BDNF/NT-3 growth factors receptor - Homo sapiens

BDNF/NT-3 growth factors receptor (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	BDNF/NT-3 growth factors receptor
Accession Code	Q16620
Gene	NTRK2
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 822)
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLE IINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIK TLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYN GAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDY GTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNL CPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMA EGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNI KGIHTLLQNLAKASPVYLDILG

Structure Viewer (PDB: 4AT4)

Subcellular Location

Description
Cell membrane {Experimental EvidencePubMed:15494731}; Single-pass type I membrane protein {Curator Inference}. Endosome membrane {By SimilarityUniProtKB:P15209}; Single-pass type I membrane protein {By SimilarityUniProtKB:P15209}. Early endosome membrane {By SimilarityUniProtKB:P15209}. Cell projection, axon {ECO:0000250\|UniProtKB:Q63604}. Cell projection, dendrite {ECO:0000250\|UniProtKB:Q63604}. Cytoplasm, perinuclear region {ECO:0000250\|UniProtKB:Q63604}. Postsynaptic density {By SimilarityUniProtKB:P15209}. Note=Internalized to endosomes upon ligand-binding. {By SimilarityUniProtKB:P15209}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Anchoring Junction (GO:0070161) Axon (GO:0030424) Axon Terminus (GO:0043679) Cytosol (GO:0005829) Dendrite (GO:0030425) Dendritic Spine (GO:0043197) Early Endosome (GO:0005769) Early Endosome Membrane (GO:0031901) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Postsynaptic Density (GO:0014069) Receptor Complex (GO:0043235) Terminal Bouton (GO:0043195)

Biology & Function

Description
Receptor tyrosine kinase involved in the development and the maturation of the central and the peripheral nervous systems through regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity (By similarity). Receptor for BDNF/brain-derived neurotrophic factor and NTF4/neurotrophin-4. Alternatively can also bind NTF3/neurotrophin-3 which is less efficient in activating the receptor but regulates neuron survival through NTRK2 (PubMed:7574684, PubMed:15494731). Upon ligand- binding, undergoes homodimerization, autophosphorylation and activation (PubMed:15494731). Recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlapping signaling cascades. Through SHC1, FRS2, SH2B1, SH2B2 activates the GRB2-Ras-MAPK cascade that regulates for instance neuronal differentiation including neurite outgrowth. Through the same effectors controls the Ras-PI3 kinase-AKT1 signaling cascade that mainly regulates growth and survival. Through PLCG1 and the downstream protein kinase C-regulated pathways controls synaptic plasticity. Thereby, plays a role in learning and memory by regulating both short term synaptic function and long-term potentiation. PLCG1 also leads to NF-Kappa-B activation and the transcription of genes involved in cell survival. Hence, it is able to suppress anoikis, the apoptosis resulting from loss of cell-matrix interactions. May also play a role in neutrophin-dependent calcium signaling in glial cells and mediate communication between neurons and glia. {By SimilarityUniProtKB:P15209, Experimental EvidencePubMed:15494731, Experimental EvidencePubMed:7574684}.
Assigned Ontology terms

Biological Process	Brain-Derived Neurotrophic Factor Receptor Signaling Pathway (GO:0031547) Cellular Response To Amino Acid Stimulus (GO:0071230) Cellular Response To Brain-Derived Neurotrophic Factor Stimulus (GO:1990416) Cellular Response To Nerve Growth Factor Stimulus (GO:1990090) Central Nervous System Neuron Development (GO:0021954) Cerebral Cortex Development (GO:0021987) Circadian Rhythm (GO:0007623) Feeding Behavior (GO:0007631) Glutamate Secretion (GO:0014047) Learning (GO:0007612) Long-Term Synaptic Potentiation (GO:0060291) Mechanoreceptor Differentiation (GO:0042490) Myelination In Peripheral Nervous System (GO:0022011) Negative Regulation Of Amyloid-Beta Formation (GO:1902430) Negative Regulation Of Anoikis (GO:2000811) Negative Regulation Of Neuron Apoptotic Process (GO:0043524) Neuron Differentiation (GO:0030182) Neuron Migration (GO:0001764) Neuronal Action Potential Propagation (GO:0019227) Oligodendrocyte Differentiation (GO:0048709) Peptidyl-Serine Phosphorylation (GO:0018105) Peripheral Nervous System Neuron Development (GO:0048935) Positive Regulation Of Axonogenesis (GO:0050772) Positive Regulation Of Cell Population Proliferation (GO:0008284) Positive Regulation Of Gene Expression (GO:0010628) Positive Regulation Of Kinase Activity (GO:0033674) Positive Regulation Of MAPK Cascade (GO:0043410) Positive Regulation Of Neuron Projection Development (GO:0010976) Positive Regulation Of Peptidyl-Serine Phosphorylation (GO:0033138) Positive Regulation Of Phosphatidylinositol 3-Kinase Signaling (GO:0014068) Positive Regulation Of Protein Phosphorylation (GO:0001934) Positive Regulation Of Synapse Assembly (GO:0051965) Protein Autophosphorylation (GO:0046777) Regulation Of GTPase Activity (GO:0043087) Regulation Of Protein Kinase B Signaling (GO:0051896) Retinal Rod Cell Development (GO:0046548) Trans-Synaptic Signaling By BDNF, Modulating Synaptic Transmission (GO:0099183) Trans-Synaptic Signaling By Neuropeptide, Modulating Synaptic Transmission (GO:0099551) Transmembrane Receptor Protein Tyrosine Kinase Signaling Pathway (GO:0007169) Vasculogenesis (GO:0001570)
Molecular Function	ATP Binding (GO:0005524) Brain-Derived Neurotrophic Factor Binding (GO:0048403) Brain-Derived Neurotrophic Factor Receptor Activity (GO:0060175) Neurotrophin Binding (GO:0043121) Neurotrophin Receptor Activity (GO:0005030) Protease Binding (GO:0002020) Protein Homodimerization Activity (GO:0042803) Transmembrane Receptor Protein Tyrosine Kinase Activity (GO:0004714)

Disease associations

Description
Developmental and epileptic encephalopathy 58 (DEE58) [MIM:617830]: A form of epileptic encephalopathy, a heterogeneous group of severe early-onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. DEE58 is an autosomal dominant condition characterized by onset of refractory seizures in the first days or months of life. {Experimental EvidencePubMed:29100083}. Note=The disease may be caused by variants affecting the gene represented in this entry. Obesity, hyperphagia, and developmental delay (OBHD) [MIM:613886]: A disorder characterized by early-onset obesity, hyperphagia, and severe developmental delay in motor function, speech, and language. {Experimental EvidencePubMed:15494731, Experimental EvidencePubMed:27884935, Experimental EvidencePubMed:29100083}. Note=The disease is caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	600456 613886 617830
DisGeNET	4915

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (6 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q16620	Self	EBI-5650732	0.49
Q99523	Sortilin	EBI-9828457	0.44
Q03001	Dystonin	EBI-32724423	0.27
P00533	Epidermal growth factor receptor	EBI-9689644	0.55
Q96RT1	Erbin	EBI-32724423	0.27
Q9UM54	Unconventional myosin-VI	EBI-32724423	0.27
Interactions with other proteins (100 interactors)

Partner (UniProt)		IntAct	Confidence score
Q10567	AP-1 complex subunit beta-1 (Adaptor protein complex AP-1 subunit beta-1) (Adaptor-related protein complex 1 subunit beta-1) (Beta-1-adaptin) (Beta-adaptin 1) (Clathrin assembly protein complex 1 beta large chain) (Golgi adaptor HA1/AP1 adaptin beta subunit)	EBI-3904879	0.37
P62487	DNA-directed RNA polymerase II subunit RPB7 (RNA polymerase II subunit B7) (DNA-directed RNA polymerase II subunit G) (RNA polymerase II 19 kDa subunit) (RPB19)	EBI-3911957	0.37
Q9HAN9	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 (NMN/NaMN adenylyltransferase 1) (EC 2.7.7.1) (EC 2.7.7.18) (Nicotinamide-nucleotide adenylyltransferase 1) (NMN adenylyltransferase 1) (Nicotinate-nucleotide adenylyltransferase 1) (NaMN adenylyltransferase 1)	EBI-3919655	0.37
P08238	Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84)	EBI-6424683	0.40
P34130	Neurotrophin-4 (NT-4) (Neurotrophin-5) (NT-5) (Neutrophic factor 4)	EBI-6590946	0.41
P14618	Pyruvate kinase PKM (EC 2.7.1.40) (Cytosolic thyroid hormone-binding protein) (CTHBP) (Opa-interacting protein 3) (OIP-3) (Pyruvate kinase 2/3) (Pyruvate kinase muscle isozyme) (Threonine-protein kinase PKM2) (EC 2.7.11.1) (Thyroid hormone-binding protein 1) (THBP1) (Tumor M2-PK) (Tyrosine-protein kinase PKM2) (EC 2.7.10.2) (p58)	EBI-9354703	0.44
Q03114	Cyclin-dependent kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Cyclin-dependent-like kinase 5) (Serine/threonine-protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit)	EBI-15624658	0.56
P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	EBI-15750128	0.40
P78352	Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90)	EBI-16037188	0.40
Q96QK1	Vacuolar protein sorting-associated protein 35 (hVPS35) (Maternal-embryonic 3) (Vesicle protein sorting 35)	EBI-27081124	0.35
P19174	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 (EC 3.1.4.11) (PLC-148) (Phosphoinositide phospholipase C-gamma-1) (Phospholipase C-II) (PLC-II) (Phospholipase C-gamma-1) (PLC-gamma-1)	EBI-32719199	0.42
Q16543	Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed]	EBI-32719199	0.42
P08754	Guanine nucleotide-binding protein G(i) subunit alpha-3 (G(i) alpha-3)	EBI-32719199	0.35
Q8WU20	Fibroblast growth factor receptor substrate 2 (FGFR substrate 2) (FGFR-signaling adaptor SNT) (Suc1-associated neurotrophic factor target 1) (SNT-1)	EBI-32719199	0.42
P62158	Calmodulin-1	EBI-32719199	0.35
Q16288	NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)	EBI-32719212	0.54
Q3V6T2	Girdin (Akt phosphorylation enhancer) (APE) (Coiled-coil domain-containing protein 88A) (G alpha-interacting vesicle-associated protein) (GIV) (Girders of actin filament) (Hook-related protein 1) (HkRP1)	EBI-32724423	0.27
Q9UPS8	Ankyrin repeat domain-containing protein 26	EBI-32724423	0.27
Q9H3R5	Centromere protein H (CENP-H) (Interphase centromere complex protein 35)	EBI-32724423	0.27
Q86YF9	Cilium assembly protein DZIP1 (DAZ-interacting protein 1/2) (DAZ-interacting zinc finger protein 1)	EBI-32724423	0.27
Q92738	USP6 N-terminal-like protein (Related to the N-terminus of tre) (RN-tre)	EBI-32724423	0.27
Q8IYB1	Nucleotidyltransferase MB21D2 (EC 2.7.7.-) (Mab-21 domain-containing protein 2) (hMB21D2)	EBI-32724423	0.27
Q16625	Occludin	EBI-32724423	0.27
P50851	Lipopolysaccharide-responsive and beige-like anchor protein (Beige-like protein) (CDC4-like protein)	EBI-32724423	0.27
Q12923	Tyrosine-protein phosphatase non-receptor type 13 (EC 3.1.3.48) (Fas-associated protein-tyrosine phosphatase 1) (FAP-1) (PTP-BAS) (Protein-tyrosine phosphatase 1E) (PTP-E1) (hPTPE1) (Protein-tyrosine phosphatase PTPL1)	EBI-32724423	0.27
Q9H3P7	Golgi resident protein GCP60 (Acyl-CoA-binding domain-containing protein 3) (Golgi complex-associated protein 1) (GOCAP1) (Golgi phosphoprotein 1) (GOLPH1) (PBR- and PKA-associated protein 7) (Peripheral benzodiazepine receptor-associated protein PAP7) [Cleaved into: Golgi resident protein GCP60, N-terminally processed]	EBI-32724423	0.27
Q5VUB5	Protein FAM171A1 (Astroprincin) (APCN)	EBI-32724423	0.27
Q6WCQ1	Myosin phosphatase Rho-interacting protein (M-RIP) (Rho-interacting protein 3) (RIP3) (p116Rip)	EBI-32724423	0.27
Q15334	Lethal(2) giant larvae protein homolog 1 (LLGL) (DLG4) (Hugl-1) (Human homolog to the D-lgl gene protein)	EBI-32724423	0.27
Q8TEW0	Partitioning defective 3 homolog (PAR-3) (PARD-3) (Atypical PKC isotype-specific-interacting protein) (ASIP) (CTCL tumor antigen se2-5) (PAR3-alpha)	EBI-32724423	0.27
A8MVW0	Protein FAM171A2	EBI-32724423	0.27
P27448	MAP/microtubule affinity-regulating kinase 3 (EC 2.7.11.1) (C-TAK1) (cTAK1) (Cdc25C-associated protein kinase 1) (ELKL motif kinase 2) (EMK-2) (Protein kinase STK10) (Ser/Thr protein kinase PAR-1) (Par-1a) (Serine/threonine-protein kinase p78)	EBI-32724423	0.27
Q9NNW5	WD repeat-containing protein 6	EBI-32724423	0.27
O00459	Phosphatidylinositol 3-kinase regulatory subunit beta (PI3-kinase regulatory subunit beta) (PI3K regulatory subunit beta) (PtdIns-3-kinase regulatory subunit beta) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta) (PI3-kinase subunit p85-beta) (PtdIns-3-kinase regulatory subunit p85-beta)	EBI-32724423	0.27
O95487	Protein transport protein Sec24B (SEC24-related protein B)	EBI-32724423	0.27
Q9ULH0	Kinase D-interacting substrate of 220 kDa (Ankyrin repeat-rich membrane-spanning protein)	EBI-32724423	0.27
Q13480	GRB2-associated-binding protein 1 (GRB2-associated binder 1) (Growth factor receptor bound protein 2-associated protein 1)	EBI-32724423	0.27
Q9Y6M7	Sodium bicarbonate cotransporter 3 (Electroneutral Na/HCO(3) cotransporter) (Sodium bicarbonate cotransporter 2) (Sodium bicarbonate cotransporter 2b) (Bicarbonate transporter) (Solute carrier family 4 member 7)	EBI-32724423	0.27
Q9H792	Inactive tyrosine-protein kinase PEAK1 (Pseudopodium-enriched atypical kinase 1) (Sugen kinase 269) (Tyrosine-protein kinase SgK269)	EBI-32724423	0.27
Q9H2D6	TRIO and F-actin-binding protein (Protein Tara) (Trio-associated repeat on actin)	EBI-32724423	0.27
Q99618	Cell division cycle-associated protein 3 (Gene-rich cluster protein C8) (Trigger of mitotic entry protein 1) (TOME-1)	EBI-32724423	0.27
P29317	Ephrin type-A receptor 2 (EC 2.7.10.1) (Epithelial cell kinase) (Tyrosine-protein kinase receptor ECK)	EBI-32724423	0.27
Q86X29	Lipolysis-stimulated lipoprotein receptor (Angulin-1)	EBI-32724423	0.27
P20020	Plasma membrane calcium-transporting ATPase 1 (EC 7.2.2.10) (Plasma membrane calcium ATPase isoform 1) (PMCA1) (Plasma membrane calcium pump isoform 1)	EBI-32724423	0.27
A7KAX9	Rho GTPase-activating protein 32 (Brain-specific Rho GTPase-activating protein) (GAB-associated Cdc42/Rac GTPase-activating protein) (GC-GAP) (GTPase regulator interacting with TrkA) (Rho-type GTPase-activating protein 32) (Rho/Cdc42/Rac GTPase-activating protein RICS) (RhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling) (p200RhoGAP) (p250GAP)	EBI-32724423	0.27
Q9Y2I1	Nischarin (Imidazoline receptor 1) (I-1) (IR1) (Imidazoline receptor antisera-selected protein) (hIRAS) (Imidazoline-1 receptor) (I1R) (Imidazoline-1 receptor candidate protein) (I-1 receptor candidate protein) (I1R candidate protein)	EBI-32724423	0.27
Q15643	Thyroid receptor-interacting protein 11 (TR-interacting protein 11) (TRIP-11) (Clonal evolution-related gene on chromosome 14 protein) (Golgi-associated microtubule-binding protein 210) (GMAP-210) (Trip230)	EBI-32724423	0.27
Q04721	Neurogenic locus notch homolog protein 2 (Notch 2) (hN2) [Cleaved into: Notch 2 extracellular truncation (N2ECD); Notch 2 intracellular domain (N2ICD)]	EBI-32724423	0.27
O14964	Hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) (Protein pp110)	EBI-32724423	0.27
Q86W92	Liprin-beta-1 (Protein tyrosine phosphatase receptor type f polypeptide-interacting protein-binding protein 1) (PTPRF-interacting protein-binding protein 1) (hSGT2)	EBI-32724423	0.27
P16333	Cytoplasmic protein NCK1 (NCK adaptor protein 1) (Nck-1) (SH2/SH3 adaptor protein NCK-alpha)	EBI-32724423	0.27
Q8TDM6	Disks large homolog 5 (Discs large protein P-dlg) (Placenta and prostate DLG)	EBI-32724423	0.27
Q15437	Protein transport protein Sec23B (hSec23B) (SEC23-related protein B)	EBI-32724423	0.27
Q8TAA9	Vang-like protein 1 (Loop-tail protein 2 homolog) (LPP2) (Strabismus 2) (Van Gogh-like protein 1)	EBI-32724423	0.27
Q9HCM4	Band 4.1-like protein 5 (Erythrocyte membrane protein band 4.1-like 5)	EBI-32724423	0.27
P27986	Phosphatidylinositol 3-kinase regulatory subunit alpha (PI3-kinase regulatory subunit alpha) (PI3K regulatory subunit alpha) (PtdIns-3-kinase regulatory subunit alpha) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha) (PI3-kinase subunit p85-alpha) (PtdIns-3-kinase regulatory subunit p85-alpha)	EBI-32724423	0.27
Q9C0B5	Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375)	EBI-32724423	0.27
Q9HD26	Golgi-associated PDZ and coiled-coil motif-containing protein (CFTR-associated ligand) (Fused in glioblastoma) (PDZ protein interacting specifically with TC10) (PIST)	EBI-32724423	0.27
Q6ZVF9	G protein-regulated inducer of neurite outgrowth 3 (GRIN3)	EBI-32724423	0.27
Q9H2J7	Sodium-dependent neutral amino acid transporter B(0)AT2 (Sodium- and chloride-dependent neurotransmitter transporter NTT73) (Sodium-coupled branched-chain amino-acid transporter 1) (Solute carrier family 6 member 15) (Transporter v7-3)	EBI-32724423	0.27
Q02487	Desmocollin-2 (Cadherin family member 2) (Desmocollin-3) (Desmosomal glycoprotein II) (Desmosomal glycoprotein III)	EBI-32724423	0.27
Q14254	Flotillin-2 (Epidermal surface antigen) (ESA) (Membrane component chromosome 17 surface marker 1)	EBI-32724423	0.27
P62993	Growth factor receptor-bound protein 2 (Adapter protein GRB2) (Protein Ash) (SH2/SH3 adapter GRB2)	EBI-32724423	0.27
O95490	Adhesion G protein-coupled receptor L2 (Calcium-independent alpha-latrotoxin receptor 2) (CIRL-2) (Latrophilin homolog 1) (Latrophilin-2) (Lectomedin-1)	EBI-32724423	0.27
P41743	Protein kinase C iota type (EC 2.7.11.13) (Atypical protein kinase C-lambda/iota) (PRKC-lambda/iota) (aPKC-lambda/iota) (nPKC-iota)	EBI-32724423	0.27
Q658P3	Metalloreductase STEAP3 (EC 1.16.1.-) (Dudulin-2) (Six-transmembrane epithelial antigen of prostate 3) (Tumor suppressor-activated pathway protein 6) (hTSAP6) (pHyde) (hpHyde)	EBI-32724423	0.27
O75052	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (C-terminal PDZ ligand of neuronal nitric oxide synthase protein) (Nitric oxide synthase 1 adaptor protein)	EBI-32724423	0.27
Q9HDC5	Junctophilin-1 (JP-1) (Junctophilin type 1)	EBI-32724423	0.27
Q9P2D6	Protein FAM135A	EBI-32724423	0.27
Q9UKG1	DCC-interacting protein 13-alpha (Dip13-alpha) (Adapter protein containing PH domain, PTB domain and leucine zipper motif 1)	EBI-32724423	0.27
Q6P995	Protein FAM171B	EBI-32724423	0.27
Q9UBH6	Xenotropic and polytropic retrovirus receptor 1 (Protein SYG1 homolog) (Xenotropic and polytropic murine leukemia virus receptor X3) (X-receptor)	EBI-32724423	0.27
Q13136	Liprin-alpha-1 (LAR-interacting protein 1) (LIP-1) (Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1) (PTPRF-interacting protein alpha-1)	EBI-32724423	0.27
Q9BXF6	Rab11 family-interacting protein 5 (Rab11-FIP5) (Gamma-SNAP-associated factor 1) (Gaf-1) (Phosphoprotein pp75) (Rab11-interacting protein Rip11)	EBI-32724423	0.27
Q9UET6	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase (EC 2.1.1.205) (2'-O-ribose RNA methyltransferase TRM7 homolog) (Protein ftsJ homolog 1)	EBI-32724423	0.27
Q9UNF0	Protein kinase C and casein kinase substrate in neurons protein 2 (Syndapin-2) (Syndapin-II) (SdpII)	EBI-32724423	0.27
O75886	Signal transducing adapter molecule 2 (STAM-2) (Hrs-binding protein)	EBI-32724423	0.27
Q9Y5Z9	UbiA prenyltransferase domain-containing protein 1 (EC 2.5.1.-) (Transitional epithelial response protein 1)	EBI-32724423	0.27
Q6NSJ2	Pleckstrin homology-like domain family B member 3	EBI-32724423	0.27
O95292	Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)	EBI-32724423	0.27
O15013	Rho guanine nucleotide exchange factor 10	EBI-32724423	0.27
Q92569	Phosphatidylinositol 3-kinase regulatory subunit gamma (PI3-kinase regulatory subunit gamma) (PI3K regulatory subunit gamma) (PtdIns-3-kinase regulatory subunit gamma) (Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma) (PI3-kinase subunit p55-gamma) (PtdIns-3-kinase regulatory subunit p55-gamma) (p55PIK)	EBI-32724423	0.27
Q9Y4J8	Dystrobrevin alpha (DTN-A) (Alpha-dystrobrevin) (Dystrophin-related protein 3)	EBI-32724423	0.27
Q99959	Plakophilin-2	EBI-32724423	0.27
Q9H8Y8	Golgi reassembly-stacking protein 2 (GRS2) (Golgi phosphoprotein 6) (GOLPH6) (Golgi reassembly-stacking protein of 55 kDa) (GRASP55) (p59)	EBI-32724423	0.27
P42338	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform (PI3-kinase subunit beta) (PI3K-beta) (PI3Kbeta) (PtdIns-3-kinase subunit beta) (EC 2.7.1.153) (Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta) (PtdIns-3-kinase subunit p110-beta) (p110beta) (Serine/threonine protein kinase PIK3CB) (EC 2.7.11.1)	EBI-32724423	0.27
O14639	Actin-binding LIM protein 1 (abLIM-1) (Actin-binding LIM protein family member 1) (Actin-binding double zinc finger protein) (LIMAB1) (Limatin)	EBI-32724423	0.27
Q8N4C8	Misshapen-like kinase 1 (EC 2.7.11.1) (GCK family kinase MiNK) (MAPK/ERK kinase kinase kinase 6) (MEK kinase kinase 6) (MEKKK 6) (Misshapen/NIK-related kinase) (Mitogen-activated protein kinase kinase kinase kinase 6)	EBI-32724423	0.27
Q8N350	Voltage-dependent calcium channel beta subunit-associated regulatory protein	EBI-32724423	0.27
Q4KWH8	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-eta-1) (Phospholipase C-eta-1) (PLC-eta-1) (Phospholipase C-like protein 3) (PLC-L3)	EBI-32724423	0.27
Q9C004	Protein sprouty homolog 4 (Spry-4)	EBI-32724423	0.27
Q9H0W5	Coiled-coil domain-containing protein 8	EBI-32724423	0.27
Q9H939	Proline-serine-threonine phosphatase-interacting protein 2 (PEST phosphatase-interacting protein 2)	EBI-32724423	0.27
Q8NE01	Metal transporter CNNM3 (Ancient conserved domain-containing protein 3) (Cyclin-M3)	EBI-32724423	0.27
Q08357	Sodium-dependent phosphate transporter 2 (Gibbon ape leukemia virus receptor 2) (GLVR-2) (Phosphate transporter 2) (PiT-2) (Pit2) (hPit2) (Solute carrier family 20 member 2)	EBI-32724423	0.27
P62873	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 (Transducin beta chain 1)	EBI-32724423	0.27
Q6P996	Pyridoxal-dependent decarboxylase domain-containing protein 1 (EC 4.1.1.-)	EBI-32724423	0.27
O95405	Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation)	EBI-32724423	0.27
O00170	AH receptor-interacting protein (AIP) (Aryl-hydrocarbon receptor-interacting protein) (HBV X-associated protein 2) (XAP-2) (Immunophilin homolog ARA9)	EBI-32724423	0.27
Q06124	Tyrosine-protein phosphatase non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1D) (PTP-1D) (Protein-tyrosine phosphatase 2C) (PTP-2C) (SH-PTP2) (SHP-2) (Shp2) (SH-PTP3)	EBI-32724423	0.27

Cross-References

Database	Links
UNIPROT	Q16620 B1ANZ4 B4DFV9 Q16675 Q59GJ1 Q8WXJ5 Q8WXJ6 Q8WXJ7
PDB	1HCF 1WWB 2MFQ 4ASZ 4AT3 4AT4 4AT5 5MO9
Pfam	PF07679 PF13855 PF16920 PF01462 PF07714
PROSITE	PS50835 PS00107 PS50011 PS00109 PS00239
OMIM	600456 613886 617830
DisGeNET	4915

BDNF/NT-3 growth factors receptor (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 4AT4)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (6 interactors)

Interactions with other proteins (100 interactors)

Cross-References

Database

Links

Description

Description