Keratin, type I cytoskeletal 18 - Homo sapiens

Keratin, type I cytoskeletal 18 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Keratin, type I cytoskeletal 18
Accession Code	P05783
Gene	KRT18
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 430)
MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYF KIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELA RKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDF NLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH

Subcellular Location

Description
Nucleus matrix {By SimilarityUniProtKB:Q5BJY9}. Cytoplasm, perinuclear region. Nucleus, nucleolus {Experimental EvidencePubMed:22002106}. Cytoplasm {By SimilarityUniProtKB:Q5BJY9}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Adherens Junction (GO:0005912) Cell Periphery (GO:0071944) Centriolar Satellite (GO:0034451) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Intermediate Filament (GO:0005882) Keratin Filament (GO:0045095) Microtubule Organizing Center (GO:0005815) Nucleolus (GO:0005730) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Involved in the uptake of thrombin-antithrombin complexes by hepatic cells (By similarity). When phosphorylated, plays a role in filament reorganization. Involved in the delivery of mutated CFTR to the plasma membrane. Together with KRT8, is involved in interleukin-6 (IL-6)-mediated barrier protection. {By Similarity, Experimental EvidencePubMed:15529338, Experimental EvidencePubMed:16424149, Experimental EvidencePubMed:17213200, Experimental EvidencePubMed:7523419, Experimental EvidencePubMed:8522591, Experimental EvidencePubMed:9298992, Experimental EvidencePubMed:9524113}.
Assigned Ontology terms

Biological Process	Anatomical Structure Morphogenesis (GO:0009653) Cell Cycle (GO:0007049) Extrinsic Apoptotic Signaling Pathway (GO:0097191) Obsolete Golgi To Plasma Membrane CFTR Protein Transport (GO:0043000) Hepatocyte Apoptotic Process (GO:0097284) Intermediate Filament Cytoskeleton Organization (GO:0045104) Negative Regulation Of Apoptotic Process (GO:0043066) Tumor Necrosis Factor-Mediated Signaling Pathway (GO:0033209)
Molecular Function	Cadherin Binding Involved In Cell-Cell Adhesion (GO:0098641) RNA Binding (GO:0003723) Scaffold Protein Binding (GO:0097110) Structural Molecule Activity (GO:0005198)

Disease associations

Description
Cirrhosis (CIRRH) [MIM:215600]: A liver disease characterized by severe panlobular liver-cell swelling with Mallory body formation, prominent pericellular fibrosis, and marked deposits of copper. Clinical features include abdomen swelling, jaundice and pulmonary hypertension. {Experimental EvidencePubMed:12724528, Experimental EvidencePubMed:9011570}. Note=The disease is caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	148070 215600
DisGeNET	3875

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (9 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O15027	Protein transport protein Sec16A	EBI-11083608	0.35
P01112	GTPase HRas, N-terminally processed	EBI-3930926	0.37
P27958	RNA-directed RNA polymerase	EBI-9350927	0.35
P05783	Self	EBI-10483950	0.37
Q14094	Cyclin-I	EBI-3915486	0.37
Q5SQX6	Cytoplasmic FMR1-interacting protein 2	EBI-16086797	0.35
O75190	DnaJ homolog subfamily B member 6	EBI-1255173	0.62
Q8WYP5	Protein ELYS	EBI-20924394	0.40
Q8IYI6	Exocyst complex component 8	EBI-756712	0.37
Interactions with other proteins (111 interactors)

Partner (UniProt)		IntAct	Confidence score
Q925J2	Polycystin 1	EBI-7985760	0.53
P62993	Growth factor receptor-bound protein 2 (Adapter protein GRB2) (Protein Ash) (SH2/SH3 adapter GRB2)	EBI-297464	0.35
P29353	SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1)	EBI-298042	0.27
P05787	Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) (Type-II keratin Kb8)	EBI-445615	0.94
P04049	RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (Proto-oncogene c-RAF) (cRaf) (Raf-1)	EBI-7291105	0.49
P63104	14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1)	EBI-7293055	0.67
Q9BVR6	Gamma-tubulin complex component	EBI-753352	0.37
P19012	Keratin, type I cytoskeletal 15 (Cytokeratin-15) (CK-15) (Keratin-15) (K15)	EBI-754231	0.55
O95751	Protein LDOC1 (Leucine zipper protein down-regulated in cancer cells)	EBI-756694	0.37
Q15834	Coiled-coil domain-containing protein 85B (Hepatitis delta antigen-interacting protein A) (Delta-interacting protein A)	EBI-757168	0.37
O14964	Hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) (Protein pp110)	EBI-758998	0.78
Q9Y5B8	Nucleoside diphosphate kinase 7 (NDK 7) (NDP kinase 7) (EC 2.7.4.6) (nm23-H7)	EBI-759004	0.67
O75688	Protein phosphatase 1B (EC 3.1.3.16) (Protein phosphatase 2C isoform beta) (PP2C-beta)	EBI-1060989	0.00
P23508	Colorectal mutant cancer protein (Protein MCC)	EBI-1078134	0.00
P05452	Tetranectin (TN) (C-type lectin domain family 3 member B) (Plasminogen kringle 4-binding protein)	EBI-1085136	0.00
P02671	Fibrinogen alpha chain [Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain]	EBI-1255726	0.37
P27348	14-3-3 protein theta (14-3-3 protein T-cell) (14-3-3 protein tau) (Protein HS1)	EBI-1255734	0.37
Q15628	Tumor necrosis factor receptor type 1-associated DEATH domain protein (TNFR1-associated DEATH domain protein) (TNFRSF1A-associated via death domain)	EBI-1371586	0.60
Q8NFJ9	Bardet-Biedl syndrome 1 protein (BBS2-like protein 2)	EBI-1805760	0.44
Q96RK4	Bardet-Biedl syndrome 4 protein	EBI-1805921	0.44
Q9BXC9	Bardet-Biedl syndrome 2 protein	EBI-1805991	0.44
Q8IWZ6	Bardet-Biedl syndrome 7 protein (BBS2-like protein 1)	EBI-1806052	0.44
Q99816	Tumor susceptibility gene 101 protein (ESCRT-I complex subunit TSG101)	EBI-2339235	0.67
Q8NFA0	Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.4.19.12) (Deubiquitinating enzyme 32) (Renal carcinoma antigen NY-REN-60) (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32)	EBI-2513538	0.40
O46385	Supervillin (Archvillin) (p205/p250)	EBI-7872249	0.37
P63103	14-3-3 protein zeta/delta (Factor activating exoenzyme S) (FAS) (Protein kinase C inhibitor protein 1) (KCIP-1)	EBI-8673294	0.35
P63101	14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1) (SEZ-2)	EBI-8686577	0.35
P61981	14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed]	EBI-3453257	0.00
P28799	Progranulin (PGRN) (Acrogranin) (Epithelin precursor) (Glycoprotein of 88 Kda) (GP88) (Glycoprotein 88) (Granulin precursor) (PC cell-derived growth factor) (PCDGF) (Proepithelin) (PEPI) [Cleaved into: Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Epithelin-2) (Granulin B); Granulin-4 (Epithelin-1) (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Granulin E)]	EBI-3909889	0.37
Q9Y6K9	NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)	EBI-3911087	0.57
Q9NUX5	Protection of telomeres protein 1 (hPot1) (POT1-like telomere end-binding protein)	EBI-3917886	0.49
Q99459	Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein)	EBI-3926990	0.37
Q09472	Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-)	EBI-3929095	0.37
P52292	Importin subunit alpha-1 (Karyopherin subunit alpha-2) (RAG cohort protein 1) (SRP1-alpha)	EBI-3931399	0.37
O43913	Origin recognition complex subunit 5	EBI-3931539	0.37
Q96GM5	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (60 kDa BRG-1/Brm-associated factor subunit A) (BRG1-associated factor 60A) (BAF60A) (SWI/SNF complex 60 kDa subunit)	EBI-3931549	0.37
Q5VU43	Myomegalin (Cardiomyopathy-associated protein 2) (Phosphodiesterase 4D-interacting protein)	EBI-3931569	0.44
Q14161	ARF GTPase-activating protein GIT2 (ARF GAP GIT2) (Cool-interacting tyrosine-phosphorylated protein 2) (CAT-2) (CAT2) (G protein-coupled receptor kinase-interactor 2) (GRK-interacting protein 2)	EBI-3931579	0.44
Q92837	Proto-oncogene FRAT1 (Frequently rearranged in advanced T-cell lymphomas 1) (FRAT-1)	EBI-3934896	0.37
Q99757	Thioredoxin, mitochondrial (MTRX) (Mt-Trx) (Thioredoxin-2)	EBI-3938277	0.37
Q6PKC3	Thioredoxin domain-containing protein 11 (EF-hand-binding protein 1)	EBI-3939414	0.37
Q8N2W9	E3 SUMO-protein ligase PIAS4 (EC 2.3.2.27) (PIASy) (Protein inhibitor of activated STAT protein 4) (Protein inhibitor of activated STAT protein gamma) (PIAS-gamma)	EBI-3939424	0.37
Q96MU7	YTH domain-containing protein 1 (Splicing factor YT521) (YT521-B)	EBI-3939434	0.37
P15336	Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response element-binding protein CRE-BP1)	EBI-5529812	0.35
Q12815	Tastin (Trophinin-assisting protein) (Trophinin-associated protein)	EBI-5652482	0.31
Q13895	Bystin	EBI-5652463	0.31
P19320	Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106)	EBI-6190694	0.53
P02751	Fibronectin (FN) (Cold-insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl-Y1; Ugl-Y2; Ugl-Y3]	EBI-6285956	0.35
P04792	Heat shock protein beta-1 (HspB1) (28 kDa heat shock protein) (Estrogen-regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP 27) (Stress-responsive protein 27) (SRP27)	EBI-6871566	0.37
P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	EBI-6898303	0.53
Q99959	Plakophilin-2	EBI-9074403	0.40
Q13835	Plakophilin-1 (Band 6 protein) (B6P)	EBI-9073560	0.58
Q08379	Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95)	EBI-10194630	0.78
Q8IYE0	Coiled-coil domain-containing protein 146	EBI-10263041	0.56
Q96CS2	HAUS augmin-like complex subunit 1 (Coiled-coil domain-containing protein 5) (Enhancer of invasion-cluster) (HEI-C)	EBI-10283572	0.56
Q9D7I8	Protein FAM83D	EBI-11048266	0.35
P63167	Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN)	EBI-11051725	0.35
A0A0S2Z505	Proline-serine-threonine phosphatase interacting protein 2 isoform 3 (Proline-serine-threonine phosphatase interacting protein 2, isoform CRA_a)	EBI-16437711	0.56
P07196	Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein)	EBI-16437697	0.56
A0A0S2Z4Q4	Hepatocyte growth factor-regulated tyrosine kinase substrate	EBI-16437687	0.56
Q5JVL4	EF-hand domain-containing protein 1 (Myoclonin-1)	EBI-24291369	0.56
Q3SY84	Keratin, type II cytoskeletal 71 (Cytokeratin-71) (CK-71) (Keratin-71) (K71) (Type II inner root sheath-specific keratin-K6irs1) (Keratin 6 irs) (hK6irs) (hK6irs1) (Type-II keratin Kb34)	EBI-24361934	0.56
P02538	Keratin, type II cytoskeletal 6A (Cytokeratin-6A) (CK-6A) (Cytokeratin-6D) (CK-6D) (Keratin-6A) (K6A) (Type-II keratin Kb6) (allergen Hom s 5)	EBI-24367348	0.56
Q5XKE5	Keratin, type II cytoskeletal 79 (Cytokeratin-79) (CK-79) (Keratin-6-like) (Keratin-6L) (Keratin-79) (K79) (Type-II keratin Kb38)	EBI-24620654	0.56
Q9NX04	Ribosome biogenesis protein C1orf109	EBI-24396239	0.56
P48668	Keratin, type II cytoskeletal 6C (Cytokeratin-6C) (CK-6C) (Cytokeratin-6E) (CK-6E) (Keratin K6h) (Keratin-6C) (K6C) (Type-II keratin Kb12)	EBI-24419624	0.68
Q9P2K3	REST corepressor 3	EBI-24420285	0.56
Q9BVG8	Kinesin-like protein KIFC3	EBI-24553060	0.56
Q8WW24	Tektin-4	EBI-24557965	0.56
Q14533	Keratin, type II cuticular Hb1 (Hair keratin K2.9) (Keratin, hair, basic, 1) (Keratin-81) (K81) (Metastatic lymph node 137 gene protein) (MLN 137) (Type II hair keratin Hb1) (Type-II keratin Kb21) (ghHKb1) (ghHb1)	EBI-24563479	0.56
Q8TD31	Coiled-coil alpha-helical rod protein 1 (Alpha-helical coiled-coil rod protein) (Putative gene 8 protein) (Pg8)	EBI-24572327	0.56
Q8N0S2	Synaptonemal complex central element protein 1 (Cancer/testis antigen 76) (CT76)	EBI-12703058	0.56
O75022	Leukocyte immunoglobulin-like receptor subfamily B member 3 (LIR-3) (Leukocyte immunoglobulin-like receptor 3) (CD85 antigen-like family member A) (Immunoglobulin-like transcript 5) (ILT-5) (Monocyte inhibitory receptor HL9) (CD antigen CD85a)	EBI-14032442	0.43
Q14457	Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]	EBI-16020615	0.50
Q9BQ69	ADP-ribose glycohydrolase MACROD1 (MACRO domain-containing protein 1) (O-acetyl-ADP-ribose deacetylase MACROD1) (EC 3.1.1.106) (Protein LRP16) ([Protein ADP-ribosylaspartate] hydrolase MACROD1) (EC 3.2.2.-) ([Protein ADP-ribosylglutamate] hydrolase MACROD1) (EC 3.2.2.-)	EBI-16880214	0.65
P61417	Chaperone protein YscY (Yop proteins translocation protein Y)	EBI-20817152	0.37
P61416	Yop proteins translocation protein X	EBI-20817281	0.37
P68640	Outer membrane protein YopN (LcrE) (Yop4b)	EBI-20817402	0.37
O30878	Putative type III secretion protein (Type III secretion protein) (Type III secretion spans bacterial envelope protein) (Yop proteins translocation protein O) (YscO)	EBI-20817508	0.37
P69974	Yop proteins translocation protein K (Low calcium response locus protein KB)	EBI-20817667	0.37
A0A5P8YI02	Attachment invasion locus protein	EBI-20818482	0.37
Q0WD22	Putative fimbrial biogenesis protein	EBI-20818419	0.37
Q86U44	N6-adenosine-methyltransferase catalytic subunit (EC 2.1.1.348) (Methyltransferase-like protein 3) (hMETTL3) (N6-adenosine-methyltransferase 70 kDa subunit) (MT-A70)	EBI-20594935	0.35
Q9HCE5	N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14)	EBI-20595531	0.35
A0A087WXM9	Meiosis-specific kinetochore protein	EBI-20917996	0.40
P08670	Vimentin	EBI-20917772	0.40
Q5HYC2	Uncharacterized protein KIAA2026	EBI-20918276	0.40
Q15149	Plectin (PCN) (PLTN) (Hemidesmosomal protein 1) (HD1) (Plectin-1)	EBI-20919124	0.40
Q96M95	Coiled-coil domain-containing protein 42	EBI-20921148	0.40
Q12860	Contactin-1 (Glycoprotein gp135) (Neural cell surface protein F3)	EBI-20920940	0.40
Q8WWL7	G2/mitotic-specific cyclin-B3	EBI-20922150	0.40
Q8IYB4	PEX5-related protein (PEX2-related protein) (PEX5-like protein) (Peroxin-5-related protein) (Peroxisome biogenesis factor 5-like) (Tetratricopeptide repeat-containing Rab8b-interacting protein) (Pex5Rp) (TRIP8b)	EBI-20926658	0.40
P01730	T-cell surface glycoprotein CD4 (T-cell surface antigen T4/Leu-3) (CD antigen CD4)	EBI-20930576	0.40
Q9Y616	Interleukin-1 receptor-associated kinase 3 (IRAK-3) (IL-1 receptor-associated kinase M) (IRAK-M) (Inactive IL-1 receptor-associated kinase 3)	EBI-20935164	0.40
Q9NY99	Gamma-2-syntrophin (G2SYN) (Syntrophin-5) (SYN5)	EBI-20938524	0.40
Q66PJ3	ADP-ribosylation factor-like protein 6-interacting protein 4 (ARL-6-interacting protein 4) (Aip-4) (HSP-975) (HSVI-binding protein) (SR-15) (SRp25) (SR-25) (Splicing factor SRrp37)	EBI-20938316	0.40
A2A935	Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1)	EBI-21022882	0.35
P14404	Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog)	EBI-21026252	0.35
Q14108	Lysosome membrane protein 2 (85 kDa lysosomal membrane sialoglycoprotein) (LGP85) (CD36 antigen-like 2) (Lysosome membrane protein II) (LIMP II) (Scavenger receptor class B member 2) (CD antigen CD36)	EBI-21264396	0.35
B7UM99	Translocated intimin receptor Tir (Secreted effector protein Tir)	EBI-22228314	0.66
P61158	Actin-related protein 3 (Actin-like protein 3)	EBI-22229062	0.27
Q96CS3	FAS-associated factor 2 (Protein ETEA) (UBX domain-containing protein 3B) (UBX domain-containing protein 8)	EBI-25770166	0.35
Q8IWF2	FAD-dependent oxidoreductase domain-containing protein 2 (Endoplasmic reticulum flavoprotein associated with degradation)	EBI-25770736	0.35
P42858	Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment]	EBI-25951430	0.56
P51114	RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p)	EBI-26510698	0.37
P51116	RNA-binding protein FXR2 (FMR1 autosomal homolog 2)	EBI-26511933	0.37
Q53F19	Nuclear cap-binding protein subunit 3 (Protein ELG)	EBI-26396827	0.35
F1PAA9	Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-27079701	0.27
P35226	Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51)	EBI-27109494	0.35
Q9UNH5	Dual specificity protein phosphatase CDC14A (EC 3.1.3.16) (EC 3.1.3.48) (CDC14 cell division cycle 14 homolog A)	EBI-27115490	0.27
Q13283	Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1)	EBI-28955349	0.35

Cross-References

Database	Links
UNIPROT	P05783 Q53G38 Q5U0N8 Q9BW26
Pfam	PF00038
PROSITE	PS00226 PS51842
OMIM	148070 215600
DisGeNET	3875

Keratin, type I cytoskeletal 18 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (9 interactors)

Interactions with other proteins (111 interactors)

Cross-References

Database

Links

Description

Description