Protein Information |
|
|---|---|
| Protein Name | Serine/threonine-protein kinase N3 |
| Accession Code | Q6P5Z2 |
| Gene | PKN3 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 889) | |
|
MEEGAPRQPGPSQWPPEDEKEVIRRAIQKELKIKEGVENLRRVATDRRHLGHVQQLLRSSNRRLEQLHGELRELHARILLPGPGPGPAEPVASGPRPWAEQLRARHLEALRRQLHVELKVKQGAENMTHT CASGTPKERKLLAAAQQMLRDSQLKVALLRMKISSLEASGSPEPGPELLAEELQHRLHVEAAVAEGAKNVVKLLSSRRTQDRKALAEAQAQLQESSQKLDLLRLALEQLLEQLPPAHPLRSRVTRELRAA VPGYPQPSGTPVKPTALTGTLQVRLLGCEQLLTAVPGRSPAAALASSPSEGWLRTKAKHQRGRGELASEVLAVLKVDNRVVGQTGWGQVAEQSWDQTFVIPLERARELEIGVHWRDWRQLCGVAFLRLED FLDNACHQLSLSLVPQGLLFAQVTFCDPVIERRPRLQRQERIFSKRRGQDFLRASQMNLGMAAWGRLVMNLLPPCSSPSTISPPKGCPRTPTTLREASDPATPSNFLPKKTPLGEEMTPPPKPPRLYLPQ EPTSEETPRTKRPHMEPRTRRGPSPPASPTRKPPRLQDFRCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDEIESLYCEKRILEAVGCTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMMQ IHEDVFPEPQARFYVACVVLGLQFLHEKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFCGTPEFLAPEVLTQEAYTRAVDWWGLGVLLYEMLVGECPFPGDTEEEVFDCIVNMDAPYPG FLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLARTIQPPFVPTLCGPADLRYFEGEFTGLPPALTPPAPHSLLTARQQAAFRDFDFVSERFLEP |
|
Description |
||
|---|---|---|
| Nucleus {Experimental EvidencePubMed:10441506}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:10441506}. Note=Nuclear and perinuclear Golgi region. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytosol (GO:0005829) Golgi Apparatus (GO:0005794) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) |
|
Description |
|
|---|---|
| Contributes to invasiveness in malignant prostate cancer. {Experimental EvidencePubMed:15282551}. | Assigned Ontology terms |
| Biological Process | Epithelial Cell Migration (GO:0010631) Intracellular Signal Transduction (GO:0035556) Peptidyl-Serine Phosphorylation (GO:0018105) Protein Phosphorylation (GO:0006468) Signal Transduction (GO:0007165) |
| Molecular Function | ATP Binding (GO:0005524) Calcium-Dependent Protein Kinase C Activity (GO:0004698) Protein Kinase Activity (GO:0004672) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674) Small GTPase Binding (GO:0031267) |
Interactions with Nuclear Envelope proteins (9 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| A1A4S6 | Rho GTPase-activating protein 10 | EBI-1390955 | 0.68 |
| O15027 | Protein transport protein Sec16A | EBI-28941754 | 0.35 |
| Q13393 | Phospholipase D1 | EBI-7796971 | 0.54 |
| Q15569 | Dual specificity testis-specific protein kinase 1 | EBI-28941754 | 0.35 |
| O96018 | Amyloid-beta A4 precursor protein-binding family A member 3 | EBI-21604776 | 0.35 |
| Q9D8B3 | Charged multivesicular body protein 4b | EBI-11052854 | 0.35 |
| P50402 | Emerin | EBI-28941754 | 0.35 |
| O00165 | HCLS1-associated protein X-1 | EBI-28941754 | 0.35 |
| Q9Y3A3 | MOB-like protein phocein | EBI-11918474 | 0.00 | Interactions with other proteins (138 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q22038 | Ras-like GTP-binding protein rhoA | EBI-8669452 | 0.54 |
| Q9UNA1 | Rho GTPase-activating protein 26 (GTPase regulator associated with focal adhesion kinase) (Oligophrenin-1-like protein) (Rho-type GTPase-activating protein 26) | EBI-1390909 | 0.68 |
| Q8IVD9 | NudC domain-containing protein 3 | EBI-9395191 | 0.35 |
| P17918 | Proliferating cell nuclear antigen (PCNA) (Cyclin) | EBI-10999136 | 0.35 |
| Q96BD8 | Spindle and kinetochore-associated protein 1 | EBI-11000226 | 0.35 |
| Q9UKF6 | Cleavage and polyadenylation specificity factor subunit 3 (EC 3.1.27.-) (Cleavage and polyadenylation specificity factor 73 kDa subunit) (CPSF 73 kDa subunit) (mRNA 3'-end-processing endonuclease CPSF-73) | EBI-11006031 | 0.35 |
| O95235 | Kinesin-like protein KIF20A (GG10_2) (Mitotic kinesin-like protein 2) (MKlp2) (Rab6-interacting kinesin-like protein) (Rabkinesin-6) | EBI-11007956 | 0.35 |
| Q8VC57 | BTB/POZ domain-containing protein KCTD5 | EBI-11009211 | 0.35 |
| Q62376 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | EBI-11015551 | 0.35 |
| Q8BQ46 | TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor (TATA-box-binding protein-associated factor 15) | EBI-11018041 | 0.35 |
| Q96L14 | Cep170-like protein (CEP170 pseudogene 1) | EBI-11022408 | 0.35 |
| P19788 | Matrix Gla protein (MGP) | EBI-11032999 | 0.35 |
| Q9EQU5 | Protein SET (Phosphatase 2A inhibitor I2PP2A) (I-2PP2A) (Template-activating factor I) (TAF-I) | EBI-11047846 | 0.35 |
| P62714 | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PP2A-beta) (EC 3.1.3.16) | EBI-11056306 | 0.35 |
| P67775 | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (PP2A-alpha) (EC 3.1.3.16) (Replication protein C) (RP-C) | EBI-11058007 | 0.35 |
| P58771 | Tropomyosin alpha-1 chain (Alpha-tropomyosin) (Tropomyosin-1) | EBI-11063826 | 0.35 |
| Q9Z2X1 | Heterogeneous nuclear ribonucleoprotein F (hnRNP F) [Cleaved into: Heterogeneous nuclear ribonucleoprotein F, N-terminally processed] | EBI-11066678 | 0.35 |
| D3Z482 | Ankyrin repeat domain-containing protein 26 | EBI-11073201 | 0.35 |
| Q13033 | Striatin-3 (Cell cycle autoantigen SG2NA) (S/G2 antigen) | EBI-11077798 | 0.35 |
| P23258 | Tubulin gamma-1 chain (Gamma-1-tubulin) (Gamma-tubulin complex component 1) (GCP-1) | EBI-11085623 | 0.35 |
| Q00839 | Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (GRIP120) (Nuclear p120 ribonucleoprotein) (Scaffold-attachment factor A) (SAF-A) (p120) (pp120) | EBI-11088773 | 0.35 |
| Q91YI4 | Beta-arrestin-2 (Arrestin beta-2) | EBI-11102575 | 0.35 |
| Q9UBN7 | Histone deacetylase 6 (HD6) (EC 3.5.1.98) (Tubulin-lysine deacetylase HDAC6) (EC 3.5.1.-) | EBI-11116627 | 0.35 |
| P55795 | Heterogeneous nuclear ribonucleoprotein H2 (hnRNP H2) (FTP-3) (Heterogeneous nuclear ribonucleoprotein H') (hnRNP H') [Cleaved into: Heterogeneous nuclear ribonucleoprotein H2, N-terminally processed] | EBI-11129092 | 0.35 |
| Q9P2B7 | Cilia- and flagella-associated protein 97 | EBI-11131339 | 0.35 |
| Q14134 | Tripartite motif-containing protein 29 (Ataxia telangiectasia group D-associated protein) | EBI-11137164 | 0.35 |
| Q9BQE3 | Tubulin alpha-1C chain (EC 3.6.5.-) (Alpha-tubulin 6) (Tubulin alpha-6 chain) [Cleaved into: Detyrosinated tubulin alpha-1C chain] | EBI-11139064 | 0.35 |
| P62937 | Peptidyl-prolyl cis-trans isomerase A (PPIase A) (EC 5.2.1.8) (Cyclophilin A) (Cyclosporin A-binding protein) (Rotamase A) [Cleaved into: Peptidyl-prolyl cis-trans isomerase A, N-terminally processed] | EBI-11141455 | 0.35 |
| Q14103 | Heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) (AU-rich element RNA-binding protein 1) | EBI-11152836 | 0.35 |
| Q13352 | Centromere protein R (CENP-R) (Beta-3-endonexin) (Integrin beta-3-binding protein) (Nuclear receptor-interacting factor 3) | EBI-11156428 | 0.35 |
| Q71U36 | Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain] | EBI-11897791 | 0.35 |
| Q5JR59 | Microtubule-associated tumor suppressor candidate 2 (Cardiac zipper protein) (Microtubule plus-end tracking protein TIP150) (Tracking protein of 150 kDa) | EBI-24358565 | 0.56 |
| Q9UBB9 | Tuftelin-interacting protein 11 (Septin and tuftelin-interacting protein 1) (STIP-1) | EBI-25244295 | 0.56 |
| Q8N1B4 | Vacuolar protein sorting-associated protein 52 homolog (SAC2 suppressor of actin mutations 2-like protein) | EBI-25245406 | 0.56 |
| Q08379 | Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95) | EBI-25247991 | 0.56 |
| Q15323 | Keratin, type I cuticular Ha1 (Hair keratin, type I Ha1) (Keratin-31) (K31) | EBI-24477843 | 0.56 |
| Q8ND90 | Paraneoplastic antigen Ma1 (37 kDa neuronal protein) (Neuron- and testis-specific protein 1) | EBI-24507203 | 0.56 |
| O95619 | YEATS domain-containing protein 4 (Glioma-amplified sequence 41) (Gas41) (NuMA-binding protein 1) (NuBI-1) (NuBI1) | EBI-11918232 | 0.00 |
| Q6NZI2 | Caveolae-associated protein 1 (Cavin-1) (Polymerase I and transcript release factor) | EBI-11917959 | 0.00 |
| O43482 | Protein Mis18-beta (Cancer/testis antigen 86) (CT86) (Opa-interacting protein 5) (OIP-5) | EBI-11918214 | 0.00 |
| O15516 | Circadian locomoter output cycles protein kaput (hCLOCK) (EC 2.3.1.48) (Class E basic helix-loop-helix protein 8) (bHLHe8) | EBI-11918205 | 0.00 |
| O00327 | Aryl hydrocarbon receptor nuclear translocator-like protein 1 (Basic-helix-loop-helix-PAS protein MOP3) (Brain and muscle ARNT-like 1) (Class E basic helix-loop-helix protein 5) (bHLHe5) (Member of PAS protein 3) (PAS domain-containing protein 3) (bHLH-PAS protein JAP3) | EBI-11918196 | 0.00 |
| O00233 | 26S proteasome non-ATPase regulatory subunit 9 (26S proteasome regulatory subunit p27) | EBI-11918187 | 0.00 |
| Q5R372 | Rab GTPase-activating protein 1-like | EBI-11918178 | 0.00 |
| O43815 | Striatin | EBI-11918223 | 0.00 |
| Q8TBA6 | Golgin subfamily A member 5 (Cell proliferation-inducing gene 31 protein) (Golgin-84) (Protein Ret-II) (RET-fused gene 5 protein) | EBI-11918349 | 0.00 |
| Q8TD31 | Coiled-coil alpha-helical rod protein 1 (Alpha-helical coiled-coil rod protein) (Putative gene 8 protein) (Pg8) | EBI-11918358 | 0.00 |
| Q7Z4H7 | HAUS augmin-like complex subunit 6 | EBI-11918331 | 0.00 |
| Q6NSJ2 | Pleckstrin homology-like domain family B member 3 | EBI-11918322 | 0.00 |
| Q5VIR6 | Vacuolar protein sorting-associated protein 53 homolog | EBI-11918313 | 0.00 |
| Q5T0U0 | Coiled-coil domain-containing protein 122 | EBI-11918304 | 0.00 |
| Q567U6 | Coiled-coil domain-containing protein 93 | EBI-11918295 | 0.00 |
| Q53HC9 | EARP and GARP complex-interacting protein 1 (Endosome-associated recycling protein-interacting protein) (Golgi-associated retrograde protein-interacting protein) (Tumor-suppressing STF cDNA 1 protein) (Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein) | EBI-11918286 | 0.00 |
| Q4V328 | GRIP1-associated protein 1 (GRASP-1) [Cleaved into: GRASP-1 C-terminal chain (30kDa C-terminus form)] | EBI-11918277 | 0.00 |
| Q15276 | Rab GTPase-binding effector protein 1 (Rabaptin-4) (Rabaptin-5) (Rabaptin-5alpha) (Renal carcinoma antigen NY-REN-17) | EBI-11918268 | 0.00 |
| Q14161 | ARF GTPase-activating protein GIT2 (ARF GAP GIT2) (Cool-interacting tyrosine-phosphorylated protein 2) (CAT-2) (CAT2) (G protein-coupled receptor kinase-interactor 2) (GRK-interacting protein 2) | EBI-11918259 | 0.00 |
| P61244 | Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) | EBI-11918250 | 0.00 |
| P0C1Z6 | TCF3 fusion partner (INO80 complex subunit F) (Protein FB1) | EBI-11918241 | 0.00 |
| Q9BZD4 | Kinetochore protein Nuf2 (hNuf2) (hNuf2R) (hsNuf2) (Cell division cycle-associated protein 1) | EBI-11918402 | 0.00 |
| Q96P16 | Regulation of nuclear pre-mRNA domain-containing protein 1A (Cyclin-dependent kinase inhibitor 2B-related protein) (p15INK4B-related protein) | EBI-11918393 | 0.00 |
| Q96JG6 | Syndetin (Coiled-coil domain-containing protein 132) (EARP/GARPII complex subunit VPS50) | EBI-11918385 | 0.00 |
| Q96EK4 | THAP domain-containing protein 11 | EBI-11918376 | 0.00 |
| Q96BD5 | PHD finger protein 21A (BHC80a) (BRAF35-HDAC complex protein BHC80) | EBI-11918367 | 0.00 |
| Q86Y13 | E3 ubiquitin-protein ligase DZIP3 (EC 2.3.2.27) (DAZ-interacting protein 3) (RING-type E3 ubiquitin transferase DZIP3) (RNA-binding ubiquitin ligase of 138 kDa) (hRUL138) | EBI-11918340 | 0.00 |
| Q9Y2X7 | ARF GTPase-activating protein GIT1 (ARF GAP GIT1) (Cool-associated and tyrosine-phosphorylated protein 1) (CAT-1) (CAT1) (G protein-coupled receptor kinase-interactor 1) (GRK-interacting protein 1) (p95-APP1) | EBI-11918465 | 0.00 |
| Q9UKL0 | REST corepressor 1 (Protein CoREST) | EBI-11918456 | 0.00 |
| Q9UJ41 | Rab5 GDP/GTP exchange factor (RAP1) (Rabaptin-5-associated exchange factor for Rab5) (Rabex-5) | EBI-11918447 | 0.00 |
| Q9UID3 | Vacuolar protein sorting-associated protein 51 homolog (Another new gene 2 protein) (Protein fat-free homolog) | EBI-11918438 | 0.00 |
| Q9NP66 | High mobility group protein 20A (HMG box-containing protein 20A) (HMG domain-containing protein 1) (HMG domain-containing protein HMGX1) | EBI-11918429 | 0.00 |
| Q9NNX1 | Tuftelin | EBI-11918420 | 0.00 |
| Q9HCH0 | Nck-associated protein 5-like (NCKAP5-like) (Centrosomal protein of 169 kDa) (Cep169) | EBI-11918411 | 0.00 |
| Q9H8J5 | MANSC domain-containing protein 1 (Loss of heterozygosity 12 chromosomal region 3 protein) | EBI-21537025 | 0.35 |
| Q15768 | Ephrin-B3 (EPH-related receptor transmembrane ligand ELK-L3) (EPH-related receptor tyrosine kinase ligand 8) (LERK-8) | EBI-21537920 | 0.35 |
| P04201 | Proto-oncogene Mas | EBI-21538834 | 0.35 |
| O60232 | Protein ZNRD2 (Autoantigen p27) (Sjoegren syndrome/scleroderma autoantigen 1) (Zinc ribbon domain-containing protein 2) | EBI-21543889 | 0.35 |
| Q8TDQ0 | Hepatitis A virus cellular receptor 2 (HAVcr-2) (T-cell immunoglobulin and mucin domain-containing protein 3) (TIMD-3) (T-cell immunoglobulin mucin receptor 3) (TIM-3) (T-cell membrane protein 3) (CD antigen CD366) | EBI-21556046 | 0.35 |
| Q9Y279 | V-set and immunoglobulin domain-containing protein 4 (Protein Z39Ig) | EBI-21556596 | 0.35 |
| O15460 | Prolyl 4-hydroxylase subunit alpha-2 (4-PH alpha-2) (EC 1.14.11.2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2) | EBI-21563604 | 0.35 |
| Q96F46 | Interleukin-17 receptor A (IL-17 receptor A) (IL-17RA) (CDw217) (CD antigen CD217) | EBI-21578337 | 0.35 |
| P52799 | Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L) | EBI-21582984 | 0.35 |
| Q9Y5G3 | Protocadherin gamma-B1 (PCDH-gamma-B1) | EBI-21584582 | 0.35 |
| Q86WV1 | Src kinase-associated phosphoprotein 1 (Src family-associated phosphoprotein 1) (Src kinase-associated phosphoprotein of 55 kDa) (SKAP-55) (pp55) | EBI-21601309 | 0.35 |
| P43115 | Prostaglandin E2 receptor EP3 subtype (PGE receptor EP3 subtype) (PGE2 receptor EP3 subtype) (PGE2-R) (Prostanoid EP3 receptor) | EBI-21607127 | 0.35 |
| A8K8V0 | Zinc finger protein 785 | EBI-21612043 | 0.35 |
| P33151 | Cadherin-5 (7B4 antigen) (Vascular endothelial cadherin) (VE-cadherin) (CD antigen CD144) | EBI-21650356 | 0.35 |
| P37173 | TGF-beta receptor type-2 (TGFR-2) (EC 2.7.11.30) (TGF-beta type II receptor) (Transforming growth factor-beta receptor type II) (TGF-beta receptor type II) (TbetaR-II) | EBI-21668347 | 0.35 |
| Q8N831 | Testis-specific Y-encoded-like protein 6 (TSPY-like protein 6) | EBI-21684562 | 0.35 |
| Q6ZN54 | Differentially expressed in FDCP 8 homolog (DEF-8) | EBI-21689078 | 0.35 |
| P61586 | Transforming protein RhoA (EC 3.6.5.2) (Rho cDNA clone 12) (h12) | EBI-21721324 | 0.35 |
| P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | EBI-20749487 | 0.35 |
| Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C (PP6-ARS-C) (Serine/threonine-protein phosphatase 6 regulatory subunit ARS-C) (Ankyrin repeat domain-containing protein 52) | EBI-28941754 | 0.35 |
| Q9Y4W2 | Ribosomal biogenesis protein LAS1L (Protein LAS1 homolog) | EBI-28941754 | 0.35 |
| Q9Y4I1 | Unconventional myosin-Va (Dilute myosin heavy chain, non-muscle) (Myosin heavy chain 12) (Myosin-12) (Myoxin) | EBI-28941754 | 0.35 |
| Q9UNE7 | E3 ubiquitin-protein ligase CHIP (EC 2.3.2.27) (Antigen NY-CO-7) (CLL-associated antigen KW-8) (Carboxy terminus of Hsp70-interacting protein) (RING-type E3 ubiquitin transferase CHIP) (STIP1 homology and U box-containing protein 1) | EBI-28941754 | 0.35 |
| Q9ULX6 | A-kinase anchor protein 8-like (AKAP8-like protein) (Helicase A-binding protein 95) (HAP95) (Homologous to AKAP95 protein) (HA95) (Neighbor of A-kinase-anchoring protein 95) (Neighbor of AKAP95) | EBI-28941754 | 0.35 |
| Q9UJP4 | Kelch-like protein 21 | EBI-28941754 | 0.35 |
| Q9NWS0 | PIH1 domain-containing protein 1 (Nucleolar protein 17 homolog) | EBI-28941754 | 0.35 |
| Q9NNW5 | WD repeat-containing protein 6 | EBI-28941754 | 0.35 |
| Q9HD67 | Unconventional myosin-X (Unconventional myosin-10) | EBI-28941754 | 0.35 |
| Q9H6T3 | RNA polymerase II-associated protein 3 | EBI-28941754 | 0.35 |
| Q9H4I3 | TraB domain-containing protein (Protein TTG2) | EBI-28941754 | 0.35 |
| Q99733 | Nucleosome assembly protein 1-like 4 (Nucleosome assembly protein 2) (NAP-2) | EBI-28941754 | 0.35 |
| Q96TA2 | ATP-dependent zinc metalloprotease YME1L1 (EC 3.4.24.-) (ATP-dependent metalloprotease FtsH1) (Meg-4) (Presenilin-associated metalloprotease) (PAMP) (YME1-like protein 1) | EBI-28941754 | 0.35 |
| Q96K37 | Solute carrier family 35 member E1 | EBI-28941754 | 0.35 |
| Q96IX5 | ATP synthase membrane subunit K, mitochondrial (ATP synthase membrane subunit DAPIT, mitochondrial) (Diabetes-associated protein in insulin-sensitive tissues) (HCV F-transactivated protein 2) (Up-regulated during skeletal muscle growth protein 5) | EBI-28941754 | 0.35 |
| Q96EY1 | DnaJ homolog subfamily A member 3, mitochondrial (DnaJ protein Tid-1) (hTid-1) (Hepatocellular carcinoma-associated antigen 57) (Tumorous imaginal discs protein Tid56 homolog) | EBI-28941754 | 0.35 |
| Q93008 | Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC 3.4.19.12) (Deubiquitinating enzyme FAF-X) (Fat facets in mammals) (hFAM) (Fat facets protein-related, X-linked) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific protease 9, X chromosome) (Ubiquitin-specific-processing protease FAF-X) | EBI-28941754 | 0.35 |
| Q8NF37 | Lysophosphatidylcholine acyltransferase 1 (LPC acyltransferase 1) (LPCAT-1) (LysoPC acyltransferase 1) (EC 2.3.1.23) (1-acylglycerol-3-phosphate O-acyltransferase) (EC 2.3.1.51) (1-acylglycerophosphocholine O-acyltransferase) (1-alkenylglycerophosphocholine O-acyltransferase) (EC 2.3.1.25) (1-alkylglycerophosphocholine O-acetyltransferase) (EC 2.3.1.67) (Acetyl-CoA:lyso-platelet-activating factor acetyltransferase) (Acetyl-CoA:lyso-PAF acetyltransferase) (Lyso-PAF acetyltransferase) (LysoPAFAT) (Acyltransferase-like 2) (Phosphonoformate immuno-associated protein 3) | EBI-28941754 | 0.35 |
| Q8NEJ9 | Neuroguidin (Centromere accumulated nuclear protein 1) (CANu1) (EIF4E-binding protein) | EBI-28941754 | 0.35 |
| Q86VI3 | Ras GTPase-activating-like protein IQGAP3 | EBI-28941754 | 0.35 |
| Q69YQ0 | Cytospin-A (Renal carcinoma antigen NY-REN-22) (Sperm antigen with calponin homology and coiled-coil domains 1-like) (SPECC1-like protein) | EBI-28941754 | 0.35 |
| Q5XKP0 | MICOS complex subunit MIC13 (Protein P117) | EBI-28941754 | 0.35 |
| Q5T9A4 | ATPase family AAA domain-containing protein 3B (AAA-TOB3) | EBI-28941754 | 0.35 |
| Q16543 | Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed] | EBI-28941754 | 0.35 |
| Q14318 | Peptidyl-prolyl cis-trans isomerase FKBP8 (PPIase FKBP8) (EC 5.2.1.8) (38 kDa FK506-binding protein) (38 kDa FKBP) (FKBP-38) (hFKBP38) (FK506-binding protein 8) (FKBP-8) (FKBPR38) (Rotamase) | EBI-28941754 | 0.35 |
| Q13557 | Calcium/calmodulin-dependent protein kinase type II subunit delta (CaM kinase II subunit delta) (CaMK-II subunit delta) (EC 2.7.11.17) | EBI-28941754 | 0.35 |
| Q13555 | Calcium/calmodulin-dependent protein kinase type II subunit gamma (CaM kinase II subunit gamma) (CaMK-II subunit gamma) (EC 2.7.11.17) | EBI-28941754 | 0.35 |
| Q13554 | Calcium/calmodulin-dependent protein kinase type II subunit beta (CaM kinase II subunit beta) (CaMK-II subunit beta) (EC 2.7.11.17) | EBI-28941754 | 0.35 |
| Q13451 | Peptidyl-prolyl cis-trans isomerase FKBP5 (PPIase FKBP5) (EC 5.2.1.8) (51 kDa FK506-binding protein) (51 kDa FKBP) (FKBP-51) (54 kDa progesterone receptor-associated immunophilin) (Androgen-regulated protein 6) (FF1 antigen) (FK506-binding protein 5) (FKBP-5) (FKBP54) (p54) (HSP90-binding immunophilin) (Rotamase) | EBI-28941754 | 0.35 |
| Q01813 | ATP-dependent 6-phosphofructokinase, platelet type (ATP-PFK) (PFK-P) (EC 2.7.1.11) (6-phosphofructokinase type C) (Phosphofructo-1-kinase isozyme C) (PFK-C) (Phosphohexokinase) | EBI-28941754 | 0.35 |
| Q00587 | Cdc42 effector protein 1 (Binder of Rho GTPases 5) (Serum protein MSE55) | EBI-28941754 | 0.35 |
| P43307 | Translocon-associated protein subunit alpha (TRAP-alpha) (Signal sequence receptor subunit alpha) (SSR-alpha) | EBI-28941754 | 0.35 |
| P42356 | Phosphatidylinositol 4-kinase alpha (PI4-kinase alpha) (PI4K-alpha) (PtdIns-4-kinase alpha) (EC 2.7.1.67) (Phosphatidylinositol 4-Kinase III alpha) | EBI-28941754 | 0.35 |
| P30876 | DNA-directed RNA polymerase II subunit RPB2 (EC 2.7.7.6) (DNA-directed RNA polymerase II 140 kDa polypeptide) (DNA-directed RNA polymerase II subunit B) (RNA polymerase II subunit 2) (RNA polymerase II subunit B2) | EBI-28941754 | 0.35 |
| P30154 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65-beta) (PP2A subunit A isoform R1-beta) | EBI-28941754 | 0.35 |
| P27708 | CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] | EBI-28941754 | 0.35 |
| P09543 | 2',3'-cyclic-nucleotide 3'-phosphodiesterase (CNP) (CNPase) (EC 3.1.4.37) | EBI-28941754 | 0.35 |
| P08238 | Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84) | EBI-28941754 | 0.35 |
| P07900 | Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38) | EBI-28941754 | 0.35 |
| P00367 | Glutamate dehydrogenase 1, mitochondrial (GDH 1) (EC 1.4.1.3) | EBI-28941754 | 0.35 |
| O95071 | E3 ubiquitin-protein ligase UBR5 (EC 2.3.2.26) (E3 ubiquitin-protein ligase, HECT domain-containing 1) (HECT-type E3 ubiquitin transferase UBR5) (Hyperplastic discs protein homolog) (hHYD) (Progestin-induced protein) | EBI-28941754 | 0.35 |
| O94763 | Unconventional prefoldin RPB5 interactor 1 (Protein NNX3) (Protein phosphatase 1 regulatory subunit 19) (RNA polymerase II subunit 5-mediating protein) (RPB5-mediating protein) | EBI-28941754 | 0.35 |
| O43819 | Protein SCO2 homolog, mitochondrial | EBI-28941754 | 0.35 |
| O43251 | RNA binding protein fox-1 homolog 2 (Fox-1 homolog B) (Hexaribonucleotide-binding protein 2) (RNA-binding motif protein 9) (RNA-binding protein 9) (Repressor of tamoxifen transcriptional activity) | EBI-28941754 | 0.35 |
| O14773 | Tripeptidyl-peptidase 1 (TPP-1) (EC 3.4.14.9) (Cell growth-inhibiting gene 1 protein) (Lysosomal pepstatin-insensitive protease) (LPIC) (Tripeptidyl aminopeptidase) (Tripeptidyl-peptidase I) (TPP-I) | EBI-28941754 | 0.35 |
| O14654 | Insulin receptor substrate 4 (IRS-4) (160 kDa phosphotyrosine protein) (py160) (Phosphoprotein of 160 kDa) (pp160) | EBI-28941754 | 0.35 |
| O00459 | Phosphatidylinositol 3-kinase regulatory subunit beta (PI3-kinase regulatory subunit beta) (PI3K regulatory subunit beta) (PtdIns-3-kinase regulatory subunit beta) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta) (PI3-kinase subunit p85-beta) (PtdIns-3-kinase regulatory subunit p85-beta) | EBI-28941754 | 0.35 |
| O00170 | AH receptor-interacting protein (AIP) (Aryl-hydrocarbon receptor-interacting protein) (HBV X-associated protein 2) (XAP-2) (Immunophilin homolog ARA9) | EBI-28941754 | 0.35 |
Database | Links |
| UNIPROT | Q6P5Z2 Q9UM03 |
| Pfam | PF02185 PF00069 PF00433 |
| PROSITE | PS51285 PS00107 PS50011 PS00108 PS51860 |
| OMIM | 610714 |
| DisGeNET | 29941 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory