Erbin - Homo sapiens

Erbin (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Erbin
Accession Code	Q96RT1
Gene	ERBIN
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 1412)
MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEELPKQLFNCQSLHKLSLPDND LTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRL TKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFIPGFIGSLKQLTYLDVSKN NIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITTLKIDENQLMYLPDSIGGLISVEELDCSFNEVEALPSSIGQ LTNLRTFAADHNYLQQLPPEIGSWKNITVLFLHSNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSD NQSKPLIPLQKETDSETQKMVLTNYMFPQQPRTEDVMFISDNESFNPSLWEEQRKQRAQVAFECDEDKDEREAPPREGNL KRYPTPYPDELKNMVKTVQTIVHRLKDEETNEDSGRDLKPHEDQQDINKDVGVKTSESTTTVKSKVDEREKYMIGNSVQK ISEPEAEISPGSLPVTANMKASENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKET DSLSDEVTHNSNQNNSNCSSPSRMSDSVSLNTDSSQDTSLCSPVKQTHIDINSKIRQEDENFNSLLQNGDILNSSTEEKF KAHDKKDFNLPEYDLNVEERLVLIEKSVDSTATADDTHKLDHINMNLNKLITNDTFQPEIMERSKTQDIVLGTSFLSINS KEETEHLENGNKYPNLESVNKVNGHSEETSQSPNRTEPHDSDCSVDLGISKSTEDLSPQKSGPVGSVVKSHSITNMEIGG LKIYDILSDNGPQQPSTTVKITSAVDGKNIVRSKSATLLYDQPLQVFTGSSSSSDLISGTKAIFKFDSNHNPEEPNIIRG PTSGPQSAPQIYGPPQYNIQYSSSAAVKDTLWHSKQNPQIDHASFPPQLLPRSESTENQSYAKHSANMNFSNHNNVRANT AYHLHQRLGPARHGEMWAISPNDRLIPAVTRSTIQRQSSVSSTASVNLGDPGSTRRAQIPEGDYLSYREFHSAGRTPPMM PGSQRPLSARTYSIDGPNASRPQSARPSINEIPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKSKVPRDWREQV LRHIEAKKLEKKHPQTSSSGDPCQDGIFISGQQNYSSATLSHKDVPPDSLMKMPLSNGQMGQPLRPQANYSQIHHPPQAS VARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQ PEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS

Structure Viewer (PDB: 6Q0N)

Subcellular Location

Description
Cell junction, hemidesmosome {Experimental EvidencePubMed:10878805, Experimental EvidencePubMed:11375975}. Nucleus membrane {By Similarity}. Basolateral cell membrane {Experimental EvidencePubMed:16203728}. Note=Found in hemidesmosomes, which are cell-substrate adhesion complexes in stratified epithelia. In transfected cells, either diffusely distributed over the cytoplasm or concentrated at the basolateral membrane. Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes (By similarity). {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Basal Plasma Membrane (GO:0009925) Basement Membrane (GO:0005604) Basolateral Plasma Membrane (GO:0016323) Cell Junction (GO:0030054) Cytoplasm (GO:0005737) Glutamatergic Synapse (GO:0098978) Hemidesmosome (GO:0030056) Nuclear Membrane (GO:0031965) Nuclear Speck (GO:0016607) Nucleus (GO:0005634) Plasma Membrane (GO:0005886) Postsynapse (GO:0098794)

Biology & Function

Description
Acts as an adapter for the receptor ERBB2, in epithelia. By binding the unphosphorylated 'Tyr-1248' of receptor ERBB2, it may contribute to stabilize this unphosphorylated state (PubMed:16203728). Inhibits NOD2-dependent NF-kappa-B signaling and pro-inflammatory cytokine secretion (PubMed:16203728). {Experimental EvidencePubMed:10878805, Experimental EvidencePubMed:16203728}.
Assigned Ontology terms

Biological Process	Basal Protein Localization (GO:0045175) Cell Adhesion (GO:0007155) Cellular Response To Tumor Necrosis Factor (GO:0071356) Epidermal Growth Factor Receptor Signaling Pathway (GO:0007173) Establishment Or Maintenance Of Epithelial Cell Apical/Basal Polarity (GO:0045197) Integrin-Mediated Signaling Pathway (GO:0007229) Intermediate Filament Cytoskeleton Organization (GO:0045104) Negative Regulation Of Monocyte Chemotactic Protein-1 Production (GO:0071638) Negative Regulation Of NF-KappaB Transcription Factor Activity (GO:0032088) Negative Regulation Of Nucleotide-Binding Oligomerization Domain Containing 2 Signaling Pathway (GO:0070433) Positive Regulation Of Ras Protein Signal Transduction (GO:0046579) Protein Targeting (GO:0006605) Regulation Of Postsynaptic Membrane Neurotransmitter Receptor Levels (GO:0099072) Response To Lipopolysaccharide (GO:0032496) Response To Muramyl Dipeptide (GO:0032495) Signal Transduction (GO:0007165)
Molecular Function	ErbB-2 Class Receptor Binding (GO:0005176) Signaling Receptor Binding (GO:0005102) Structural Constituent Of Cytoskeleton (GO:0005200)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (6 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O43542	DNA repair protein XRCC3	EBI-11129266	0.35
Q16620	BDNF/NT-3 growth factors receptor	EBI-32724423	0.27
Q5XI72	Eukaryotic translation initiation factor 4H	EBI-22258042	0.35
Q6AXS5	Plasminogen activator inhibitor 1 RNA-binding protein	EBI-22258042	0.35
Q9Z1W6	Protein LYRIC	EBI-22258042	0.35
P00533	Epidermal growth factor receptor	EBI-32720286	0.27
Interactions with other proteins (164 interactors)

Partner (UniProt)		IntAct	Confidence score
O95405	Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation)	EBI-7255424	0.37
Q99569	Plakophilin-4 (p0071)	EBI-8449263	0.63
P35222	Catenin beta-1 (Beta-catenin)	EBI-8449492	0.27
Q9UQ13	Leucine-rich repeat protein SHOC-2 (Protein soc-2 homolog) (Protein sur-8 homolog)	EBI-993893	0.62
Q15796	Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2)	EBI-2695978	0.40
P84022	Mothers against decapentaplegic homolog 3 (MAD homolog 3) (Mad3) (Mothers against DPP homolog 3) (hMAD-3) (JV15-2) (SMAD family member 3) (SMAD 3) (Smad3) (hSMAD3)	EBI-2696171	0.40
Q5NID9	Elongation factor Tu (EF-Tu)	EBI-2805400	0.00
Q8CZZ5	Prophage CP4-57 integrase	EBI-2841600	0.00
Q8CZQ2	LysR-family transcriptional regulator LeuO (Probable transcriptional activator for leuABCD operon)	EBI-2865700	0.00
P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	EBI-3436880	0.00
P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	EBI-3893063	0.35
P25791	Rhombotin-2 (Cysteine-rich protein TTG-2) (LIM domain only protein 2) (LMO-2) (T-cell translocation protein 2)	EBI-3939532	0.37
P40763	Signal transducer and activator of transcription 3 (Acute-phase response factor)	EBI-3940529	0.37
B1AYL1	Sodium channel protein	EBI-8068438	0.44
P36873	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit)	EBI-6911905	0.57
P57078	Receptor-interacting serine/threonine-protein kinase 4 (EC 2.7.11.1) (Ankyrin repeat domain-containing protein 3) (PKC-delta-interacting protein kinase)	EBI-12503575	0.35
A2AUM9	Centrosomal protein of 152 kDa (Cep152)	EBI-10994361	0.35
Q96H55	Unconventional myosin-XIX (Myosin head domain-containing protein 1)	EBI-11031416	0.35
Q8C767	Protein phosphatase 1 regulatory subunit 3B (Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL) (Protein phosphatase 1 regulatory subunit 4) (PP1 subunit R4) (Protein phosphatase 1 subunit GL) (PTG)	EBI-11064501	0.35
Q5HZK1	Centrosomal protein of 44 kDa (Cep44)	EBI-11074242	0.35
G3X972	Sec24-related gene family, member C (S. cerevisiae)	EBI-11079358	0.35
Q16643	Drebrin (Developmentally-regulated brain protein)	EBI-11080402	0.35
Q9NYZ3	G2 and S phase-expressed protein 1 (GTSE-1) (Protein B99 homolog)	EBI-11081743	0.35
Q00610	Clathrin heavy chain 1 (Clathrin heavy chain on chromosome 17) (CLH-17)	EBI-11082478	0.35
Q8BGH2	Sorting and assembly machinery component 50 homolog	EBI-11097023	0.35
P53667	LIM domain kinase 1 (LIMK-1) (EC 2.7.11.1)	EBI-11101207	0.35
P09803	Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-11106849	0.35
Q86X19	Transmembrane protein 17	EBI-11390509	0.27
Q9HC29	Nucleotide-binding oligomerization domain-containing protein 2 (Caspase recruitment domain-containing protein 15) (Inflammatory bowel disease protein 1)	EBI-11420226	0.66
Q6P5F9	Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog)	EBI-11603310	0.35
P03496	Non-structural protein 1 (NS1) (NS1A)	EBI-11519918	0.37
Q2PJP0	Non-structural protein 1 (NS1)	EBI-11520503	0.37
Q6DP93	Non-structural protein 1 (NS1)	EBI-11520678	0.37
P03508	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	EBI-11520965	0.37
Q20MH4	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	EBI-11521170	0.37
Q9UQB3	Catenin delta-2 (Delta-catenin) (GT24) (Neural plakophilin-related ARM-repeat protein) (NPRAP) (Neurojungin)	EBI-11793333	0.40
O00192	Splicing regulator ARVCF (Armadillo repeat protein deleted in velo-cardio-facial syndrome)	EBI-11793379	0.40
Q9BY21	G-protein coupled receptor 87 (G-protein coupled receptor 95)	EBI-11793409	0.40
Q96DL1	NXPE family member 2 (Protein FAM55B)	EBI-11793419	0.40
Q8NHY3	GAS2-like protein 2 (GAS2-related protein on chromosome 17) (Growth arrest-specific protein 2-like 2)	EBI-11793429	0.40
A3EX99	Envelope small membrane protein (E protein) (sM protein)	EBI-11794147	0.40
A3EXD5	Envelope small membrane protein (E protein) (sM protein)	EBI-11794185	0.40
P06427	Protein E6	EBI-11794195	0.40
Q9IDV3	Protein Vpu (U ORF protein) (Viral protein U)	EBI-11794220	0.40
Q1A244	Protein Vpu (U ORF protein) (Viral protein U)	EBI-11794243	0.40
P03126	Protein E6	EBI-11794253	0.40
P50804	Protein E6	EBI-11794263	0.40
P0C9G5	Protein MGF 110-2L	EBI-11794280	0.40
A3EXD4	Non-structural protein 3d (ns3d) (Accessory protein 3d)	EBI-11794297	0.40
P89432	Replication origin-binding protein (OBP) (OriBP)	EBI-11794318	0.40
P0C213	Protein Tax-1 (Protein X-LOR) (Trans-activating transcriptional regulatory protein of HTLV-1)	EBI-11794328	0.40
Q18LE1	Triplex capsid protein 2	EBI-11794586	0.40
Q8IWL3	Iron-sulfur cluster co-chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial]	EBI-13943458	0.35
P62136	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)	EBI-14025896	0.42
Q96H86	Zinc finger protein 764	EBI-21521634	0.35
Q7Z398	Zinc finger protein 550	EBI-21528160	0.35
A8K8V0	Zinc finger protein 785	EBI-21612043	0.35
P09017	Homeobox protein Hox-C4 (Homeobox protein CP19) (Homeobox protein Hox-3E)	EBI-21634836	0.35
Q8IZ69	tRNA (uracil-5-)-methyltransferase homolog A (EC 2.1.1.35) (mRNA (uracil-5-)-methyltransferase TRMT2A) (EC 2.1.1.-)	EBI-21636338	0.35
Q8WV44	E3 ubiquitin-protein ligase TRIM41 (EC 2.3.2.27) (RING finger-interacting protein with C kinase) (RINCK) (Tripartite motif-containing protein 41)	EBI-21636495	0.35
Q96IQ9	Zinc finger protein 414	EBI-21636586	0.35
Q9H9D4	Zinc finger protein 408 (PR domain zinc finger protein 17)	EBI-21642543	0.35
O43296	Zinc finger protein 264	EBI-21725229	0.35
Q49MI3	Ceramide kinase-like protein	EBI-21731388	0.35
P43235	Cathepsin K (EC 3.4.22.38) (Cathepsin O) (Cathepsin O2) (Cathepsin X)	EBI-21781359	0.35
Q8TA94	Zinc finger protein 563	EBI-21783979	0.35
Q9NY56	Odorant-binding protein 2a (Odorant-binding protein IIa) (OBPIIa)	EBI-21795463	0.35
Q6ZMY9	Zinc finger protein 517	EBI-21818150	0.35
P20160	Azurocidin (Cationic antimicrobial protein CAP37) (Heparin-binding protein) (HBP) (hHBP)	EBI-21867396	0.35
Q14CB8	Rho GTPase-activating protein 19 (Rho-type GTPase-activating protein 19)	EBI-21871748	0.35
Q9P0T4	Zinc finger protein 581	EBI-21882203	0.35
P15311	Ezrin (Cytovillin) (Villin-2) (p81)	EBI-16791848	0.27
P49841	Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)	EBI-16793176	0.27
P11279	Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a)	EBI-16795491	0.27
Q9NPJ6	Mediator of RNA polymerase II transcription subunit 4 (Activator-recruited cofactor 36 kDa component) (ARC36) (Mediator complex subunit 4) (TRAP/SMCC/PC2 subunit p36 subunit) (Vitamin D3 receptor-interacting protein complex 36 kDa component) (DRIP36)	EBI-25472202	0.27
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-21301141	0.35
Q2LC84	Protein numb homolog	EBI-22258042	0.35
Q04970	GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)	EBI-22258042	0.35
P60868	40S ribosomal protein S20	EBI-22258042	0.35
A0A0G2K8Z9	Kinesin family member 13B	EBI-22258042	0.35
G3V7V7	Insulin receptor substrate 1	EBI-22258042	0.35
D4A9L2	Serine/arginine-rich splicing factor 1 (Splicing factor, arginine/serine-rich 1)	EBI-22258042	0.35
A0A0G2K654	H1.2 linker histone, cluster member (RCG45246)	EBI-22258042	0.35
Q27W01	RNA-binding protein 8A (RNA-binding motif protein 8A) (Ribonucleoprotein RBM8A)	EBI-22258042	0.35
B2RYP6	LUC7-like 2 (S. cerevisiae) (LUC7-like 2 (S. cerevisiae) (Predicted))	EBI-22258042	0.35
G3V6S1	PRKC apoptosis WT1 regulator protein	EBI-22258042	0.35
P62890	60S ribosomal protein L30	EBI-22258042	0.35
P35427	60S ribosomal protein L13a	EBI-22258042	0.35
Q8K1Q0	Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase) (Peptide N-myristoyltransferase 1)	EBI-22258042	0.35
B5DFM8	Pre-mRNA-splicing factor SPF27	EBI-22258042	0.35
Q6AYK8	Eukaryotic translation initiation factor 3 subunit D (eIF3d) (Eukaryotic translation initiation factor 3 subunit 7) (eIF-3-zeta)	EBI-22258042	0.35
Q4V8C8	Parafibromin (Cell division cycle protein 73 homolog) (Hyperparathyroidism 2 protein homolog)	EBI-22258042	0.35
Q920F5	Malonyl-CoA decarboxylase, mitochondrial (MCD) (EC 4.1.1.9)	EBI-22258042	0.35
D4A3K5	Histone H1.1 (Histone H1a)	EBI-22258042	0.35
E9PT65	Radixin	EBI-22258042	0.35
P62850	40S ribosomal protein S24	EBI-22258042	0.35
G3V9L1	Testis expressed gene 2 (Testis-expressed 2) (Tex2)	EBI-22258042	0.35
M0R6J0	Mitochondrial ribosomal protein L39 (RCG58784, isoform CRA_a)	EBI-22258042	0.35
P62278	40S ribosomal protein S13	EBI-22258042	0.35
Q6IMY8	Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (SP120) (Scaffold-attachment factor A) (SAF-A)	EBI-22258042	0.35
Q62780	Probable ATP-dependent RNA helicase DDX46 (EC 3.6.4.13) (DEAD box protein 46) (Helicase of 117.4 kDa)	EBI-22258042	0.35
P24368	Peptidyl-prolyl cis-trans isomerase B (PPIase B) (EC 5.2.1.8) (CYP-S1) (Cyclophilin B) (Rotamase B) (S-cyclophilin) (SCYLP)	EBI-22258042	0.35
A0A0G2K719	RNA helicase (EC 3.6.4.13)	EBI-22258042	0.35
Q7TT49	Serine/threonine-protein kinase MRCK beta (EC 2.7.11.1) (CDC42-binding protein kinase beta) (DMPK-like beta) (Myotonic dystrophy kinase-related CDC42-binding kinase beta) (MRCK beta) (Myotonic dystrophy protein kinase-like beta)	EBI-22258042	0.35
P09875	UDP-glucuronosyltransferase 2B1 (UDPGT 2B1) (UGT2B1) (EC 2.4.1.17) (UDPGTr-2)	EBI-22258042	0.35
P09895	60S ribosomal protein L5	EBI-22258042	0.35
P62893	60S ribosomal protein L39	EBI-22258042	0.35
Q9R0T3	DnaJ homolog subfamily C member 3 (Interferon-induced, double-stranded RNA-activated protein kinase inhibitor) (Protein kinase inhibitor of 58 kDa) (Protein kinase inhibitor p58)	EBI-22258042	0.35
A0A0G2JW88	Microtubule-associated protein	EBI-22258042	0.35
M0R9L3	Sorting nexin	EBI-22258042	0.35
Q5RK00	39S ribosomal protein L46, mitochondrial (L46mt) (MRP-L46)	EBI-22258042	0.35
E9PU01	DNA helicase (EC 3.6.4.12)	EBI-22258042	0.35
Q3KRF2	High density lipoprotein binding protein (Vigilin) (High density lipoprotein binding protein, isoform CRA_c) (Vigilin)	EBI-22258042	0.35
F1M124	Cordon-bleu WH2 repeat protein-like 1	EBI-22258042	0.35
D3ZZT9	Collagen type XIV alpha 1 chain	EBI-22258042	0.35
Q9JJ31	Cullin-5 (CUL-5) (Vasopressin-activated calcium-mobilizing receptor 1) (VACM-1)	EBI-22258042	0.35
Q63186	Translation initiation factor eIF-2B subunit delta (eIF-2B GDP-GTP exchange factor subunit delta)	EBI-22258042	0.35
P17078	60S ribosomal protein L35	EBI-22258042	0.35
P13471	40S ribosomal protein S14	EBI-22258042	0.35
F1MAF2	A-kinase-anchoring protein 17A	EBI-22258042	0.35
Q6AYE2	Endophilin-B1 (SH3 domain-containing GRB2-like protein B1)	EBI-22258042	0.35
D4AD15	Eukaryotic translation initiation factor 4 gamma 1	EBI-22258042	0.35
P50904	Ras GTPase-activating protein 1 (GAP) (GTPase-activating protein) (RasGAP) (Ras p21 protein activator) (p120GAP)	EBI-22258042	0.35
B2GV09	Llgl2 protein	EBI-22258042	0.35
P05197	Elongation factor 2 (EF-2)	EBI-22258042	0.35
G3V9N7	Protein kinase C and casein kinase substrate in neurons 3 (RCG27172, isoform CRA_a)	EBI-22258042	0.35
P62961	Y-box-binding protein 1 (YB-1) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor)	EBI-22258042	0.35
A0A096MK30	Moesin	EBI-22258042	0.35
D4A4R1	EMAP-like 3 (RCG48622, isoform CRA_a)	EBI-22258042	0.35
P30009	Myristoylated alanine-rich C-kinase substrate (MARCKS) (Protein kinase C substrate 80 kDa protein)	EBI-22258042	0.35
Q5M7V8	Thyroid hormone receptor-associated protein 3 (Thyroid hormone receptor-associated protein complex 150 kDa component) (Trap150)	EBI-22258042	0.35
P47198	60S ribosomal protein L22	EBI-22258042	0.35
P31000	Vimentin	EBI-22258042	0.35
P61314	60S ribosomal protein L15	EBI-22258042	0.35
D3Z898	Deoxynucleoside triphosphate triphosphohydrolase SAMHD1	EBI-22258042	0.35
Q5U2Q7	Eukaryotic peptide chain release factor subunit 1 (Eukaryotic release factor 1) (eRF1)	EBI-22258042	0.35
Q5XIM5	Protein CDV3 homolog	EBI-22258042	0.35
P13086	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial (EC 6.2.1.4) (EC 6.2.1.5) (Succinyl-CoA synthetase subunit alpha) (SCS-alpha)	EBI-22258042	0.35
Q5M963	N-acylneuraminate cytidylyltransferase (EC 2.7.7.43) (CMP-N-acetylneuraminic acid synthase)	EBI-22258042	0.35
P81795	Eukaryotic translation initiation factor 2 subunit 3, X-linked (EC 3.6.5.3) (Eukaryotic translation initiation factor 2 subunit gamma, X-linked) (eIF-2-gamma) (eIF-2-gamma X) (PP42)	EBI-22258042	0.35
M0R9T2	Erbb2-interacting protein	EBI-22258042	0.35
P41743	Protein kinase C iota type (EC 2.7.11.13) (Atypical protein kinase C-lambda/iota) (PRKC-lambda/iota) (aPKC-lambda/iota) (nPKC-iota)	EBI-25380638	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
K9N5R3	Envelope small membrane protein (E protein) (sM protein)	EBI-26973414	0.40
F1PAA9	Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-27079701	0.27
A0A0H3NFP4	SPI-2 type III secretion system effector SifA (Type III secretion system effector protein-necessary for Sif formation and maintaining the SCV. Has GAP activity)	EBI-27055788	0.27
P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	EBI-27087549	0.35
Q99592	Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171)	EBI-27093179	0.35
Q92630	Dual specificity tyrosine-phosphorylation-regulated kinase 2 (EC 2.7.12.1)	EBI-28952324	0.27
Q13886	Krueppel-like factor 9 (Basic transcription element-binding protein 1) (BTE-binding protein 1) (GC-box-binding protein 1) (Transcription factor BTEB1)	EBI-29000705	0.35
P30530	Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene)	EBI-32717503	0.35
P29317	Ephrin type-A receptor 2 (EC 2.7.10.1) (Epithelial cell kinase) (Tyrosine-protein kinase receptor ECK)	EBI-32720711	0.27
P29320	Ephrin type-A receptor 3 (EC 2.7.10.1) (EPH-like kinase 4) (EK4) (hEK4) (HEK) (Human embryo kinase) (Tyrosine-protein kinase TYRO4) (Tyrosine-protein kinase receptor ETK1) (Eph-like tyrosine kinase 1)	EBI-32720767	0.27
P54764	Ephrin type-A receptor 4 (EC 2.7.10.1) (EPH-like kinase 8) (EK8) (hEK8) (Tyrosine-protein kinase TYRO1) (Tyrosine-protein kinase receptor SEK)	EBI-32720816	0.27
P54756	Ephrin type-A receptor 5 (EC 2.7.10.1) (Brain-specific kinase) (EPH homology kinase 1) (EHK-1) (EPH-like kinase 7) (EK7) (hEK7)	EBI-32720907	0.27
Q15375	Ephrin type-A receptor 7 (EC 2.7.10.1) (EPH homology kinase 3) (EHK-3) (EPH-like kinase 11) (EK11) (hEK11)	EBI-32721052	0.27
P21802	Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332)	EBI-32721907	0.27
P22455	Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334)	EBI-32722168	0.27
Q06124	Tyrosine-protein phosphatase non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1D) (PTP-1D) (Protein-tyrosine phosphatase 2C) (PTP-2C) (SH-PTP2) (SHP-2) (Shp2) (SH-PTP3)	EBI-32723738	0.27
Q16288	NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)	EBI-32724526	0.27
P16234	Platelet-derived growth factor receptor alpha (PDGF-R-alpha) (PDGFR-alpha) (EC 2.7.10.1) (Alpha platelet-derived growth factor receptor) (Alpha-type platelet-derived growth factor receptor) (CD140 antigen-like family member A) (CD140a antigen) (Platelet-derived growth factor alpha receptor) (Platelet-derived growth factor receptor 2) (PDGFR-2) (CD antigen CD140a)	EBI-32724889	0.27
Q01973	Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Neurotrophic tyrosine kinase, receptor-related 1)	EBI-32725295	0.27
Q6J9G0	Tyrosine-protein kinase STYK1 (EC 2.7.10.2) (Novel oncogene with kinase domain) (Protein PK-unique) (Serine/threonine/tyrosine kinase 1)	EBI-32731895	0.27
P12830	Cadherin-1 (CAM 120/80) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-34580821	0.35

Cross-References

Database	Links
UNIPROT	Q96RT1 A0AVR1 B4E3F1 B7ZLV9 E7EQW9 E9PCR8 Q1RMD0 Q86W38 Q9NR18 Q9NW48 Q9ULJ5
PDB	1MFG 1MFL 1N7T 2H3L 2QBW 3CH8 6Q0M 6Q0N 6Q0U 6UBH 7LUL
Pfam	PF13855 PF00595
PROSITE	PS51450 PS50106
OMIM	606944
DisGeNET	55914

Erbin (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 6Q0N)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (6 interactors)

Interactions with other proteins (164 interactors)

Cross-References

Database

Links

Description

Description