S phase cyclin A-associated protein in the endoplasmic reticulum (S phase cyclin A-associated protein in the ER) (Zinc finger protein 291) | EBI-27129966 | 0.35 |
A0AV96 | RNA-binding protein 47 (RNA-binding motif protein 47) | EBI-27129966 | 0.35 |
Q6NUN9 | Zinc finger protein 746 (Parkin-interacting substrate) (PARIS) | EBI-27129966 | 0.35 |
Q9P1Y6 | PHD and RING finger domain-containing protein 1 | EBI-27129966 | 0.35 |
Q14119 | Vascular endothelial zinc finger 1 (Putative transcription factor DB1) (Zinc finger protein 161) | EBI-27129966 | 0.35 |
Q6P1M3 | LLGL scribble cell polarity complex component 2 (HGL) (Lethal(2) giant larvae protein homolog 2) | EBI-27129966 | 0.35 |
Q96GY0 | Zinc finger C2HC domain-containing protein 1A | EBI-27129966 | 0.35 |
Q13574 | Diacylglycerol kinase zeta (DAG kinase zeta) (EC 2.7.1.107) (Diglyceride kinase zeta) (DGK-zeta) | EBI-27129966 | 0.35 |
Q8NI77 | Kinesin-like protein KIF18A (Marrow stromal KIF18A) (MS-KIF18A) | EBI-27129966 | 0.35 |
Q9UH17 | DNA dC->dU-editing enzyme APOBEC-3B (A3B) (EC 3.5.4.38) (Phorbolin-1-related protein) (Phorbolin-2/3) | EBI-27129966 | 0.35 |
O75525 | KH domain-containing, RNA-binding, signal transduction-associated protein 3 (RNA-binding protein T-Star) (Sam68-like mammalian protein 2) (SLM-2) (Sam68-like phosphotyrosine protein) | EBI-27129966 | 0.35 |
P49759 | Dual specificity protein kinase CLK1 (EC 2.7.12.1) (CDC-like kinase 1) | EBI-27129966 | 0.35 |
Q13523 | Serine/threonine-protein kinase PRP4 homolog (EC 2.7.11.1) (PRP4 kinase) (PRP4 pre-mRNA-processing factor 4 homolog) | EBI-27129966 | 0.35 |
Q9HAZ1 | Dual specificity protein kinase CLK4 (EC 2.7.12.1) (CDC-like kinase 4) | EBI-27129966 | 0.35 |
Q8N567 | Zinc finger CCHC domain-containing protein 9 | EBI-27129966 | 0.35 |
Q16698 | 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial (EC 1.3.1.124) (2,4-dienoyl-CoA reductase [NADPH]) (4-enoyl-CoA reductase [NADPH]) (Short chain dehydrogenase/reductase family 18C member 1) | EBI-27129966 | 0.35 |
Q9H7N4 | Splicing factor, arginine/serine-rich 19 (SR-related C-terminal domain-associated factor 1) (SR-related and CTD-associated factor 1) (SR-related-CTD-associated factor) (SCAF) (Serine arginine-rich pre-mRNA splicing factor SR-A1) (SR-A1) | EBI-27129966 | 0.35 |
Q12873 | Chromodomain-helicase-DNA-binding protein 3 (CHD-3) (EC 3.6.4.12) (ATP-dependent helicase CHD3) (Mi-2 autoantigen 240 kDa protein) (Mi2-alpha) (Zinc finger helicase) (hZFH) | EBI-27129966 | 0.35 |
Q9NV31 | U3 small nucleolar ribonucleoprotein protein IMP3 (U3 snoRNP protein IMP3) (BRMS2) | EBI-27129966 | 0.35 |
Q14147 | Probable ATP-dependent RNA helicase DHX34 (EC 3.6.4.13) (DEAH box protein 34) (DExH-box helicase 34) | EBI-27129966 | 0.35 |
Q149N8 | E3 ubiquitin-protein ligase SHPRH (EC 2.3.2.27) (EC 3.6.4.-) (RING-type E3 ubiquitin transferase SHPRH) (SNF2, histone-linker, PHD and RING finger domain-containing helicase) | EBI-27129966 | 0.35 |
Q02880 | DNA topoisomerase 2-beta (EC 5.6.2.2) (DNA topoisomerase II, beta isozyme) | EBI-27129966 | 0.35 |
Q96BK5 | PIN2/TERF1-interacting telomerase inhibitor 1 (Liver-related putative tumor suppressor) (Pin2-interacting protein X1) (Protein 67-11-3) (TRF1-interacting protein 1) | EBI-27129966 | 0.35 |
Q9H9Y2 | Ribosome production factor 1 (Brix domain-containing protein 5) (Ribosome biogenesis protein RPF1) | EBI-27129966 | 0.35 |
Q9P0L2 | Serine/threonine-protein kinase MARK1 (EC 2.7.11.1) (EC 2.7.11.26) (MAP/microtubule affinity-regulating kinase 1) (PAR1 homolog c) (Par-1c) (Par1c) | EBI-27129966 | 0.35 |
Q12986 | Transcriptional repressor NF-X1 (EC 2.3.2.-) (Nuclear transcription factor, X box-binding protein 1) | EBI-27129966 | 0.35 |
Q9UKM9 | RNA-binding protein Raly (Autoantigen p542) (Heterogeneous nuclear ribonucleoprotein C-like 2) (hnRNP core protein C-like 2) (hnRNP associated with lethal yellow protein homolog) | EBI-27129966 | 0.35 |
Q8N5F7 | NF-kappa-B-activating protein | EBI-27129966 | 0.35 |
O95625 | Zinc finger and BTB domain-containing protein 11 | EBI-27129966 | 0.35 |
Q96K58 | Zinc finger protein 668 | EBI-27129966 | 0.35 |
Q9NQZ2 | Something about silencing protein 10 (Charged amino acid-rich leucine zipper 1) (CRL1) (Disrupter of silencing SAS10) (UTP3 homolog) | EBI-27129966 | 0.35 |
Q96MX3 | Zinc finger protein 48 (Zinc finger protein 553) | EBI-27129966 | 0.35 |
Q14CB8 | Rho GTPase-activating protein 19 (Rho-type GTPase-activating protein 19) | EBI-27129966 | 0.35 |
Q15776 | Zinc finger protein with KRAB and SCAN domains 8 (LD5-1) (Zinc finger protein 192) | EBI-27129966 | 0.35 |
Q9GZR2 | RNA exonuclease 4 (EC 3.1.-.-) (Exonuclease XPMC2) (Prevents mitotic catastrophe 2 protein homolog) (hPMC2) | EBI-27129966 | 0.35 |
O75330 | Hyaluronan mediated motility receptor (Intracellular hyaluronic acid-binding protein) (Receptor for hyaluronan-mediated motility) (CD antigen CD168) | EBI-27129966 | 0.35 |
Q709F0 | Acyl-CoA dehydrogenase family member 11 (ACAD-11) (EC 1.3.8.-) | EBI-27129966 | 0.35 |
Q9Y3Y2 | Chromatin target of PRMT1 protein (Friend of PRMT1 protein) (Small arginine- and glycine-rich protein) (SRAG) | EBI-27129966 | 0.35 |
Q9NUL7 | Probable ATP-dependent RNA helicase DDX28 (EC 3.6.4.13) (Mitochondrial DEAD box protein 28) | EBI-27129966 | 0.35 |
Q5VWQ0 | Lysine-specific demethylase 9 (KDM9) (EC 1.14.11.-) (Round spermatid basic protein 1) | EBI-27129966 | 0.35 |
P49761 | Dual specificity protein kinase CLK3 (EC 2.7.12.1) (CDC-like kinase 3) | EBI-27129966 | 0.35 |
Q9H6R4 | Nucleolar protein 6 (Nucleolar RNA-associated protein) (Nrap) | EBI-27129966 | 0.35 |
Q9NY61 | Protein AATF (Apoptosis-antagonizing transcription factor) (Rb-binding protein Che-1) | EBI-27129966 | 0.35 |
Q9H8H2 | Probable ATP-dependent RNA helicase DDX31 (EC 3.6.4.13) (DEAD box protein 31) (Helicain) | EBI-27129966 | 0.35 |
Q9Y2P8 | RNA 3'-terminal phosphate cyclase-like protein | EBI-27129966 | 0.35 |
Q5BKZ1 | DBIRD complex subunit ZNF326 (Zinc finger protein 326) (Zinc finger protein interacting with mRNPs and DBC1) | EBI-27129966 | 0.35 |
P07305 | Histone H1.0 (Histone H1') (Histone H1(0)) [Cleaved into: Histone H1.0, N-terminally processed] | EBI-27129966 | 0.35 |
Q6NZI2 | Caveolae-associated protein 1 (Cavin-1) (Polymerase I and transcript release factor) | EBI-27129966 | 0.35 |
Q9H7B2 | Ribosome production factor 2 homolog (Brix domain-containing protein 1) (Ribosome biogenesis protein RPF2 homolog) | EBI-27129966 | 0.35 |
O00566 | U3 small nucleolar ribonucleoprotein protein MPP10 (M phase phosphoprotein 10) | EBI-27129966 | 0.35 |
O94761 | ATP-dependent DNA helicase Q4 (EC 3.6.4.12) (DNA helicase, RecQ-like type 4) (RecQ4) (RTS) (RecQ protein-like 4) | EBI-27129966 | 0.35 |
Q9NUQ6 | SPATS2-like protein (DNA polymerase-transactivated protein 6) (Stress granule and nucleolar protein) (SGNP) | EBI-27129966 | 0.35 |
Q14680 | Maternal embryonic leucine zipper kinase (hMELK) (EC 2.7.11.1) (Protein kinase Eg3) (pEg3 kinase) (Protein kinase PK38) (hPK38) (Tyrosine-protein kinase MELK) (EC 2.7.10.2) | EBI-27129966 | 0.35 |
P78332 | RNA-binding protein 6 (Lung cancer antigen NY-LU-12) (Protein G16) (RNA-binding motif protein 6) (RNA-binding protein DEF-3) | EBI-27129966 | 0.35 |
Q9Y4F1 | FERM, ARHGEF and pleckstrin domain-containing protein 1 (Chondrocyte-derived ezrin-like protein) (FERM, RhoGEF and pleckstrin domain-containing protein 1) (Pleckstrin homology domain-containing family C member 2) (PH domain-containing family C member 2) | EBI-27129966 | 0.35 |
Q8WXF0 | Serine/arginine-rich splicing factor 12 (35 kDa SR repressor protein) (SRrp35) (Splicing factor, arginine/serine-rich 13B) (Splicing factor, arginine/serine-rich 19) | EBI-27129966 | 0.35 |
Q5VYS8 | Terminal uridylyltransferase 7 (TUTase 7) (EC 2.7.7.52) (Zinc finger CCHC domain-containing protein 6) | EBI-27129966 | 0.35 |
Q96PU8 | Protein quaking (Hqk) (HqkI) | EBI-27129966 | 0.35 |
O95453 | Poly(A)-specific ribonuclease PARN (EC 3.1.13.4) (Deadenylating nuclease) (Deadenylation nuclease) (Polyadenylate-specific ribonuclease) | EBI-27129966 | 0.35 |
Q9UL40 | Zinc finger protein 346 (Just another zinc finger protein) | EBI-27129966 | 0.35 |
Q15050 | Ribosome biogenesis regulatory protein homolog | EBI-27129966 | 0.35 |
P49840 | Glycogen synthase kinase-3 alpha (GSK-3 alpha) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3A) (EC 2.7.11.1) | EBI-27129966 | 0.35 |
Q9P275 | Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.4.19.12) (Deubiquitinating enzyme 36) (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) | EBI-27129966 | 0.35 |
P11388 | DNA topoisomerase 2-alpha (EC 5.6.2.2) (DNA topoisomerase II, alpha isozyme) | EBI-27129966 | 0.35 |
Q9H5H4 | Zinc finger protein 768 | EBI-27129966 | 0.35 |
Q9HC36 | rRNA methyltransferase 3, mitochondrial (EC 2.1.1.-) (16S rRNA (guanosine(1370)-2'-O)-methyltransferase) (16S rRNA [Gm1370] 2'-O-methyltransferase) (RNA methyltransferase-like protein 1) | EBI-27129966 | 0.35 |
Q9H6F5 | Coiled-coil domain-containing protein 86 (Cytokine-induced protein with coiled-coil domain) | EBI-27129966 | 0.35 |
Q9H7H0 | Methyltransferase-like protein 17, mitochondrial (EC 2.1.1.-) (False p73 target gene protein) (Methyltransferase 11 domain-containing protein 1) (Protein RSM22 homolog, mitochondrial) | EBI-27129966 | 0.35 |
Q9ULW3 | Activator of basal transcription 1 (hABT1) (Basal transcriptional activator) | EBI-27129966 | 0.35 |
Q8IYB3 | Serine/arginine repetitive matrix protein 1 (SR-related nuclear matrix protein of 160 kDa) (SRm160) (Ser/Arg-related nuclear matrix protein) | EBI-27129966 | 0.35 |
Q6PK04 | Coiled-coil domain-containing protein 137 | EBI-27129966 | 0.35 |
Q9UGR2 | Zinc finger CCCH domain-containing protein 7B (Rotavirus 'X'-associated non-structural protein) (RoXaN) | EBI-27129966 | 0.35 |
Q49A26 | Cytokine-like nuclear factor N-PAC (NPAC) (3-hydroxyisobutyrate dehydrogenase-like protein) (Glyoxylate reductase 1 homolog) (Nuclear protein NP60) (Nuclear protein of 60 kDa) (Nucleosome-destabilizing factor) (hNDF) (Putative oxidoreductase GLYR1) | EBI-27129966 | 0.35 |
O94813 | Slit homolog 2 protein (Slit-2) [Cleaved into: Slit homolog 2 protein N-product; Slit homolog 2 protein C-product] | EBI-27129966 | 0.35 |
Q9Y5J1 | U3 small nucleolar RNA-associated protein 18 homolog (WD repeat-containing protein 50) | EBI-27129966 | 0.35 |
Q9BXS6 | Nucleolar and spindle-associated protein 1 (NuSAP) | EBI-27129966 | 0.35 |
Q9Y3C1 | Nucleolar protein 16 (HBV pre-S2 trans-regulated protein 3) | EBI-27129966 | 0.35 |
Q6DKI1 | 60S ribosomal protein L7-like 1 (Large ribosomal subunit protein uL30-like 1) | EBI-27129966 | 0.35 |
P22492 | Histone H1t (Testicular H1 histone) | EBI-27129966 | 0.35 |
Q12788 | Transducin beta-like protein 3 (WD repeat-containing protein SAZD) | EBI-27129966 | 0.35 |
Q9NWH9 | SAFB-like transcription modulator (Modulator of estrogen-induced transcription) | EBI-27129966 | 0.35 |
P49841 | Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1) | EBI-27129966 | 0.35 |
Q9Y4C8 | Probable RNA-binding protein 19 (RNA-binding motif protein 19) | EBI-27129966 | 0.35 |
P27448 | MAP/microtubule affinity-regulating kinase 3 (EC 2.7.11.1) (C-TAK1) (cTAK1) (Cdc25C-associated protein kinase 1) (ELKL motif kinase 2) (EMK-2) (Protein kinase STK10) (Ser/Thr protein kinase PAR-1) (Par-1a) (Serine/threonine-protein kinase p78) | EBI-27129966 | 0.35 |
Q9H6R0 | ATP-dependent RNA helicase DHX33 (EC 3.6.4.13) (DEAH box protein 33) | EBI-27129966 | 0.35 |
Q3KQU3 | MAP7 domain-containing protein 1 (Arginine/proline-rich coiled-coil domain-containing protein 1) (Proline/arginine-rich coiled-coil domain-containing protein 1) | EBI-27129966 | 0.35 |
Q9UN81 | LINE-1 retrotransposable element ORF1 protein (L1ORF1p) (LINE retrotransposable element 1) (LINE1 retrotransposable element 1) | EBI-27129966 | 0.35 |
Q14137 | Ribosome biogenesis protein BOP1 (Block of proliferation 1 protein) | EBI-27129966 | 0.35 |
Q9BVJ6 | U3 small nucleolar RNA-associated protein 14 homolog A (Antigen NY-CO-16) (Serologically defined colon cancer antigen 16) | EBI-27129966 | 0.35 |
Q9UNX4 | WD repeat-containing protein 3 | EBI-27129966 | 0.35 |
P38935 | DNA-binding protein SMUBP-2 (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent helicase IGHMBP2) (Glial factor 1) (GF-1) (Immunoglobulin mu-binding protein 2) | EBI-27129966 | 0.35 |
O43663 | Protein regulator of cytokinesis 1 | EBI-27129966 | 0.35 |
Q659C4 | La-related protein 1B (La ribonucleoprotein domain family member 1B) (La ribonucleoprotein domain family member 2) (La-related protein 2) | EBI-27129966 | 0.35 |
Q9NUD5 | Zinc finger CCHC domain-containing protein 3 | EBI-27129966 | 0.35 |
Q01780 | Exosome component 10 (EC 3.1.13.-) (Autoantigen PM/Scl 2) (P100 polymyositis-scleroderma overlap syndrome-associated autoantigen) (Polymyositis/scleroderma autoantigen 100 kDa) (PM/Scl-100) (Polymyositis/scleroderma autoantigen 2) | EBI-27129966 | 0.35 |
P46783 | 40S ribosomal protein S10 (Small ribosomal subunit protein eS10) | EBI-27129966 | 0.35 |
O43660 | Pleiotropic regulator 1 | EBI-27129966 | 0.35 |
P46779 | 60S ribosomal protein L28 (Large ribosomal subunit protein eL28) | EBI-27129966 | 0.35 |
O60306 | RNA helicase aquarius (EC 3.6.4.13) (Intron-binding protein of 160 kDa) (IBP160) | EBI-27129966 | 0.35 |
Q13151 | Heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) | EBI-27129966 | 0.35 |
P36873 | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit) | EBI-27129966 | 0.35 |
Q14692 | Ribosome biogenesis protein BMS1 homolog (Ribosome assembly protein BMS1 homolog) | EBI-27129966 | 0.35 |
Q1KMD3 | Heterogeneous nuclear ribonucleoprotein U-like protein 2 (Scaffold-attachment factor A2) (SAF-A2) | EBI-27129966 | 0.35 |
Q14562 | ATP-dependent RNA helicase DHX8 (EC 3.6.4.13) (DEAH box protein 8) (RNA helicase HRH1) | EBI-27129966 | 0.35 |
Q99729 | Heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) (APOBEC1-binding protein 1) (ABBP-1) | EBI-27129966 | 0.35 |
P62136 | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16) | EBI-27129966 | 0.35 |
Q8N9T8 | Protein KRI1 homolog | EBI-27129966 | 0.35 |
Q13601 | KRR1 small subunit processome component homolog (HIV-1 Rev-binding protein 2) (KRR-R motif-containing protein 1) (Rev-interacting protein 1) (Rip-1) | EBI-27129966 | 0.35 |
Q07666 | KH domain-containing, RNA-binding, signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68) | EBI-27129966 | 0.35 |
P07910 | Heterogeneous nuclear ribonucleoproteins C1/C2 (hnRNP C1/C2) | EBI-27129966 | 0.35 |
P42766 | 60S ribosomal protein L35 (Large ribosomal subunit protein uL29) | EBI-27129966 | 0.35 |
Q07020 | 60S ribosomal protein L18 (Large ribosomal subunit protein eL18) | EBI-27129966 | 0.35 |
P62899 | 60S ribosomal protein L31 (Large ribosomal subunit protein eL31) | EBI-27129966 | 0.35 |
Q5SSJ5 | Heterochromatin protein 1-binding protein 3 (Protein HP1-BP74) | EBI-27129966 | 0.35 |
Q96E39 | RNA binding motif protein, X-linked-like-1 (Heterogeneous nuclear ribonucleoprotein G-like 1) | EBI-27129966 | 0.35 |
Q9NZB2 | Constitutive coactivator of PPAR-gamma-like protein 1 (Oxidative stress-associated Src activator) (Protein FAM120A) | EBI-27129966 | 0.35 |
Q13206 | Probable ATP-dependent RNA helicase DDX10 (EC 3.6.4.13) (DEAD box protein 10) | EBI-27129966 | 0.35 |
P10412 | Histone H1.4 (Histone H1b) (Histone H1s-4) | EBI-27129966 | 0.35 |
P84103 | Serine/arginine-rich splicing factor 3 (Pre-mRNA-splicing factor SRP20) (Splicing factor, arginine/serine-rich 3) | EBI-27129966 | 0.35 |
Q92522 | Histone H1.10 (Histone H1x) | EBI-27129966 | 0.35 |
P46013 | Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67) | EBI-27129966 | 0.35 |
P05455 | Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS-B) | EBI-27129966 | 0.35 |
P62280 | 40S ribosomal protein S11 (Small ribosomal subunit protein uS17) | EBI-27129966 | 0.35 |
P22087 | rRNA 2'-O-methyltransferase fibrillarin (EC 2.1.1.-) (34 kDa nucleolar scleroderma antigen) (Histone-glutamine methyltransferase) (U6 snRNA 2'-O-methyltransferase fibrillarin) | EBI-27129966 | 0.35 |
Q52LJ0 | Protein FAM98B | EBI-27129966 | 0.35 |
P08708 | 40S ribosomal protein S17 (Small ribosomal subunit protein eS17) | EBI-27129966 | 0.35 |
O00567 | Nucleolar protein 56 (Nucleolar protein 5A) | EBI-27129966 | 0.35 |
P78316 | Nucleolar protein 14 (Nucleolar complex protein 14) | EBI-27129966 | 0.35 |
P16403 | Histone H1.2 (Histone H1c) (Histone H1d) (Histone H1s-1) | EBI-27129966 | 0.35 |
Q9H2U1 | ATP-dependent DNA/RNA helicase DHX36 (EC 3.6.4.12) (EC 3.6.4.13) (DEAD/H box polypeptide 36) (DEAH-box protein 36) (G4-resolvase-1) (G4R1) (MLE-like protein 1) (RNA helicase associated with AU-rich element protein) | EBI-27129966 | 0.35 |
P40429 | 60S ribosomal protein L13a (23 kDa highly basic protein) (Large ribosomal subunit protein uL13) | EBI-27129966 | 0.35 |
Q8TDD1 | ATP-dependent RNA helicase DDX54 (EC 3.6.4.13) (ATP-dependent RNA helicase DP97) (DEAD box RNA helicase 97 kDa) (DEAD box protein 54) | EBI-27129966 | 0.35 |
Q9BQ39 | ATP-dependent RNA helicase DDX50 (EC 3.6.4.13) (DEAD box protein 50) (Gu-beta) (Nucleolar protein Gu2) | EBI-27129966 | 0.35 |
P38159 | RNA-binding motif protein, X chromosome (Glycoprotein p43) (Heterogeneous nuclear ribonucleoprotein G) (hnRNP G) [Cleaved into: RNA-binding motif protein, X chromosome, N-terminally processed] | EBI-27129966 | 0.35 |
P26368 | Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (hU2AF(65)) (hU2AF65) (U2 snRNP auxiliary factor large subunit) | EBI-27129966 | 0.35 |
P62841 | 40S ribosomal protein S15 (RIG protein) (Small ribosomal subunit protein uS19) | EBI-27129966 | 0.35 |
P84098 | 60S ribosomal protein L19 (Large ribosomal subunit protein eL19) | EBI-27129966 | 0.35 |
P27635 | 60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM) | EBI-27129966 | 0.35 |
Q9UNX3 | 60S ribosomal protein L26-like 1 (Large ribosomal subunit protein uL24-like 1) | EBI-27129966 | 0.35 |
P62847 | 40S ribosomal protein S24 (Small ribosomal subunit protein eS24) | EBI-27129966 | 0.35 |
Q14684 | Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B) | EBI-27129966 | 0.35 |
P62244 | 40S ribosomal protein S15a (Small ribosomal subunit protein uS8) | EBI-27129966 | 0.35 |
Q9BZE4 | GTP-binding protein 4 (Chronic renal failure gene protein) (GTP-binding protein NGB) (Nucleolar GTP-binding protein 1) | EBI-27129966 | 0.35 |
P61254 | 60S ribosomal protein L26 (Large ribosomal subunit protein uL24) | EBI-27129966 | 0.35 |
Q07955 | Serine/arginine-rich splicing factor 1 (Alternative-splicing factor 1) (ASF-1) (Splicing factor, arginine/serine-rich 1) (pre-mRNA-splicing factor SF2, P33 subunit) | EBI-27129966 | 0.35 |
P62277 | 40S ribosomal protein S13 (Small ribosomal subunit protein uS15) | EBI-27129966 | 0.35 |
Q6P158 | Putative ATP-dependent RNA helicase DHX57 (EC 3.6.4.13) (DEAH box protein 57) | EBI-27129966 | 0.35 |
P62241 | 40S ribosomal protein S8 (Small ribosomal subunit protein eS8) | EBI-27129966 | 0.35 |
O43390 | Heterogeneous nuclear ribonucleoprotein R (hnRNP R) | EBI-27129966 | 0.35 |
P22626 | Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1) | EBI-27129966 | 0.35 |
P46781 | 40S ribosomal protein S9 (Small ribosomal subunit protein uS4) | EBI-27129966 | 0.35 |
O60506 | Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) (Glycine- and tyrosine-rich RNA-binding protein) (GRY-RBP) (NS1-associated protein 1) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) | EBI-27129966 | 0.35 |
P39023 | 60S ribosomal protein L3 (HIV-1 TAR RNA-binding protein B) (TARBP-B) (Large ribosomal subunit protein uL3) | EBI-27129966 | 0.35 |
P62750 | 60S ribosomal protein L23a (Large ribosomal subunit protein uL23) | EBI-27129966 | 0.35 |
P62753 | 40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6) | EBI-27129966 | 0.35 |
P18621 | 60S ribosomal protein L17 (60S ribosomal protein L23) (Large ribosomal subunit protein uL22) (PD-1) | EBI-27129966 | 0.35 |
Q9Y3I0 | RNA-splicing ligase RtcB homolog (EC 6.5.1.8) (3'-phosphate/5'-hydroxy nucleic acid ligase) | EBI-27129966 | 0.35 |
P15880 | 40S ribosomal protein S2 (40S ribosomal protein S4) (Protein LLRep3) (Small ribosomal subunit protein uS5) | EBI-27129966 | 0.35 |
P67809 | Y-box-binding protein 1 (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor) | EBI-27129966 | 0.35 |
P62701 | 40S ribosomal protein S4, X isoform (SCR10) (Single copy abundant mRNA protein) (Small ribosomal subunit protein eS4) | EBI-27129966 | 0.35 |
Q9NR30 | Nucleolar RNA helicase 2 (EC 3.6.4.13) (DEAD box protein 21) (Gu-alpha) (Nucleolar RNA helicase Gu) (Nucleolar RNA helicase II) (RH II/Gu) | EBI-27129966 | 0.35 |
Q00839 | Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (GRIP120) (Nuclear p120 ribonucleoprotein) (Scaffold-attachment factor A) (SAF-A) (p120) (pp120) | EBI-27129966 | 0.35 |
Q08211 | ATP-dependent RNA helicase A (EC 3.6.4.13) (DEAH box protein 9) (DExH-box helicase 9) (Leukophysin) (LKP) (Nuclear DNA helicase II) (NDH II) (RNA helicase A) | EBI-27129966 | 0.35 |
Q92499 | ATP-dependent RNA helicase DDX1 (EC 3.6.4.13) (DEAD box protein 1) (DEAD box protein retinoblastoma) (DBP-RB) | EBI-27129966 | 0.35 |
P61247 | 40S ribosomal protein S3a (Small ribosomal subunit protein eS1) (v-fos transformation effector protein) (Fte-1) | EBI-27129966 | 0.35 |
Q00987 | E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) | EBI-30810851 | 0.40 |
Q96CW1 | AP-2 complex subunit mu (AP-2 mu chain) (Adaptin-mu2) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (HA2 50 kDa subunit) (Plasma membrane adaptor AP-2 50 kDa protein) | EBI-30812690 | 0.40 |
Database | Links |
UNIPROT | P59595 Q7T3Z4 Q7TA14 Q7TF99 Q80E50 |
PDB | 1SSK 1X7Q 2CJR 2GIB 2JW8 2OFZ 2OG3 3I6L 6IEX 7LG0 |
Pfam | PF00937 |
PROSITE | PS51929 PS51928 |