Protein Information |
|
|---|---|
| Protein Name | Calcium-binding and coiled-coil domain-containing protein 2 |
| Accession Code | Q13137 |
| Gene | CALCOCO2 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 446) | |
|
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPID LNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELK DSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQ EKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEII CNALQRQKERLEGENDLLKRENSRLLSYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPIC KADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL |
|
Structure Viewer (PDB: 5Z7L) |
|---|
Description |
||
|---|---|---|
| Cytoplasm, perinuclear region {Experimental EvidencePubMed:12869526, Experimental EvidencePubMed:17635994, Experimental EvidencePubMed:9230084}. Cytoplasm, cytoskeleton {Experimental EvidencePubMed:17635994}. Cytoplasmic vesicle, autophagosome membrane {Experimental EvidencePubMed:25771791}; Peripheral membrane protein {Curator Inference}. Note=According to PubMed:7540613, localizes to nuclear dots. According to PubMed:9230084 and PubMed:12869526, it is not a nuclear dot-associated protein but localizes predominantly in the cytoplasm with a coarse-grained distribution preferentially close to the nucleus. {Experimental EvidencePubMed:12869526, ECO:0000269|PubMed:7540613, Experimental EvidencePubMed:9230084}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Peripheral | UniProt | Curator Inference {ECO:0000305} | Assigned Ontology terms |
| Cellular Component | Autophagosome (GO:0005776) Autophagosome Membrane (GO:0000421) Cytoplasm (GO:0005737) Cytoplasmic Vesicle (GO:0031410) Cytoskeleton (GO:0005856) Cytosol (GO:0005829) Intracellular Membrane-Bounded Organelle (GO:0043231) Membrane (GO:0016020) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) PML Body (GO:0016605) |
|
Description |
|
|---|---|
| Xenophagy-specific receptor required for autophagy-mediated intracellular bacteria degradation. Acts as an effector protein of galectin-sensed membrane damage that restricts the proliferation of infecting pathogens such as Salmonella typhimurium upon entry into the cytosol by targeting LGALS8-associated bacteria for autophagy (PubMed:22246324). Initially orchestrates bacteria targeting to autophagosomes and subsequently ensures pathogen degradation by regulating pathogen-containing autophagosome maturation (PubMed:23022382, PubMed:25771791). Bacteria targeting to autophagosomes relies on its interaction with MAP1LC3A, MAP1LC3B and/or GABARAPL2, whereas regulation of pathogen-containing autophagosome maturation requires the interaction with MAP3LC3C (PubMed:23022382, PubMed:25771791). May play a role in ruffle formation and actin cytoskeleton organization and seems to negatively regulate constitutive secretion (PubMed:17635994). {Experimental EvidencePubMed:17635994, Experimental EvidencePubMed:22246324, Experimental EvidencePubMed:23022382, Experimental EvidencePubMed:23386746, Experimental EvidencePubMed:25771791}. | Assigned Ontology terms |
| Biological Process | Positive Regulation Of Autophagosome Maturation (GO:1901098) Response To Type II Interferon (GO:0034341) Viral Process (GO:0016032) Xenophagy (GO:0098792) |
| Molecular Function | Metal Ion Binding (GO:0046872) Protein Homodimerization Activity (GO:0042803) |
Interactions with Nuclear Envelope proteins (11 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O75604 | Ubiquitin carboxyl-terminal hydrolase 2 | EBI-24334992 | 0.56 |
| O75716 | Serine/threonine-protein kinase 16 | EBI-10189253 | 0.56 |
| P29991 | RNA-directed RNA polymerase NS5 | EBI-8829245 | 0.37 |
| P50613 | Cyclin-dependent kinase 7 | EBI-21835901 | 0.35 |
| Q02821 | Importin subunit alpha | EBI-11534474 | 0.56 |
| Q06787 | Fragile X messenger ribonucleoprotein 1 | EBI-6115370 | 0.55 |
| Q13137 | Self | EBI-758068 | 0.37 |
| Q99IB8 | RNA-directed RNA polymerase | EBI-6928172 | 0.37 |
| Q9WMX2 | RNA-directed RNA polymerase | EBI-9081202 | 0.57 |
| Q96T37 | RNA-binding protein 15 | EBI-10293900 | 0.56 |
| Q9H7C4 | Syncoilin | EBI-21702482 | 0.35 | Interactions with other proteins (218 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q9Y3C5 | RING finger protein 11 | EBI-7220121 | 0.37 |
| Q96S44 | EKC/KEOPS complex subunit TP53RK (EC 3.6.-.-) (Atypical serine/threonine protein kinase TP53RK) (Nori-2) (TP53-regulating kinase) (EC 2.7.11.1) (p53-related protein kinase) | EBI-752485 | 0.74 |
| O00214 | Galectin-8 (Gal-8) (Po66 carbohydrate-binding protein) (Po66-CBP) (Prostate carcinoma tumor antigen 1) (PCTA-1) | EBI-752575 | 0.85 |
| Q53FD0 | Zinc finger C2HC domain-containing protein 1C | EBI-752725 | 0.37 |
| Q8N715 | Coiled-coil domain-containing protein 185 | EBI-752740 | 0.37 |
| Q8TBB1 | E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb-protein X 1) (Numb-binding protein 1) (PDZ domain-containing RING finger protein 2) (RING-type E3 ubiquitin transferase LNX) | EBI-753001 | 0.55 |
| Q8N2W9 | E3 SUMO-protein ligase PIAS4 (EC 2.3.2.27) (PIASy) (Protein inhibitor of activated STAT protein 4) (Protein inhibitor of activated STAT protein gamma) (PIAS-gamma) | EBI-753673 | 0.37 |
| Q8N5R6 | Coiled-coil domain-containing protein 33 (Cancer/testis antigen 61) (CT61) | EBI-753856 | 0.37 |
| P25786 | Proteasome subunit alpha type-1 (30 kDa prosomal protein) (PROS-30) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome component C2) (Proteasome nu chain) | EBI-753919 | 0.67 |
| P26599 | Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) | EBI-754081 | 0.37 |
| Q3YEC7 | Rab-like protein 6 (GTP-binding protein Parf) (Partner of ARF) (Rab-like protein 1) (RBEL1) | EBI-754117 | 0.37 |
| Q9UBL6 | Copine-7 (Copine VII) | EBI-24292126 | 0.56 |
| Q96F93 | ZNF101 protein | EBI-754906 | 0.37 |
| Q9Y4Z0 | U6 snRNA-associated Sm-like protein LSm4 (Glycine-rich protein) (GRP) | EBI-754981 | 0.78 |
| P29353 | SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1) | EBI-755236 | 0.55 |
| P60520 | Gamma-aminobutyric acid receptor-associated protein-like 2 (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16) (MAP1 light chain 3-related protein) | EBI-755311 | 0.78 |
| Q15906 | Vacuolar protein sorting-associated protein 72 homolog (Protein YL-1) (Transcription factor-like 1) | EBI-755386 | 0.37 |
| Q9Y4E5 | E3 SUMO-protein ligase ZNF451 (EC 2.3.2.-) (Coactivator for steroid receptors) (E3 SUMO-protein transferase ZNF451) (Zinc finger protein 451) | EBI-755704 | 0.37 |
| Q9BQY9 | Dysbindin domain-containing protein 2 (Casein kinase-1 binding protein) (CK1BP) (HSMNP1) | EBI-755827 | 0.37 |
| Q14966 | Zinc finger protein 638 (Cutaneous T-cell lymphoma-associated antigen se33-1) (CTCL-associated antigen se33-1) (Nuclear protein 220) (Zinc finger matrin-like protein) | EBI-755848 | 0.37 |
| Q96D16 | FBXL18 protein | EBI-755989 | 0.67 |
| O95201 | Zinc finger protein 205 (Zinc finger protein 210) | EBI-756364 | 0.37 |
| P51116 | RNA-binding protein FXR2 (FMR1 autosomal homolog 2) | EBI-756460 | 0.37 |
| Q7L590 | Protein MCM10 homolog (HsMCM10) | EBI-756649 | 0.37 |
| Q9UNA4 | DNA polymerase iota (EC 2.7.7.7) (Eta2) (RAD30 homolog B) | EBI-756718 | 0.37 |
| Q9UKA9 | Polypyrimidine tract-binding protein 2 (Neural polypyrimidine tract-binding protein) (Neurally-enriched homolog of PTB) (PTB-like protein) | EBI-756841 | 0.37 |
| O95251 | Histone acetyltransferase KAT7 (EC 2.3.1.48) (Histone acetyltransferase binding to ORC1) (Lysine acetyltransferase 7) (MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2) (MYST-2) | EBI-757276 | 0.37 |
| Q9BSM1 | Polycomb group RING finger protein 1 (Nervous system Polycomb-1) (NSPc1) (RING finger protein 68) | EBI-757711 | 0.37 |
| P56279 | T-cell leukemia/lymphoma protein 1A (Oncogene TCL-1) (Oncogene TCL1) (Protein p14 TCL1) | EBI-757792 | 0.87 |
| Q96GM5 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (60 kDa BRG-1/Brm-associated factor subunit A) (BRG1-associated factor 60A) (BAF60A) (SWI/SNF complex 60 kDa subunit) | EBI-757918 | 0.67 |
| Q8IYF1 | Elongin-A2 (EloA2) (RNA polymerase II transcription factor SIII subunit A2) (Transcription elongation factor B polypeptide 3B) | EBI-757939 | 0.55 |
| O14639 | Actin-binding LIM protein 1 (abLIM-1) (Actin-binding LIM protein family member 1) (Actin-binding double zinc finger protein) (LIMAB1) (Limatin) | EBI-757951 | 0.37 |
| Q9H0I2 | Enkurin domain-containing protein 1 | EBI-758104 | 0.67 |
| Q9BUY5 | Zinc finger protein 426 | EBI-758131 | 0.37 |
| Q9BVV2 | Fibronectin type III domain-containing protein 11 | EBI-758146 | 0.67 |
| P30626 | Sorcin (22 kDa protein) (CP-22) (CP22) (V19) | EBI-758236 | 0.74 |
| Q9BWD7 | FASTK protein | EBI-758320 | 0.37 |
| Q12933 | TNF receptor-associated factor 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF2) (RING-type E3 ubiquitin transferase TRAF2) (Tumor necrosis factor type 2 receptor-associated protein 3) | EBI-758476 | 0.37 |
| Q9H9D4 | Zinc finger protein 408 (PR domain zinc finger protein 17) | EBI-758947 | 0.67 |
| Q15038 | DAZ-associated protein 2 (Deleted in azoospermia-associated protein 2) (Proline-rich transcript in brain protein) | EBI-759250 | 0.67 |
| Q8TCX5 | Rhophilin-1 (GTP-Rho-binding protein 1) | EBI-759364 | 0.37 |
| Q9UBV8 | Peflin (PEF protein with a long N-terminal hydrophobic domain) (Penta-EF hand domain-containing protein 1) | EBI-759700 | 0.67 |
| Q9UBZ4 | DNA-(apurinic or apyrimidinic site) endonuclease 2 (EC 3.1.11.2) (AP endonuclease XTH2) (APEX nuclease 2) (APEX nuclease-like 2) (Apurinic-apyrimidinic endonuclease 2) (AP endonuclease 2) | EBI-759748 | 0.37 |
| Q9H0R8 | Gamma-aminobutyric acid receptor-associated protein-like 1 (Early estrogen-regulated protein) (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1) | EBI-759847 | 0.78 |
| O95990 | Actin-associated protein FAM107A (Down-regulated in renal cell carcinoma 1) (Protein TU3A) | EBI-760045 | 0.37 |
| Q7Z3B3 | KAT8 regulatory NSL complex subunit 1 (MLL1/MLL complex subunit KANSL1) (MSL1 homolog 1) (hMSL1v1) (NSL complex protein NSL1) (Non-specific lethal 1 homolog) | EBI-760072 | 0.74 |
| Q5NEX4 | Dihydrolipoyl dehydrogenase (EC 1.8.1.4) | EBI-2808427 | 0.00 |
| A0A3N4B896 | Putative siderophore biosynthesis protein IucC | EBI-2840104 | 0.00 |
| Q9UNI6 | Dual specificity protein phosphatase 12 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity tyrosine phosphatase YVH1) | EBI-8633706 | 0.74 |
| Q15884 | Endosomal transmembrane epsin interactor 1 (Endosomal transmembrane binding with epsin) | EBI-8636634 | 0.37 |
| Q13671 | Ras and Rab interactor 1 (Ras inhibitor JC99) (Ras interaction/interference protein 1) | EBI-8641704 | 0.67 |
| Q8WUI4 | Histone deacetylase 7 (HD7) (EC 3.5.1.98) (Histone deacetylase 7A) (HD7a) | EBI-10276459 | 0.56 |
| Q99471 | Prefoldin subunit 5 (Myc modulator 1) (c-Myc-binding protein Mm-1) | EBI-8644653 | 0.67 |
| Q6PF05 | Tetratricopeptide repeat protein 23-like | EBI-8656859 | 0.37 |
| Q86YD7 | Protein FAM90A1 | EBI-8656891 | 0.78 |
| P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | EBI-3962281 | 0.35 |
| O43913 | Origin recognition complex subunit 5 | EBI-3935022 | 0.37 |
| P15927 | Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) | EBI-3935032 | 0.37 |
| Q9Y4K3 | TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6) | EBI-3935052 | 0.37 |
| Q9Y6K9 | NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | EBI-3935062 | 0.37 |
| Q14161 | ARF GTPase-activating protein GIT2 (ARF GAP GIT2) (Cool-interacting tyrosine-phosphorylated protein 2) (CAT-2) (CAT2) (G protein-coupled receptor kinase-interactor 2) (GRK-interacting protein 2) | EBI-3935072 | 0.37 |
| Q8TDY2 | RB1-inducible coiled-coil protein 1 (FAK family kinase-interacting protein of 200 kDa) (FIP200) | EBI-3935082 | 0.37 |
| Q15051 | IQ calmodulin-binding motif-containing protein 1 (Nephrocystin-5) (p53 and DNA damage-regulated IQ motif protein) (PIQ) | EBI-4286917 | 0.35 |
| Q7Z434 | Mitochondrial antiviral-signaling protein (MAVS) (CARD adapter inducing interferon beta) (Cardif) (Interferon beta promoter stimulator protein 1) (IPS-1) (Putative NF-kappa-B-activating protein 031N) (Virus-induced-signaling adapter) (VISA) | EBI-6115370 | 0.58 |
| Q8NCU4 | Coiled-coil domain-containing protein 191 | EBI-6115370 | 0.35 |
| Q9UHD2 | Serine/threonine-protein kinase TBK1 (EC 2.7.11.1) (NF-kappa-B-activating kinase) (T2K) (TANK-binding kinase 1) | EBI-6115370 | 0.75 |
| P48634 | Protein PRRC2A (HLA-B-associated transcript 2) (Large proline-rich protein BAT2) (Proline-rich and coiled-coil-containing protein 2A) (Protein G2) | EBI-6115370 | 0.35 |
| A7MCY6 | TANK-binding kinase 1-binding protein 1 (TBK1-binding protein 1) | EBI-6115370 | 0.53 |
| Q9H6S1 | 5-azacytidine-induced protein 2 (NF-kappa-B-activating kinase-associated protein 1) (Nak-associated protein 1) (Nap1) (TILP) | EBI-6115370 | 0.53 |
| Q9NVV4 | Poly(A) RNA polymerase, mitochondrial (PAP) (EC 2.7.7.19) (PAP-associated domain-containing protein 1) (Polynucleotide adenylyltransferase) (Terminal uridylyltransferase 1) (TUTase 1) (mtPAP) | EBI-6115370 | 0.50 |
| Q9QYP6 | 5-azacytidine-induced protein 2 (NF-kappa-B-activating kinase-associated protein 1) (Nak-associated protein 1) (Nap1) | EBI-6115837 | 0.35 |
| O41947 | 31 protein (Uncharacterized protein GAMMAHV.ORF31) | EBI-9640332 | 0.37 |
| A8KA13 | B-cell CLL/lymphoma 6, member B (Zinc finger protein), isoform CRA_a (cDNA FLJ16548 fis, clone PLACE7000410, highly similar to B-cell CLL/lymphoma 6 member B protein) (cDNA FLJ77637) (cDNA FLJ77701, highly similar to Homo sapiens B-cell CLL/lymphoma 6, member B (zinc finger protein)(BCL6B), mRNA) | EBI-10174899 | 0.56 |
| Q2TBE0 | CWF19-like protein 2 | EBI-10175027 | 0.56 |
| B2R9Y1 | cDNA, FLJ94608, Homo sapiens reticulon 4 interacting protein 1 (RTN4IP1), mRNA | EBI-10175744 | 0.56 |
| Q8WWY3 | U4/U6 small nuclear ribonucleoprotein Prp31 (Pre-mRNA-processing factor 31) (Serologically defined breast cancer antigen NY-BR-99) (U4/U6 snRNP 61 kDa protein) (Protein 61K) (hPrp31) | EBI-10177378 | 0.72 |
| O00560 | Syntenin-1 (Melanoma differentiation-associated protein 9) (MDA-9) (Pro-TGF-alpha cytoplasmic domain-interacting protein 18) (TACIP18) (Scaffold protein Pbp1) (Syndecan-binding protein 1) | EBI-10180081 | 0.56 |
| O43189 | PHD finger protein 1 (Protein PHF1) (hPHF1) (Polycomb-like protein 1) (hPCl1) | EBI-10183509 | 0.56 |
| O43324 | Eukaryotic translation elongation factor 1 epsilon-1 (Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3) (Elongation factor p18) (Multisynthase complex auxiliary component p18) | EBI-10183831 | 0.56 |
| O43602 | Neuronal migration protein doublecortin (Doublin) (Lissencephalin-X) (Lis-X) | EBI-10184475 | 0.56 |
| O95363 | Phenylalanine--tRNA ligase, mitochondrial (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase) (PheRS) | EBI-10191564 | 0.78 |
| P00540 | Proto-oncogene serine/threonine-protein kinase mos (EC 2.7.11.1) (Oocyte maturation factor mos) (Proto-oncogene c-Mos) | EBI-10193294 | 0.78 |
| P14678 | Small nuclear ribonucleoprotein-associated proteins B and B' (snRNP-B) (Sm protein B/B') (Sm-B/B') (SmB/B') | EBI-10198485 | 0.56 |
| P17482 | Homeobox protein Hox-B9 (Homeobox protein Hox-2.5) (Homeobox protein Hox-2E) | EBI-10199927 | 0.56 |
| P25791 | Rhombotin-2 (Cysteine-rich protein TTG-2) (LIM domain only protein 2) (LMO-2) (T-cell translocation protein 2) | EBI-10202872 | 0.56 |
| P26196 | Probable ATP-dependent RNA helicase DDX6 (EC 3.6.4.13) (ATP-dependent RNA helicase p54) (DEAD box protein 6) (Oncogene RCK) | EBI-10203823 | 0.72 |
| P26640 | Valine--tRNA ligase (EC 6.1.1.9) (Protein G7a) (Valyl-tRNA synthetase) (ValRS) | EBI-10204357 | 0.56 |
| P32969 | 60S ribosomal protein L9 (Large ribosomal subunit protein uL6) | EBI-10206135 | 0.56 |
| P41227 | N-alpha-acetyltransferase 10 (EC 2.3.1.255) (N-terminal acetyltransferase complex ARD1 subunit homolog A) (hARD1) (NatA catalytic subunit Naa10) | EBI-10208549 | 0.78 |
| P49901 | Sperm mitochondrial-associated cysteine-rich protein | EBI-10211623 | 0.56 |
| P50539 | Max-interacting protein 1 (Max interactor 1) (Class C basic helix-loop-helix protein 11) (bHLHc11) | EBI-10212007 | 0.72 |
| P51946 | Cyclin-H (MO15-associated protein) (p34) (p37) | EBI-10212597 | 0.56 |
| P61968 | LIM domain transcription factor LMO4 (Breast tumor autoantigen) (LIM domain only protein 4) (LMO-4) | EBI-10218982 | 0.56 |
| P62979 | Ubiquitin-40S ribosomal protein S27a (Ubiquitin carboxyl extension protein 80) [Cleaved into: Ubiquitin; 40S ribosomal protein S27a (Small ribosomal subunit protein eS31)] | EBI-10220080 | 0.56 |
| Q02040 | A-kinase anchor protein 17A (AKAP-17A) (721P) (B-lymphocyte antigen) (Protein XE7) (Protein kinase A-anchoring protein 17A) (PRKA17A) (Splicing factor, arginine/serine-rich 17A) | EBI-10222670 | 0.56 |
| Q05CH4 | SLC15A3 protein | EBI-10223754 | 0.56 |
| Q08117 | TLE family member 5 (Amino-terminal enhancer of split) (Amino enhancer of split) (Gp130-associated protein GAM) (Grg-5) (Groucho-related protein 5) (Protein ESP1) (Protein GRG) (TLE family member 5, transcriptional modulator) | EBI-10224979 | 0.56 |
| Q12774 | Rho guanine nucleotide exchange factor 5 (Ephexin-3) (Guanine nucleotide regulatory protein TIM) (Oncogene TIM) (Transforming immortalized mammary oncogene) (p60 TIM) | EBI-10227037 | 0.56 |
| Q14997 | Proteasome activator complex subunit 4 (Proteasome activator PA200) | EBI-10234580 | 0.56 |
| Q14D33 | Receptor-transporting protein 5 (3CxxC-type zinc finger protein 5) (CXXC-type zinc finger protein 11) | EBI-10234924 | 0.72 |
| Q17RB8 | LON peptidase N-terminal domain and RING finger protein 1 (RING finger protein 191) | EBI-10238780 | 0.56 |
| Q3B820 | Protein FAM161A | EBI-10240301 | 0.72 |
| Q5U5U6 | Epididymis secretory protein Li 50 (Ubiquitin B) (Ubiquitin B, isoform CRA_a) | EBI-10247590 | 0.56 |
| Q6NYC8 | Phostensin (Protein phosphatase 1 F-actin cytoskeleton-targeting subunit) (Protein phosphatase 1 regulatory subunit 18) | EBI-10251814 | 0.56 |
| Q6P4J0 | N-terminal amino-acid N(alpha)-acetyltransferase NatA (EC 2.3.1.255) | EBI-10252829 | 0.56 |
| Q6PIY7 | Poly(A) RNA polymerase GLD2 (hGLD-2) (EC 2.7.7.19) (PAP-associated domain-containing protein 4) (Terminal nucleotidyltransferase 2) (Terminal uridylyltransferase 2) (TUTase 2) | EBI-10253897 | 0.56 |
| Q7Z4I7 | LIM and senescent cell antigen-like-containing domain protein 2 (LIM-like protein 2) (Particularly interesting new Cys-His protein 2) (PINCH-2) | EBI-10257703 | 0.56 |
| Q86TG7 | Retrotransposon-derived protein PEG10 (Embryonal carcinoma differentiation-regulated protein) (Mammalian retrotransposon-derived protein 2) (Myelin expression factor 3-like protein 1) (MEF3-like protein 1) (Paternally expressed gene 10 protein) (Retrotransposon gag domain-containing protein 3) (Retrotransposon-derived gag-like polyprotein) (Ty3/Gypsy-like protein) | EBI-10258559 | 0.67 |
| Q86W54 | Spermatogenesis-associated protein 24 (Testis protein T6441 homolog) | EBI-10259956 | 0.56 |
| Q8IVS8 | Glycerate kinase (EC 2.7.1.31) (HBeAg-binding protein 4) | EBI-10261677 | 0.56 |
| Q8IYX8 | Centrosomal protein CEP57L1 (Centrosomal protein 57kDa-like protein 1) (Centrosomal protein of 57 kDa-related protein) (Cep57R) (Cep57-related protein) | EBI-10264302 | 0.56 |
| Q8N4T4 | Rho guanine nucleotide exchange factor 39 | EBI-10265711 | 0.67 |
| Q8NBM4 | Ubiquitin-associated domain-containing protein 2 (UBA domain-containing protein 2) (Phosphoglycerate dehydrogenase-like protein 1) | EBI-10269199 | 0.56 |
| Q8TBE0 | Bromo adjacent homology domain-containing 1 protein (BAH domain-containing protein 1) | EBI-10273199 | 0.56 |
| Q8TBZ8 | Zinc finger protein 564 | EBI-10273829 | 0.56 |
| Q8TES7 | Fas-binding factor 1 (FBF-1) (Protein albatross) | EBI-10275340 | 0.56 |
| Q8WU02 | C9orf61 protein | EBI-10276217 | 0.56 |
| Q8WXI9 | Transcriptional repressor p66-beta (GATA zinc finger domain-containing protein 2B) (p66/p68) | EBI-10278009 | 0.56 |
| Q92567 | Protein FAM168A (Tongue cancer chemotherapy resistance-associated protein 1) | EBI-10278631 | 0.56 |
| Q92608 | Dedicator of cytokinesis protein 2 | EBI-10278809 | 0.56 |
| Q969Z0 | FAST kinase domain-containing protein 4 (Cell cycle progression restoration protein 2) (Cell cycle progression protein 2) (Protein TBRG4) (Transforming growth factor beta regulator 4) | EBI-10281521 | 0.56 |
| Q96A72 | Protein mago nashi homolog 2 | EBI-10281716 | 0.72 |
| Q96BZ8 | Leukocyte receptor cluster member 1 | EBI-10282682 | 0.56 |
| Q96C32 | Polyubiquitin-C (UBC protein) | EBI-10283082 | 0.56 |
| Q96D03 | DNA damage-inducible transcript 4-like protein (HIF-1 responsive protein RTP801-like) (Protein regulated in development and DNA damage response 2) (REDD-2) | EBI-10284252 | 0.56 |
| Q99732 | Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LPS-induced TNF-alpha factor) (Small integral membrane protein of lysosome/late endosome) (p53-induced gene 7 protein) | EBI-10294748 | 0.72 |
| Q9BU23 | Lipase maturation factor 2 (Transmembrane protein 112B) (Transmembrane protein 153) | EBI-10298573 | 0.56 |
| Q9BV47 | Dual specificity protein phosphatase 26 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity phosphatase SKRP3) (Low-molecular-mass dual-specificity phosphatase 4) (DSP-4) (LDP-4) (Mitogen-activated protein kinase phosphatase 8) (MAP kinase phosphatase 8) (MKP-8) (Novel amplified gene in thyroid anaplastic cancer) | EBI-10299234 | 0.56 |
| Q9BXF9 | Tektin-3 | EBI-10301058 | 0.67 |
| Q9BXY8 | Protein BEX2 (Brain-expressed X-linked protein 2) (hBex2) | EBI-10301594 | 0.56 |
| Q9H7H0 | Methyltransferase-like protein 17, mitochondrial (EC 2.1.1.-) (False p73 target gene protein) (Methyltransferase 11 domain-containing protein 1) (Protein RSM22 homolog, mitochondrial) | EBI-10308833 | 0.78 |
| Q9HC52 | Chromobox protein homolog 8 (Polycomb 3 homolog) (Pc3) (hPc3) (Rectachrome 1) | EBI-10310384 | 0.72 |
| Q9NQT4 | Exosome complex component RRP46 (Chronic myelogenous leukemia tumor antigen 28) (Exosome component 5) (Ribosomal RNA-processing protein 46) (p12B) | EBI-10312366 | 0.56 |
| Q9NU19 | TBC1 domain family member 22B | EBI-10313689 | 0.56 |
| Q9NX63 | MICOS complex subunit MIC19 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 3) | EBI-10316161 | 0.56 |
| Q9P0T4 | Zinc finger protein 581 | EBI-10317870 | 0.56 |
| Q9P2K6 | Kelch-like protein 42 (Cullin-3-binding protein 9) (Ctb9) (Kelch domain-containing protein 5) | EBI-10318921 | 0.56 |
| Q9UIM3 | FK506-binding protein-like (WAF-1/CIP1 stabilizing protein 39) (WISp39) | EBI-10322118 | 0.56 |
| Q9UJV3 | Probable E3 ubiquitin-protein ligase MID2 (EC 2.3.2.27) (Midin-2) (Midline defect 2) (Midline-2) (RING finger protein 60) (RING-type E3 ubiquitin transferase MID2) (Tripartite motif-containing protein 1) | EBI-10322427 | 0.56 |
| Q9UJW0 | Dynactin subunit 4 (Dyn4) (Dynactin subunit p62) | EBI-10322497 | 0.56 |
| Q9UMS0 | NFU1 iron-sulfur cluster scaffold homolog, mitochondrial (HIRA-interacting protein 5) | EBI-10324153 | 0.56 |
| Q9Y3M9 | Zinc finger protein 337 | EBI-10327900 | 0.56 |
| Q9Y4X0 | Nuclear protein AMMECR1 (AMME syndrome candidate gene 1 protein) | EBI-10328456 | 0.67 |
| P30566 | Adenylosuccinate lyase (ADSL) (ASL) (EC 4.3.2.2) (Adenylosuccinase) (ASase) | EBI-21246927 | 0.37 |
| Q9HBZ2 | Aryl hydrocarbon receptor nuclear translocator 2 (ARNT protein 2) (Class E basic helix-loop-helix protein 1) (bHLHe1) | EBI-21247102 | 0.37 |
| X5DP31 | Aryl-hydrocarbon receptor nuclear translocator 2 isoform E | EBI-21247566 | 0.37 |
| X5D7R7 | Major vault protein isoform G | EBI-21250303 | 0.37 |
| X5DP17 | Major vault protein isoform H | EBI-21250609 | 0.37 |
| Q99608 | Necdin | EBI-21250960 | 0.37 |
| O43741 | 5'-AMP-activated protein kinase subunit beta-2 (AMPK subunit beta-2) | EBI-21251734 | 0.37 |
| P03182 | Apoptosis regulator BHRF1 (Early antigen protein R) (EA-R) (Nuclear antigen) | EBI-11721938 | 0.35 |
| P30119 | Uncharacterized protein BTRF1 | EBI-11736591 | 0.37 |
| P05759 | Ubiquitin-40S ribosomal protein S31 [Cleaved into: Ubiquitin; 40S ribosomal protein S31 (CEP76) (S37) (Small ribosomal subunit protein eS31) (YS24)] | EBI-11522944 | 0.56 |
| P0CH08 | Ubiquitin-60S ribosomal protein L40 [Cleaved into: Ubiquitin; 60S ribosomal protein L40-A (CEP52) (Large ribosomal subunit protein eL40-A)] | EBI-11523121 | 0.56 |
| P32902 | 37S ribosomal protein MRP4, mitochondrial (Mitochondrial small ribosomal subunit protein uS2m) | EBI-11526925 | 0.56 |
| P38815 | Endosomal/vacuolar adapter protein YPT35 (PX domain-containing protein YPT35) | EBI-11529521 | 0.56 |
| P39518 | Long-chain-fatty-acid--CoA ligase 2 (EC 6.2.1.3) (Fatty acid activator 2) (Long-chain acyl-CoA synthetase 2) | EBI-11529902 | 0.56 |
| P40302 | Proteasome subunit alpha type-6 (Macropain subunit PRE5) (Multicatalytic endopeptidase complex subunit PRE5) (Proteasome component PRE5) (Proteinase YSCE subunit PRE5) | EBI-11530551 | 0.56 |
| P40325 | Proline-rich protein HUA1 | EBI-11530725 | 0.56 |
| P41911 | Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial (EC 1.1.1.8) | EBI-11531747 | 0.56 |
| Q06630 | Mitochondrial homologous recombination protein 1 (Cross-linked transcription component 1) (Mitochondrial large ribosomal subunit protein mL67) | EBI-11535826 | 0.56 |
| Q06707 | SWR1-complex protein 7 | EBI-11535920 | 0.56 |
| Q07821 | Iron-sulfur assembly protein 1 | EBI-11536127 | 0.56 |
| Q12342 | Protein LDB17 (Low dye-binding protein 17) | EBI-11537295 | 0.56 |
| P28702 | Retinoic acid receptor RXR-beta (Nuclear receptor subfamily 2 group B member 2) (Retinoid X receptor beta) | EBI-16433077 | 0.56 |
| A0A0S2Z4M1 | Axin-1 (Axis inhibition protein 1) | EBI-16433037 | 0.56 |
| O15169 | Axin-1 (Axis inhibition protein 1) (hAxin) | EBI-16433027 | 0.56 |
| A0A0S2Z5X4 | Zinc finger protein 688 isoform 4 | EBI-16433137 | 0.56 |
| Q3SY00 | Testis-specific protein 10-interacting protein (Tsga10-interacting protein) | EBI-24288555 | 0.56 |
| P57086 | SCAN domain-containing protein 1 | EBI-24289178 | 0.56 |
| P47897 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | EBI-24292527 | 0.56 |
| Q7L5A3 | Protein FAM214B | EBI-24308054 | 0.56 |
| Q5JVL4 | EF-hand domain-containing protein 1 (Myoclonin-1) | EBI-24316916 | 0.56 |
| P56524 | Histone deacetylase 4 (HD4) (EC 3.5.1.98) | EBI-24325092 | 0.56 |
| Q9P1Z0 | Zinc finger and BTB domain-containing protein 4 (KAISO-like zinc finger protein 1) (KAISO-L1) | EBI-24331244 | 0.56 |
| Q96HB5 | Coiled-coil domain-containing protein 120 | EBI-24332120 | 0.56 |
| P54646 | 5'-AMP-activated protein kinase catalytic subunit alpha-2 (AMPK subunit alpha-2) (EC 2.7.11.1) (Acetyl-CoA carboxylase kinase) (ACACA kinase) (EC 2.7.11.27) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase) (EC 2.7.11.31) | EBI-24338182 | 0.56 |
| Q9BSH4 | Translational activator of cytochrome c oxidase 1 (Coiled-coil domain-containing protein 44) (Translational activator of mitochondrially-encoded cytochrome c oxidase I) | EBI-24338552 | 0.56 |
| Q96FJ0 | AMSH-like protease (AMSH-LP) (EC 3.4.19.-) (STAM-binding protein-like 1) | EBI-25243983 | 0.56 |
| P51504 | Zinc finger protein 80 (ZNFpT17) | EBI-24480415 | 0.56 |
| Q8NE01 | Metal transporter CNNM3 (Ancient conserved domain-containing protein 3) (Cyclin-M3) | EBI-24488458 | 0.56 |
| Q8NA54 | IQ and ubiquitin-like domain-containing protein | EBI-24496225 | 0.56 |
| Q14005 | Pro-interleukin-16 [Cleaved into: Interleukin-16 (IL-16) (Lymphocyte chemoattractant factor) (LCF)] | EBI-24503792 | 0.56 |
| Q96IQ9 | Zinc finger protein 414 | EBI-24507508 | 0.56 |
| Q494U1 | Pleckstrin homology domain-containing family N member 1 (PH domain-containing family N member 1) (Cardiolipin and phosphatidic acid-binding protein) | EBI-24374123 | 0.56 |
| Q9BWG6 | Sodium channel modifier 1 | EBI-24383955 | 0.56 |
| Q6NX45 | Zinc finger protein 774 | EBI-24388156 | 0.56 |
| Q6VB84 | Forkhead box protein D4-like 3 (FOXD4-like 3) | EBI-24390683 | 0.56 |
| Q9C0A6 | Histone-lysine N-methyltransferase SETD5 (EC 2.1.1.359) (EC 2.1.1.367) (SET domain-containing protein 5) | EBI-24391757 | 0.56 |
| O00311 | Cell division cycle 7-related protein kinase (CDC7-related kinase) (HsCdc7) (huCdc7) (EC 2.7.11.1) | EBI-24403310 | 0.56 |
| P08218 | Chymotrypsin-like elastase family member 2B (EC 3.4.21.71) (Elastase-2B) | EBI-24406407 | 0.56 |
| P09067 | Homeobox protein Hox-B5 (Homeobox protein HHO.C10) (Homeobox protein Hox-2A) (Homeobox protein Hu-1) | EBI-24427120 | 0.56 |
| Q5T619 | Zinc finger protein 648 | EBI-24430220 | 0.56 |
| Q9H7X3 | Zinc finger protein 696 | EBI-24432271 | 0.56 |
| Q6PF15 | Kelch-like protein 35 | EBI-24453693 | 0.56 |
| Q9BXW4 | Microtubule-associated proteins 1A/1B light chain 3C (Autophagy-related protein LC3 C) (Autophagy-related ubiquitin-like modifier LC3 C) (MAP1 light chain 3-like protein 3) (MAP1A/MAP1B light chain 3 C) (MAP1A/MAP1B LC3 C) (Microtubule-associated protein 1 light chain 3 gamma) | EBI-24455075 | 0.56 |
| Q99633 | Pre-mRNA-splicing factor 18 (PRP18 homolog) (hPRP18) | EBI-24456947 | 0.56 |
| P28676 | Grancalcin | EBI-24461986 | 0.56 |
| Q6IQ23 | Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7) | EBI-16398399 | 0.35 |
| Q53EZ4 | Centrosomal protein of 55 kDa (Cep55) (Up-regulated in colon cancer 6) | EBI-21572102 | 0.35 |
| P0CG47 | Polyubiquitin-B [Cleaved into: Ubiquitin] | EBI-21572102 | 0.35 |
| Q3KP66 | Innate immunity activator protein | EBI-21617875 | 0.35 |
| Q9BU40 | Chordin-like protein 1 (Neuralin-1) (Neurogenesin-1) (Ventroptin) | EBI-21739567 | 0.35 |
| Q96DB2 | Histone deacetylase 11 (HD11) (EC 3.5.1.98) | EBI-21787335 | 0.35 |
| E9PKR8 | Sulfotransferase (EC 2.8.2.-) | EBI-21872066 | 0.35 |
| Q9UHQ4 | B-cell receptor-associated protein 29 (BCR-associated protein 29) (Bap29) | EBI-21883433 | 0.40 |
| P29972 | Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Urine water channel) (Water channel protein for red blood cells and kidney proximal tubule) | EBI-21268671 | 0.37 |
| Q9H788 | SH2 domain-containing protein 4A (Protein SH(2)A) (Protein phosphatase 1 regulatory subunit 38) | EBI-21268710 | 0.37 |
| P15622 | Zinc finger protein 250 (Zinc finger protein 647) | EBI-21268658 | 0.37 |
| Q96HA8 | Protein N-terminal glutamine amidohydrolase (EC 3.5.1.122) (Protein NH2-terminal glutamine deamidase) (N-terminal Gln amidase) (Nt(Q)-amidase) (WDYHV motif-containing protein 1) | EBI-21268697 | 0.37 |
| P61417 | Chaperone protein YscY (Yop proteins translocation protein Y) | EBI-20817146 | 0.37 |
| Q83DE4 | Uncharacterized protein | EBI-21285435 | 0.37 |
| P21580 | Tumor necrosis factor alpha-induced protein 3 (TNF alpha-induced protein 3) (EC 2.3.2.-) (EC 3.4.19.12) (OTU domain-containing protein 7C) (Putative DNA-binding protein A20) (Zinc finger protein A20) [Cleaved into: A20p50; A20p37] | EBI-20737339 | 0.35 |
| Q9UKE5 | TRAF2 and NCK-interacting protein kinase (EC 2.7.11.1) | EBI-28946906 | 0.55 |
| Q14296 | Fas-activated serine/threonine kinase (FAST kinase) (EC 2.7.11.1) (EC 2.7.11.8) | EBI-22127120 | 0.37 |
| P0CG48 | Polyubiquitin-C [Cleaved into: Ubiquitin] | EBI-22146758 | 0.37 |
| Q92574 | Hamartin (Tuberous sclerosis 1 protein) | EBI-26515497 | 0.37 |
| Q8N612 | FHF complex subunit HOOK interacting protein 1B (FHIP1B) (FTS and Hook-interacting protein) (FHIP) | EBI-34574737 | 0.27 |
Database | Links |
| UNIPROT | Q13137 B2RBT0 B4DDC4 B4DDT4 B4DP36 B4E0C0 E7ENK0 E7ETP5 E9PBE5 Q53FQ5 Q53HB5 Q6IBN9 Q9BTF7 |
| PDB | 2MXP 3VVV 3VVW 4GXL 4HAN 4XKL 5AAQ 5Z7A 5Z7L 7EAA |
| Pfam | PF17751 |
| PROSITE | PS51905 |
| OMIM | 604587 |
| DisGeNET | 10241 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory