Exocyst complex component 8 - Homo sapiens

Exocyst complex component 8 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Exocyst complex component 8
Accession Code	Q8IYI6
Gene	EXOC8
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 725)
MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLKRNVYQNYRQFIETAREISYLESEMYQLSHLLTEQKSSLESIPLTLLPAAAAAGAAAASGGEEGVGGAGGR DHLRGQAGFFSTPGGASRDGSGPGEEGKQRTLTTLLEKVEGCRHLLETPGQYLVYNGDLVEYDADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYSLDGLAVVNVKDNPPMKDMFKLLMFPESR IFQAENAKIKREWLEVLEDTKRALSEKRRREQEEAAAPRGPPQVTSKATNPFEDDEEEEPAVPEVEEEKVDLSMEWIQELPEDLDVCIAQRDFEGAVDLLDKLNHYLEDKPSPPPVKELRAKVEERVRQL TEVLVFELSPDRSLRGGPKATRRAVSQLIRLGQCTKACELFLRNRAAAVHTAIRQLRIEGATLLYIHKLCHVFFTSLLETAREFEIDFAGTDSGCYSAFVVWARSAMGMFVDAFSKQVFDSKESLSTAAE CVKVAKEHCQQLGDIGLDLTFIIHALLVKDIQGALHSYKEIIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVSNFEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEI ILVAVQHVDYSLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKPAKQLQDLRNASRLIRVNPESTTSVV

Subcellular Location

Description
Cytoplasm {By SimilarityUniProtKB:O54924}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:O54924}. Cell projection, growth cone {By SimilarityUniProtKB:O54924}. Cell projection {By SimilarityUniProtKB:O54924}. Note=Perinuclear in undifferentiated PC12 cells. Redistributes to growing neurites and growth cones during neuronal differentiation (By similarity). Binds lipids with phosphatidylinositol 3,4,5-trisphosphate groups (By similarity). Localizes at the leading edge of migrating cells (By similarity). {ECO:0000250, By SimilarityUniProtKB:O54924}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cell Leading Edge (GO:0031252) Cytosol (GO:0005829) Exocyst (GO:0000145) Growth Cone (GO:0030426) Late Endosome (GO:0005770) Membrane (GO:0016020) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.
Assigned Ontology terms

Biological Process	Endosome Organization (GO:0007032) Exocytosis (GO:0006887) Extracellular Matrix Disassembly (GO:0022617) Golgi To Plasma Membrane Transport (GO:0006893) Membrane Fission (GO:0090148) Mitotic Cytokinesis (GO:0000281) Protein Localization (GO:0008104) Protein Transport (GO:0015031) Regulation Of Macroautophagy (GO:0016241) Vesicle Docking Involved In Exocytosis (GO:0006904) Vesicle Tethering Involved In Exocytosis (GO:0090522)
Molecular Function	Phosphatidylinositol Binding (GO:0035091) Small GTPase Binding (GO:0031267)

Disease associations

Description
Neurodevelopmental disorder with microcephaly, seizures, and brain atrophy (NEDMISB) [MIM:619076]: An autosomal recessive neurodevelopmental disorder characterized by severe global developmental delay, developmental regression with loss of milestones, severe microcephaly, and brain abnormalities, primarily cerebral atrophy and hypoplasia of the corpus callosum. Affected individuals develop seizures in the first year of life. Death in childhood may occur. {Experimental EvidencePubMed:32103185}. Note=The disease may be caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	615283 619076
DisGeNET	149371

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (6 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P05783	Keratin, type I cytoskeletal 18	EBI-756712	0.37
Q7Z3B4	Nucleoporin p54	EBI-24565174	0.56
P00533	Epidermal growth factor receptor	EBI-10764512	0.40
Q9NV70	Exocyst complex component 1	EBI-12450194	0.51
O60645	Exocyst complex component 3	EBI-21672932	0.51
Q8TAG9	Exocyst complex component 6	EBI-12450124	0.64
Interactions with other proteins (109 interactors)

Partner (UniProt)		IntAct	Confidence score
Q8N6Y0	Harmonin-binding protein USHBP1 (AIE-75-binding protein) (Mutated in colon cancer protein 2) (MCC-2) (Usher syndrome type-1C protein-binding protein 1) (USH1C-binding protein 1)	EBI-760525	0.70
P35900	Keratin, type I cytoskeletal 20 (Cytokeratin-20) (CK-20) (Keratin-20) (K20) (Protein IT)	EBI-753154	0.37
O75478	Transcriptional adapter 2-alpha (Transcriptional adapter 2-like) (ADA2-like protein)	EBI-753181	0.37
P19012	Keratin, type I cytoskeletal 15 (Cytokeratin-15) (CK-15) (Keratin-15) (K15)	EBI-753475	0.37
O14964	Hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) (Protein pp110)	EBI-754885	0.37
Q9UL45	Biogenesis of lysosome-related organelles complex 1 subunit 6 (BLOC-1 subunit 6) (Pallid protein homolog) (Pallidin) (Syntaxin 13-interacting protein)	EBI-756178	0.67
P08727	Keratin, type I cytoskeletal 19 (Cytokeratin-19) (CK-19) (Keratin-19) (K19)	EBI-756208	0.67
Q15154	Pericentriolar material 1 protein (PCM-1) (hPCM-1)	EBI-24482767	0.56
Q15834	Coiled-coil domain-containing protein 85B (Hepatitis delta antigen-interacting protein A) (Delta-interacting protein A)	EBI-758167	0.37
Q8TBN0	Guanine nucleotide exchange factor for Rab-3A (Rab-3A-interacting-like protein 1) (Rab3A-interacting-like protein 1) (Rabin3-like 1)	EBI-2349923	0.49
Q9NS73	MAP3K12-binding inhibitory protein 1 (MAPK upstream kinase-binding inhibitory protein) (MUK-binding inhibitory protein)	EBI-10263400	0.56
Q5JST6	EF-hand domain-containing family member C2	EBI-2349935	0.49
P46736	Lys-63-specific deubiquitinase BRCC36 (EC 3.4.19.-) (BRCA1-A complex subunit BRCC36) (BRCA1/BRCA2-containing complex subunit 3) (BRCA1/BRCA2-containing complex subunit 36) (BRISC complex subunit BRCC36)	EBI-2510058	0.40
Q14457	Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]	EBI-3506822	0.60
Q8CDJ3	Beclin 1-associated autophagy-related key regulator (Barkor) (Autophagy-related protein 14-like protein) (Atg14L)	EBI-3506734	0.40
Q80U62	Run domain Beclin-1-interacting and cysteine-rich domain-containing protein (Rubicon)	EBI-3506709	0.40
Q96A65	Exocyst complex component 4 (Exocyst complex component Sec8)	EBI-3509957	0.73
Q4R379	Ras-related protein Ral-B (EC 3.6.5.2)	EBI-3509942	0.35
A8K0Z3	WASH complex subunit 1 (CXYorf1-like protein on chromosome 9) (Protein FAM39E) (WAS protein family homolog 1)	EBI-9075672	0.55
Q14247	Src substrate cortactin (Amplaxin) (Oncogene EMS1)	EBI-9075593	0.27
Q8VDD8	WASH complex subunit 1 (WAS protein family homolog 1)	EBI-9075562	0.27
Q15323	Keratin, type I cuticular Ha1 (Hair keratin, type I Ha1) (Keratin-31) (K31)	EBI-10263378	0.56
Q8IYX8	Centrosomal protein CEP57L1 (Centrosomal protein 57kDa-like protein 1) (Centrosomal protein of 57 kDa-related protein) (Cep57R) (Cep57-related protein)	EBI-10263388	0.56
Q9UKT9	Zinc finger protein Aiolos (Ikaros family zinc finger protein 3)	EBI-10263412	0.78
P06428	Protein E6	EBI-11738085	0.37
O00471	Exocyst complex component 5 (Exocyst complex component Sec10) (hSec10)	EBI-12450093	0.64
Q9Y2D4	Exocyst complex component 6B (Exocyst complex component Sec15B) (SEC15-like protein 2)	EBI-12450145	0.51
Q9UPT5	Exocyst complex component 7 (Exocyst complex component Exo70)	EBI-12450194	0.51
P11234	Ras-related protein Ral-B (EC 3.6.5.2)	EBI-12451925	0.64
P14373	Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (RING-type E3 ubiquitin transferase TRIM27) (Ret finger protein) (Tripartite motif-containing protein 27)	EBI-24274457	0.56
Q9UBB9	Tuftelin-interacting protein 11 (Septin and tuftelin-interacting protein 1) (STIP-1)	EBI-24277384	0.56
Q9Y250	Leucine zipper putative tumor suppressor 1 (F37/esophageal cancer-related gene-coding leucine-zipper motif) (Fez1)	EBI-24282357	0.56
P20807	Calpain-3 (EC 3.4.22.54) (Calcium-activated neutral proteinase 3) (CANP 3) (Calpain L3) (Calpain p94) (Muscle-specific calcium-activated neutral protease 3) (New calpain 1) (nCL-1)	EBI-24310203	0.56
P29084	Transcription initiation factor IIE subunit beta (TFIIE-beta) (General transcription factor IIE subunit 2)	EBI-24320917	0.56
Q8TD31	Coiled-coil alpha-helical rod protein 1 (Alpha-helical coiled-coil rod protein) (Putative gene 8 protein) (Pg8)	EBI-24326974	0.56
Q9H9H4	Vacuolar protein sorting-associated protein 37B (hVps37B) (ESCRT-I complex subunit VPS37B)	EBI-24338768	0.56
Q08379	Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95)	EBI-24339832	0.56
P15884	Transcription factor 4 (TCF-4) (Class B basic helix-loop-helix protein 19) (bHLHb19) (Immunoglobulin transcription factor 2) (ITF-2) (SL3-3 enhancer factor 2) (SEF-2)	EBI-24339961	0.56
Q15742	NGFI-A-binding protein 2 (EGR-1-binding protein 2) (Melanoma-associated delayed early response protein) (Protein MADER)	EBI-24480518	0.56
Q9H2G9	Golgin-45 (Basic leucine zipper nuclear factor 1) (JEM-1) (p45 basic leucine-zipper nuclear factor)	EBI-24488250	0.56
Q99081	Transcription factor 12 (TCF-12) (Class B basic helix-loop-helix protein 20) (bHLHb20) (DNA-binding protein HTF4) (E-box-binding protein) (Transcription factor HTF-4)	EBI-24492403	0.56
Q13155	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (Multisynthase complex auxiliary component p38) (Protein JTV-1)	EBI-24501654	0.56
P19474	E3 ubiquitin-protein ligase TRIM21 (EC 2.3.2.27) (52 kDa Ro protein) (52 kDa ribonucleoprotein autoantigen Ro/SS-A) (RING finger protein 81) (RING-type E3 ubiquitin transferase TRIM21) (Ro(SS-A)) (Sjoegren syndrome type A antigen) (SS-A) (Tripartite motif-containing protein 21)	EBI-24506936	0.56
Q6AI39	BRD4-interacting chromatin-remodeling complex-associated protein-like (Glioma tumor suppressor candidate region gene 1 protein-like)	EBI-24508160	0.56
Q9H992	E3 ubiquitin-protein ligase MARCHF7 (EC 2.3.2.27) (Axotrophin) (Membrane-associated RING finger protein 7) (Membrane-associated RING-CH protein VII) (MARCH-VII) (RING finger protein 177) (RING-type E3 ubiquitin transferase MARCHF7)	EBI-24511640	0.56
O76013	Keratin, type I cuticular Ha6 (Hair keratin, type I Ha6) (Keratin-36) (K36)	EBI-24527203	0.60
Q9NU19	TBC1 domain family member 22B	EBI-24617208	0.56
Q5EBL2	Zinc finger protein 628	EBI-23729583	0.56
Q6GMQ7	Vacuolar protein sorting-associated protein 16 homolog	EBI-23732828	0.56
Q6ZMJ2	Scavenger receptor class A member 5 (Scavenger receptor hlg)	EBI-24703615	0.56
O00472	RNA polymerase II elongation factor ELL2	EBI-24709958	0.56
Q9BRT2	Ubiquinol-cytochrome-c reductase complex assembly factor 2 (Breast cancer-associated protein SGA-81M) (Mitochondrial nucleoid factor 1) (Mitochondrial protein M19)	EBI-23790765	0.56
Q969W8	Zinc finger protein 566	EBI-23791595	0.56
Q9NTX9	Protein FAM217B	EBI-23801072	0.56
Q9BVN2	AP-4 complex accessory subunit RUSC1 (New molecule containing SH3 at the carboxy-terminus) (Nesca) (RUN and SH3 domain-containing protein 1)	EBI-24739968	0.56
Q9NZ72	Stathmin-3 (SCG10-like protein)	EBI-24767700	0.56
Q16533	snRNA-activating protein complex subunit 1 (SNAPc subunit 1) (Proximal sequence element-binding transcription factor subunit gamma) (PSE-binding factor subunit gamma) (PTF subunit gamma) (Small nuclear RNA-activating complex polypeptide 1) (snRNA-activating protein complex 43 kDa subunit) (SNAPc 43 kDa subunit)	EBI-24771824	0.56
Q9NPF5	DNA methyltransferase 1-associated protein 1 (DNMAP1) (DNMT1-associated protein 1)	EBI-23881341	0.56
Q8NAM6	Zinc finger and SCAN domain-containing protein 4 (Zinc finger protein 494)	EBI-23889434	0.56
Q6QNY1	Biogenesis of lysosome-related organelles complex 1 subunit 2 (BLOC-1 subunit 2) (Centrosome-associated protein)	EBI-25276513	0.56
Q9ULR0	Pre-mRNA-splicing factor ISY1 homolog	EBI-24803153	0.56
Q9BSW7	Synaptotagmin-17 (Protein B/K) (Synaptotagmin XVII) (SytXVII)	EBI-23914736	0.56
Q9BYV2	Tripartite motif-containing protein 54 (Muscle-specific RING finger protein) (MuRF) (Muscle-specific RING finger protein 3) (MuRF-3) (MuRF3) (RING finger protein 30)	EBI-24396533	0.56
Q96GS4	BLOC-1-related complex subunit 6 (Lysosome-dispersing protein) (Lyspersin)	EBI-24401384	0.56
Q8IYA8	Interactor of HORMAD1 protein 1 (Cancer/testis antigen 74) (CT74) (Coiled-coil domain-containing protein 36)	EBI-24409360	0.56
Q5T5P2	Sickle tail protein homolog	EBI-24413377	0.56
P0CG20	Proline-rich protein 35 (Uncharacterized protein RJD1)	EBI-24420156	0.56
Q9BVG8	Kinesin-like protein KIFC3	EBI-24423104	0.56
Q8N0S2	Synaptonemal complex central element protein 1 (Cancer/testis antigen 76) (CT76)	EBI-24423729	0.56
Q01546	Keratin, type II cytoskeletal 2 oral (Cytokeratin-2P) (CK-2P) (K2P) (Keratin-76) (K76) (Type-II keratin Kb9)	EBI-24425129	0.56
O14777	Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC)	EBI-24431662	0.56
Q8TD10	Mirror-image polydactyly gene 1 protein	EBI-24438784	0.56
Q70EL1	Inactive ubiquitin carboxyl-terminal hydrolase 54 (Inactive ubiquitin-specific peptidase 54)	EBI-24446451	0.56
Q14142	Tripartite motif-containing protein 14	EBI-24450438	0.56
O76011	Keratin, type I cuticular Ha4 (Hair keratin, type I Ha4) (Keratin-34) (K34)	EBI-24458571	0.56
Q5JR59	Microtubule-associated tumor suppressor candidate 2 (Cardiac zipper protein) (Microtubule plus-end tracking protein TIP150) (Tracking protein of 150 kDa)	EBI-24470046	0.56
Q6NUQ1	RAD50-interacting protein 1 (RAD50 interactor 1) (HsRINT-1) (RINT-1)	EBI-24477001	0.56
Q9Y6H3	Mitochondrial inner membrane protease ATP23 homolog (EC 3.4.24.-) (Ku70-binding protein 3) (XRCC6-binding protein 1)	EBI-24545393	0.56
Q6IC98	GRAM domain-containing protein 4 (Death-inducing protein)	EBI-24560187	0.56
Q96GY0	Zinc finger C2HC domain-containing protein 1A	EBI-24575784	0.56
A0A1U9X8X8	Corneodesmosin	EBI-24595565	0.56
Q8N2N9	Ankyrin repeat domain-containing protein 36B (CLL-associated antigen KW-1)	EBI-24597123	0.56
Q9BYU1	Pre-B-cell leukemia transcription factor 4 (Homeobox protein PBX4)	EBI-24633510	0.56
Q9BXY8	Protein BEX2 (Brain-expressed X-linked protein 2) (hBex2)	EBI-25154342	0.56
Q8WWY6	Methyl-CpG-binding domain protein 3-like 1 (MBD3-like protein 1)	EBI-24659479	0.56
Q2TBE0	CWF19-like protein 2	EBI-25181664	0.56
Q8TDC0	Myozenin-3 (Calsarcin-3) (FATZ-related protein 3)	EBI-24773710	0.56
P13682	Zinc finger protein 35 (Zinc finger protein HF.10)	EBI-24790242	0.56
Q96DF8	Splicing factor ESS-2 homolog (DiGeorge syndrome critical region 13) (DiGeorge syndrome critical region 14) (DiGeorge syndrome protein H) (DGS-H) (Protein ES2)	EBI-24799511	0.56
Q13360	Zinc finger protein 177	EBI-25211267	0.56
P03427	Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3)	EBI-14405248	0.35
P61006	Ras-related protein Rab-8A (EC 3.6.5.2) (Oncogene c-mel)	EBI-11909914	0.00
Q96KP1	Exocyst complex component 2 (Exocyst complex component Sec5)	EBI-21672932	0.51
Q8N7X8	SIGLEC family-like protein 1	EBI-21585341	0.35
P21709	Ephrin type-A receptor 1 (hEpha1) (EC 2.7.10.1) (EPH tyrosine kinase) (EPH tyrosine kinase 1) (Erythropoietin-producing hepatoma receptor) (Tyrosine-protein kinase receptor EPH)	EBI-21595997	0.35
P27930	Interleukin-1 receptor type 2 (IL-1R-2) (IL-1RT-2) (IL-1RT2) (CD121 antigen-like family member B) (CDw121b) (IL-1 type II receptor) (Interleukin-1 receptor beta) (IL-1R-beta) (Interleukin-1 receptor type II) (CD antigen CD121b) [Cleaved into: Interleukin-1 receptor type 2, membrane form (mIL-1R2) (mIL-1RII); Interleukin-1 receptor type 2, soluble form (sIL-1R2) (sIL-1RII)]	EBI-21662122	0.35
Q9Y3L3	SH3 domain-binding protein 1	EBI-21672932	0.35
Q9NX40	OCIA domain-containing protein 1 (Ovarian cancer immunoreactive antigen domain containing 1) (Ovarian carcinoma immunoreactive antigen)	EBI-21672932	0.35
Q9H4M9	EH domain-containing protein 1 (PAST homolog 1) (hPAST1) (Testilin)	EBI-21672932	0.35
Q9H223	EH domain-containing protein 4 (Hepatocellular carcinoma-associated protein 10/11) (PAST homolog 4)	EBI-21672932	0.35
Q15345	Leucine-rich repeat-containing protein 41 (Protein Muf1)	EBI-21672932	0.35
Q13136	Liprin-alpha-1 (LAR-interacting protein 1) (LIP-1) (Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1) (PTPRF-interacting protein alpha-1)	EBI-21672932	0.35
Q12981	Vesicle transport protein SEC20 (BCL2/adenovirus E1B 19 kDa protein-interacting protein 1) (Transformation-related gene 8 protein) (TRG-8)	EBI-21672932	0.35
O14975	Long-chain fatty acid transport protein 2 (Arachidonate--CoA ligase) (EC 6.2.1.15) (Fatty acid transport protein 2) (FATP-2) (Fatty-acid-coenzyme A ligase, very long-chain 1) (Long-chain-fatty-acid--CoA ligase) (EC 6.2.1.3) (Phytanate--CoA ligase) (EC 6.2.1.24) (Solute carrier family 27 member 2) (THCA-CoA ligase) (EC 6.2.1.7) (Very long-chain acyl-CoA synthetase) (VLACS) (VLCS) (EC 6.2.1.-) (Very long-chain-fatty-acid-CoA ligase)	EBI-21672932	0.35
O75131	Copine-3 (Copine III)	EBI-20901088	0.40
P82914	28S ribosomal protein S15, mitochondrial (MRP-S15) (S15mt) (Mitochondrial small ribosomal subunit protein uS15m)	EBI-20903504	0.40
P46781	40S ribosomal protein S9 (Small ribosomal subunit protein uS4)	EBI-20932336	0.40
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
P19739	Non-structural protein 4a (ns4a) (Accessory protein 4a)	EBI-25685423	0.35

Cross-References

Database	Links
UNIPROT	Q8IYI6 B3KU33 Q5TE82
Pfam	PF16528
PROSITE	PS50003
OMIM	615283 619076
DisGeNET	149371

Exocyst complex component 8 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (6 interactors)

Interactions with other proteins (109 interactors)

Cross-References

Database

Links

Description

Description