Protein Information |
|
|---|---|
| Protein Name | Receptor-type tyrosine-protein phosphatase R |
| Accession Code | Q15256 |
| Gene | PTPRR |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 657) | |
|
MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQKIYRHSYHSSSEAQVSKRHQI VNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKK NSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI IVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATS VCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEI PMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMV WQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDS AQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFV HHALCLYESRLSAETVQ |
|
Structure Viewer (PDB: 2A8B) |
|---|
Description |
||
|---|---|---|
| [Isoform Alpha]: Cell membrane; Single-pass type I membrane protein. [Isoform Delta]: Cytoplasm, perinuclear region. Note=Locates to the perinuclear areas within the cytoplasm. [Isoform Gamma]: Cytoplasm, perinuclear region. Note=Locates to the perinuclear areas within the cytoplasm. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms |
| Cellular Component | Cell Junction (GO:0030054) Cytosol (GO:0005829) Extracellular Space (GO:0005615) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) |
|
Description |
|
|---|---|
| Sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus (By similarity). {By Similarity}. | Assigned Ontology terms |
| Biological Process | ERBB2 Signaling Pathway (GO:0038128) In Utero Embryonic Development (GO:0001701) Negative Regulation Of Epithelial Cell Migration (GO:0010633) Negative Regulation Of ERK1 And ERK2 Cascade (GO:0070373) Peptidyl-Tyrosine Dephosphorylation (GO:0035335) Protein Dephosphorylation (GO:0006470) Signal Transduction (GO:0007165) |
| Molecular Function | Protein Kinase Binding (GO:0019901) Protein Tyrosine Phosphatase Activity (GO:0004725) Transmembrane Receptor Protein Tyrosine Phosphatase Activity (GO:0005001) |
Interactions with Nuclear Envelope proteins (6 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| Q15256 | Self | EBI-7670318 | 0.31 |
| P00533 | Epidermal growth factor receptor | EBI-20980716 | 0.37 |
| P04626 | Receptor tyrosine-protein kinase erbB-2 | EBI-20977323 | 0.51 |
| P02545 | Lamin-A/C | EBI-25393868 | 0.35 |
| Q6ZMQ8 | Serine/threonine-protein kinase LMTK1 | EBI-20980062 | 0.37 |
| P42704 | Leucine-rich PPR motif-containing protein, mitochondrial | EBI-25393868 | 0.35 | Interactions with other proteins (83 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P19022 | Cadherin-2 (CDw325) (Neural cadherin) (N-cadherin) (CD antigen CD325) | EBI-2265623 | 0.00 |
| P09619 | Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2.7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) (CD140 antigen-like family member B) (Platelet-derived growth factor receptor 1) (PDGFR-1) (CD antigen CD140b) | EBI-2265708 | 0.00 |
| Q16539 | Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (Cytokine suppressive anti-inflammatory drug-binding protein) (CSAID-binding protein) (CSBP) (MAP kinase MXI2) (MAX-interacting protein 2) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha) (Stress-activated protein kinase 2a) (SAPK2a) | EBI-16067405 | 0.65 |
| P28482 | Mitogen-activated protein kinase 1 (MAP kinase 1) (MAPK 1) (EC 2.7.11.24) (ERT1) (Extracellular signal-regulated kinase 2) (ERK-2) (MAP kinase isoform p42) (p42-MAPK) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) | EBI-7157244 | 0.58 |
| Q9H0R8 | Gamma-aminobutyric acid receptor-associated protein-like 1 (Early estrogen-regulated protein) (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1) | EBI-24684656 | 0.56 |
| P06213 | Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta] | EBI-21132493 | 0.51 |
| Q8IWU2 | Serine/threonine-protein kinase LMTK2 (EC 2.7.11.1) (Apoptosis-associated tyrosine kinase 2) (Brain-enriched kinase) (hBREK) (CDK5/p35-regulated kinase) (CPRK) (Kinase/phosphatase/inhibitor 2) (Lemur tyrosine kinase 2) (Serine/threonine-protein kinase KPI-2) | EBI-20979781 | 0.37 |
| Q15303 | Receptor tyrosine-protein kinase erbB-4 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-4) (Tyrosine kinase-type cell surface receptor HER4) (p180erbB4) [Cleaved into: ERBB4 intracellular domain (4ICD) (E4ICD) (s80HER4)] | EBI-20980546 | 0.37 |
| P21860 | Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3) | EBI-20980866 | 0.37 |
| Q02763 | Angiopoietin-1 receptor (EC 2.7.10.1) (Endothelial tyrosine kinase) (Tunica interna endothelial cell kinase) (Tyrosine kinase with Ig and EGF homology domains-2) (Tyrosine-protein kinase receptor TEK) (Tyrosine-protein kinase receptor TIE-2) (hTIE2) (p140 TEK) (CD antigen CD202b) | EBI-20981106 | 0.37 |
| Q01973 | Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Neurotrophic tyrosine kinase, receptor-related 1) | EBI-20981500 | 0.37 |
| P07949 | Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment] | EBI-20981400 | 0.37 |
| P34925 | Tyrosine-protein kinase RYK (EC 2.7.10.1) | EBI-20981440 | 0.37 |
| Q01974 | Tyrosine-protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor-related 2) | EBI-20981640 | 0.37 |
| P08069 | Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] | EBI-20981970 | 0.37 |
| Q13308 | Inactive tyrosine-protein kinase 7 (Colon carcinoma kinase 4) (CCK-4) (Protein-tyrosine kinase 7) (Pseudo tyrosine kinase receptor 7) (Tyrosine-protein kinase-like 7) | EBI-20982240 | 0.37 |
| P29317 | Ephrin type-A receptor 2 (EC 2.7.10.1) (Epithelial cell kinase) (Tyrosine-protein kinase receptor ECK) | EBI-20982664 | 0.37 |
| Q62190 | Macrophage-stimulating protein receptor (MSP receptor) (EC 2.7.10.1) (Stem cell-derived tyrosine kinase) (p185-Ron) (CD antigen CD136) [Cleaved into: Macrophage-stimulating protein receptor alpha chain; Macrophage-stimulating protein receptor beta chain] | EBI-21223151 | 0.37 |
| P04629 | High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (p140-TrkA) | EBI-21224974 | 0.37 |
| P21802 | Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332) | EBI-21226905 | 0.37 |
| P22455 | Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334) | EBI-21227046 | 0.37 |
| P35968 | Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase insert domain receptor) (KDR) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309) | EBI-21227083 | 0.37 |
| P17987 | T-complex protein 1 subunit alpha (TCP-1-alpha) (CCT-alpha) | EBI-25383510 | 0.35 |
| P19338 | Nucleolin (Protein C23) | EBI-25383510 | 0.35 |
| P22087 | rRNA 2'-O-methyltransferase fibrillarin (EC 2.1.1.-) (34 kDa nucleolar scleroderma antigen) (Histone-glutamine methyltransferase) (U6 snRNA 2'-O-methyltransferase fibrillarin) | EBI-25383510 | 0.35 |
| P40227 | T-complex protein 1 subunit zeta (TCP-1-zeta) (Acute morphine dependence-related protein 2) (CCT-zeta-1) (HTR3) (Tcp20) | EBI-25383510 | 0.35 |
| P48643 | T-complex protein 1 subunit epsilon (TCP-1-epsilon) (CCT-epsilon) | EBI-25383510 | 0.35 |
| P49368 | T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma) (hTRiC5) | EBI-25383510 | 0.35 |
| P50990 | T-complex protein 1 subunit theta (TCP-1-theta) (CCT-theta) (Chaperonin containing T-complex polypeptide 1 subunit 8) (Renal carcinoma antigen NY-REN-15) | EBI-25383510 | 0.35 |
| P50991 | T-complex protein 1 subunit delta (TCP-1-delta) (CCT-delta) (Stimulator of TAR RNA-binding) | EBI-25383510 | 0.35 |
| P78371 | T-complex protein 1 subunit beta (TCP-1-beta) (CCT-beta) | EBI-25383510 | 0.35 |
| Q13610 | Periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) | EBI-25383510 | 0.35 |
| Q5VZ46 | Uncharacterized protein KIAA1614 | EBI-25383510 | 0.35 |
| Q6P5R6 | 60S ribosomal protein L22-like 1 (Large ribosomal subunit protein eL22-like 1) | EBI-25383510 | 0.35 |
| Q99832 | T-complex protein 1 subunit eta (TCP-1-eta) (CCT-eta) (HIV-1 Nef-interacting protein) [Cleaved into: T-complex protein 1 subunit eta, N-terminally processed] | EBI-25383510 | 0.35 |
| Q9BQ67 | Glutamate-rich WD repeat-containing protein 1 | EBI-25383510 | 0.35 |
| Q9NSD9 | Phenylalanine--tRNA ligase beta subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase beta subunit) (PheRS) | EBI-25383510 | 0.35 |
| Q9NUL7 | Probable ATP-dependent RNA helicase DDX28 (EC 3.6.4.13) (Mitochondrial DEAD box protein 28) | EBI-25383510 | 0.35 |
| Q9NVI7 | ATPase family AAA domain-containing protein 3A | EBI-25383510 | 0.35 |
| O60783 | 28S ribosomal protein S14, mitochondrial (MRP-S14) (S14mt) (Mitochondrial small ribosomal subunit protein uS14m) | EBI-25393868 | 0.35 |
| O75688 | Protein phosphatase 1B (EC 3.1.3.16) (Protein phosphatase 2C isoform beta) (PP2C-beta) | EBI-25393868 | 0.35 |
| P07237 | Protein disulfide-isomerase (PDI) (EC 5.3.4.1) (Cellular thyroid hormone-binding protein) (Prolyl 4-hydroxylase subunit beta) (p55) | EBI-25393868 | 0.35 |
| P10809 | 60 kDa heat shock protein, mitochondrial (EC 5.6.1.7) (60 kDa chaperonin) (Chaperonin 60) (CPN60) (Heat shock protein 60) (HSP-60) (Hsp60) (HuCHA60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein) | EBI-25393868 | 0.35 |
| P14625 | Endoplasmin (94 kDa glucose-regulated protein) (GRP-94) (Heat shock protein 90 kDa beta member 1) (Tumor rejection antigen 1) (gp96 homolog) | EBI-25393868 | 0.35 |
| P23528 | Cofilin-1 (18 kDa phosphoprotein) (p18) (Cofilin, non-muscle isoform) | EBI-25393868 | 0.35 |
| P31153 | S-adenosylmethionine synthase isoform type-2 (AdoMet synthase 2) (EC 2.5.1.6) (Methionine adenosyltransferase 2) (MAT 2) (Methionine adenosyltransferase II) (MAT-II) | EBI-25393868 | 0.35 |
| P42166 | Lamina-associated polypeptide 2, isoform alpha (Thymopoietin isoform alpha) (TP alpha) (Thymopoietin-related peptide isoform alpha) (TPRP isoform alpha) [Cleaved into: Thymopoietin (TP) (Splenin); Thymopentin (TP5)] | EBI-25393868 | 0.35 |
| P56134 | ATP synthase subunit f, mitochondrial (ATP synthase membrane subunit f) | EBI-25393868 | 0.35 |
| P63261 | Actin, cytoplasmic 2 (EC 3.6.4.-) (Gamma-actin) [Cleaved into: Actin, cytoplasmic 2, N-terminally processed] | EBI-25393868 | 0.35 |
| P82650 | 28S ribosomal protein S22, mitochondrial (MRP-S22) (S22mt) (Mitochondrial small ribosomal subunit protein mS22) | EBI-25393868 | 0.35 |
| P82673 | 28S ribosomal protein S35, mitochondrial (MRP-S35) (S35mt) (28S ribosomal protein S28, mitochondrial) (MRP-S28) (S28mt) (Mitochondrial small ribosomal subunit protein mS35) | EBI-25393868 | 0.35 |
| P82675 | 28S ribosomal protein S5, mitochondrial (MRP-S5) (S5mt) (Mitochondrial small ribosomal subunit protein uS5m) | EBI-25393868 | 0.35 |
| P82914 | 28S ribosomal protein S15, mitochondrial (MRP-S15) (S15mt) (Mitochondrial small ribosomal subunit protein uS15m) | EBI-25393868 | 0.35 |
| P82930 | 28S ribosomal protein S34, mitochondrial (MRP-S34) (S34mt) (Mitochondrial small ribosomal subunit protein mS34) | EBI-25393868 | 0.35 |
| Q02978 | Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP) (alpha-oxoglutarate carrier) (Solute carrier family 25 member 11) (SLC25A11) | EBI-25393868 | 0.35 |
| Q15149 | Plectin (PCN) (PLTN) (Hemidesmosomal protein 1) (HD1) (Plectin-1) | EBI-25393868 | 0.35 |
| Q16875 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (6PF-2-K/Fru-2,6-P2ase 3) (PFK/FBPase 3) (6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme) (Renal carcinoma antigen NY-REN-56) (iPFK-2) [Includes: 6-phosphofructo-2-kinase (EC 2.7.1.105); Fructose-2,6-bisphosphatase (EC 3.1.3.46)] | EBI-25393868 | 0.35 |
| Q7L014 | Probable ATP-dependent RNA helicase DDX46 (EC 3.6.4.13) (DEAD box protein 46) (PRP5 homolog) | EBI-25393868 | 0.35 |
| Q8NCE2 | Myotubularin-related protein 14 (EC 3.1.3.-) (HCV NS5A-transactivated protein 4 splice variant A-binding protein 1) (NS5ATP4ABP1) (hJumpy) | EBI-25393868 | 0.35 |
| Q92552 | 28S ribosomal protein S27, mitochondrial (MRP-S27) (S27mt) (Mitochondrial ribosomal protein S27) (Mitochondrial small ribosomal subunit protein mS27) | EBI-25393868 | 0.35 |
| Q92665 | 28S ribosomal protein S31, mitochondrial (MRP-S31) (S31mt) (Imogen 38) (Mitochondrial small ribosomal subunit protein mS31) | EBI-25393868 | 0.35 |
| Q96EY1 | DnaJ homolog subfamily A member 3, mitochondrial (DnaJ protein Tid-1) (hTid-1) (Hepatocellular carcinoma-associated antigen 57) (Tumorous imaginal discs protein Tid56 homolog) | EBI-25393868 | 0.35 |
| Q96EY7 | Pentatricopeptide repeat domain-containing protein 3, mitochondrial (28S ribosomal protein S39, mitochondrial) (MRP-S39) (Mitochondrial small ribosomal subunit protein mS39) (Transformation-related gene 15 protein) (TRG-15) | EBI-25393868 | 0.35 |
| Q9BU76 | Multiple myeloma tumor-associated protein 2 (hMMTAG2) | EBI-25393868 | 0.35 |
| Q9GZT3 | SRA stem-loop-interacting RNA-binding protein, mitochondrial | EBI-25393868 | 0.35 |
| Q9H3K6 | BolA-like protein 2 | EBI-25393868 | 0.35 |
| Q9NWB6 | Arginine and glutamate-rich protein 1 | EBI-25393868 | 0.35 |
| Q9NXV2 | BTB/POZ domain-containing protein KCTD5 | EBI-25393868 | 0.35 |
| Q9ULV4 | Coronin-1C (Coronin-3) (hCRNN4) | EBI-25393868 | 0.35 |
| Q9Y291 | 28S ribosomal protein S33, mitochondrial (MRP-S33) (S33mt) (Mitochondrial small ribosomal subunit protein mS33) | EBI-25393868 | 0.35 |
| Q9Y2Q9 | 28S ribosomal protein S28, mitochondrial (MRP-S28) (S28mt) (28S ribosomal protein S35, mitochondrial) (MRP-S35) (S35mt) (Mitochondrial small ribosomal subunit protein bS1m) | EBI-25393868 | 0.35 |
| Q9Y2R9 | 28S ribosomal protein S7, mitochondrial (MRP-S7) (S7mt) (Mitochondrial small ribosomal subunit protein uS7m) (bMRP-27a) (bMRP27a) | EBI-25393868 | 0.35 |
| Q9Y399 | 28S ribosomal protein S2, mitochondrial (MRP-S2) (S2mt) (Mitochondrial small ribosomal subunit protein uS2m) | EBI-25393868 | 0.35 |
| Q9Y3D9 | 28S ribosomal protein S23, mitochondrial (MRP-S23) (S23mt) (Mitochondrial small ribosomal subunit protein mS23) | EBI-25393868 | 0.35 |
| Q96F44 | E3 ubiquitin-protein ligase TRIM11 (EC 2.3.2.27) (Protein BIA1) (RING finger protein 92) (RING-type E3 ubiquitin transferase TRIM11) (Tripartite motif-containing protein 11) | EBI-27115100 | 0.35 |
| Q9UL42 | Paraneoplastic antigen Ma2 (40 kDa neuronal protein) (Onconeuronal antigen Ma2) (Paraneoplastic neuronal antigen MM2) | EBI-27115100 | 0.42 |
| P27361 | Mitogen-activated protein kinase 3 (MAP kinase 3) (MAPK 3) (EC 2.7.11.24) (ERT2) (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase isoform p44) (p44-MAPK) (Microtubule-associated protein 2 kinase) (p44-ERK1) | EBI-27115100 | 0.35 |
| P49366 | Deoxyhypusine synthase (DHS) (EC 2.5.1.46) | EBI-27115100 | 0.35 |
| P54886 | Delta-1-pyrroline-5-carboxylate synthase (P5CS) (Aldehyde dehydrogenase family 18 member A1) [Includes: Glutamate 5-kinase (GK) (EC 2.7.2.11) (Gamma-glutamyl kinase); Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase)] | EBI-27115100 | 0.35 |
| Q9UNH7 | Sorting nexin-6 (TRAF4-associated factor 2) [Cleaved into: Sorting nexin-6, N-terminally processed] | EBI-27116713 | 0.27 |
| O75165 | DnaJ homolog subfamily C member 13 (Required for receptor-mediated endocytosis 8) (RME-8) | EBI-27116713 | 0.27 |
| Q92609 | TBC1 domain family member 5 | EBI-27116713 | 0.27 |
| Q12768 | WASH complex subunit 5 (Strumpellin) (WASH complex subunit strumpellin) | EBI-27116713 | 0.27 |
Database | Links |
| UNIPROT | Q15256 B2R5Z7 B7Z3J1 F5GXR7 O00342 Q92682 Q9UE65 |
| PDB | 2A8B |
| Pfam | PF00102 |
| PROSITE | PS00383 PS50056 PS50055 |
| OMIM | 602853 |
| DisGeNET | 5801 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory