Protein Information |
|
|---|---|
| Protein Name | PRKCA-binding protein |
| Accession Code | Q9NRD5 |
| Gene | PICK1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 415) | |
|
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKG KTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTA ELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKME LLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTR GAAGPLDKGGSWCDS |
|
Structure Viewer (PDB: 6BJN) |
|---|
Description |
||
|---|---|---|
| Cytoplasm, perinuclear region. Membrane {By Similarity}; Peripheral membrane protein {By Similarity}. Membrane {By Similarity}; Lipid-anchor {By Similarity}. Postsynaptic density {By Similarity}. Synapse, synaptosome {By Similarity}. Cytoplasm, cytoskeleton {By Similarity}. Note=Also membrane-associated, present at excitatory synapses. {By Similarity}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Lipid-Anchored | UniProt | By Similarity {ECO:0000250} | Assigned Ontology terms |
| Cellular Component | Anchoring Junction (GO:0070161) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Cytosol (GO:0005829) Endocytic Vesicle Membrane (GO:0030666) Golgi Apparatus (GO:0005794) Neuron Projection (GO:0043005) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Postsynaptic Density (GO:0014069) Postsynaptic Early Endosome (GO:0098842) Presynaptic Membrane (GO:0042734) Synapse (GO:0045202) Synaptic Vesicle (GO:0008021) Trans-Golgi Network Membrane (GO:0032588) |
|
Interactions with Nuclear Envelope proteins (15 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O75604 | Ubiquitin carboxyl-terminal hydrolase 2 | EBI-24275762 | 0.56 |
| Q6ZRP7 | Sulfhydryl oxidase 2 | EBI-21519718 | 0.35 |
| Q9BUZ4 | TNF receptor-associated factor 4 | EBI-24332833 | 0.56 |
| Q9NRR5 | Ubiquilin-4 | EBI-950320 | 0.00 |
| Q9WMX2 | RNA-directed RNA polymerase | EBI-9081130 | 0.37 |
| Q9NRD5 | Self | EBI-24440238 | 0.56 |
| Q06787 | Fragile X messenger ribonucleoprotein 1 | EBI-26509641 | 0.55 |
| Q15056 | Eukaryotic translation initiation factor 4H | EBI-24336001 | 0.56 |
| Q92993 | Histone acetyltransferase KAT5 | EBI-24509305 | 0.56 |
| P05129 | Protein kinase C gamma type | EBI-953356 | 0.00 |
| Q9Y6R4 | Mitogen-activated protein kinase kinase kinase 4 | EBI-21380388 | 0.00 |
| Q13330 | Metastasis-associated protein MTA1 | EBI-24459255 | 0.56 |
| Q9BVI4 | Nucleolar complex protein 4 homolog | EBI-24505850 | 0.56 |
| Q96CV9 | Optineurin | EBI-24457528 | 0.56 |
| Q8NC51 | Plasminogen activator inhibitor 1 RNA-binding protein | EBI-24463602 | 0.56 | Interactions with other proteins (381 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q16515 | Acid-sensing ion channel 2 (ASIC2) (Amiloride-sensitive brain sodium channel) (Amiloride-sensitive cation channel 1, neuronal) (Amiloride-sensitive cation channel neuronal 1) (Brain sodium channel 1) (BNC1) (BNaC1) (Mammalian degenerin homolog) (MDEG) | EBI-79148 | 0.51 |
| P78348 | Acid-sensing ion channel 1 (ASIC1) (Amiloride-sensitive cation channel 2, neuronal) (Brain sodium channel 2) (BNaC2) | EBI-79188 | 0.54 |
| Q01959 | Sodium-dependent dopamine transporter (DA transporter) (DAT) (Solute carrier family 6 member 3) | EBI-7839657 | 0.54 |
| P23975 | Sodium-dependent noradrenaline transporter (Norepinephrine transporter) (NET) (Solute carrier family 6 member 2) | EBI-7839909 | 0.51 |
| P31645 | Sodium-dependent serotonin transporter (SERT) (5HT transporter) (5HTT) (Solute carrier family 6 member 4) | EBI-7840397 | 0.37 |
| P49683 | Prolactin-releasing peptide receptor (PrRP receptor) (PrRPR) (G-protein coupled receptor 10) (hGR3) | EBI-8009407 | 0.46 |
| Q7Z2E3 | Aprataxin (EC 3.6.1.71) (EC 3.6.1.72) (Forkhead-associated domain histidine triad-like protein) (FHA-HIT) | EBI-950686 | 0.00 |
| P54252 | Ataxin-3 (EC 3.4.19.12) (Machado-Joseph disease protein 1) (Spinocerebellar ataxia type 3 protein) | EBI-952456 | 0.00 |
| O15265 | Ataxin-7 (Spinocerebellar ataxia type 7 protein) | EBI-952462 | 0.00 |
| Q14CW9 | Ataxin-7-like protein 3 (SAGA-associated factor 11 homolog) | EBI-952498 | 0.00 |
| Q96RK0 | Protein capicua homolog | EBI-952534 | 0.00 |
| P38432 | Coilin (p80-coilin) | EBI-952630 | 0.00 |
| Q16595 | Frataxin, mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) [Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN)] | EBI-952768 | 0.00 |
| Q99684 | Zinc finger protein Gfi-1 (Growth factor independent protein 1) (Zinc finger protein 163) | EBI-952774 | 0.00 |
| Q5VTD9 | Zinc finger protein Gfi-1b (Growth factor independent protein 1B) (Potential regulator of CDKN1A translocated in CML) | EBI-953050 | 0.00 |
| Q9NZJ4 | Sacsin (DnaJ homolog subfamily C member 29) (DNAJC29) | EBI-953494 | 0.00 |
| Q93009 | Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) | EBI-953614 | 0.00 |
| Q3KSR8 | Cytoplasmic envelopment protein 1 | EBI-2622155 | 0.37 |
| Q3KSS4 | Epstein-Barr nuclear antigen 1 (EBNA-1) (EBV nuclear antigen 1) | EBI-2623394 | 0.37 |
| Q9NZN4 | EH domain-containing protein 2 (PAST homolog 2) | EBI-3918707 | 0.37 |
| P31749 | RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha) | EBI-9063779 | 0.37 |
| Q15223 | Nectin-1 (Herpes virus entry mediator C) (Herpesvirus entry mediator C) (HveC) (Herpesvirus Ig-like receptor) (HIgR) (Nectin cell adhesion molecule 1) (Poliovirus receptor-related protein 1) (CD antigen CD111) | EBI-11668410 | 0.37 |
| Q15911 | Zinc finger homeobox protein 3 (AT motif-binding factor 1) (AT-binding transcription factor 1) (Alpha-fetoprotein enhancer-binding protein) (Zinc finger homeodomain protein 3) (ZFH-3) | EBI-24274297 | 0.56 |
| Q8TAP4 | LIM domain only protein 3 (LMO-3) (Neuronal-specific transcription factor DAT1) (Rhombotin-3) | EBI-24274829 | 0.56 |
| Q96KN3 | Homeobox protein PKNOX2 (Homeobox protein PREP-2) (PBX/knotted homeobox 2) | EBI-24275930 | 0.56 |
| Q96ST8 | Centrosomal protein of 89 kDa (Cep89) (Centrosomal protein 123) (Cep123) (Coiled-coil domain-containing protein 123) | EBI-24276888 | 0.56 |
| Q9UJX0 | Oxidative stress-induced growth inhibitor 1 (Bone marrow stromal cell-derived growth inhibitor) (BMSC-derived growth inhibitor) (Ovary, kidney and liver protein 38) (huOKL38) (Pregnancy-induced growth inhibitor OKL38) | EBI-24278192 | 0.56 |
| Q99633 | Pre-mRNA-splicing factor 18 (PRP18 homolog) (hPRP18) | EBI-24278416 | 0.56 |
| Q9BT17 | Mitochondrial ribosome-associated GTPase 1 (GTP-binding protein 7) (Mitochondrial GTPase 1) | EBI-24278563 | 0.56 |
| P49247 | Ribose-5-phosphate isomerase (EC 5.3.1.6) (Phosphoriboisomerase) | EBI-24280459 | 0.56 |
| Q9P2J8 | Zinc finger protein 624 | EBI-24280504 | 0.56 |
| P07947 | Tyrosine-protein kinase Yes (EC 2.7.10.2) (Proto-oncogene c-Yes) (p61-Yes) | EBI-24281210 | 0.56 |
| Q12774 | Rho guanine nucleotide exchange factor 5 (Ephexin-3) (Guanine nucleotide regulatory protein TIM) (Oncogene TIM) (Transforming immortalized mammary oncogene) (p60 TIM) | EBI-24281059 | 0.56 |
| Q86VK4 | Zinc finger protein 410 (Another partner for ARF 1) | EBI-24281311 | 0.56 |
| P55273 | Cyclin-dependent kinase 4 inhibitor D (p19-INK4d) | EBI-24281941 | 0.56 |
| O75771 | DNA repair protein RAD51 homolog 4 (R51H3) (RAD51 homolog D) (RAD51-like protein 3) (TRAD) | EBI-24282267 | 0.56 |
| Q7Z6G3 | N-terminal EF-hand calcium-binding protein 2 (EF-hand calcium-binding protein 2) (Neuronal calcium-binding protein 2) (Synaptotagmin-interacting protein 2) (Stip-2) | EBI-24282418 | 0.56 |
| P09661 | U2 small nuclear ribonucleoprotein A' (U2 snRNP A') | EBI-24284868 | 0.56 |
| Q6PF18 | MORN repeat-containing protein 3 | EBI-24285776 | 0.56 |
| Q9BY14 | Testis-expressed protein 101 (Cell surface receptor NYD-SP8) (Scleroderma-associated autoantigen) (Spermatogenesis-related gene protein) | EBI-24286791 | 0.56 |
| P13682 | Zinc finger protein 35 (Zinc finger protein HF.10) | EBI-24287175 | 0.56 |
| Q56NI9 | N-acetyltransferase ESCO2 (EC 2.3.1.-) (Establishment factor-like protein 2) (EFO2) (EFO2p) (hEFO2) (Establishment of cohesion 1 homolog 2) (ECO1 homolog 2) | EBI-24290604 | 0.56 |
| O75031 | Heat shock factor 2-binding protein | EBI-24291316 | 0.56 |
| Q9H0A9 | Speriolin-like protein (Spermatogenesis and centriole-associated protein 1-like protein) | EBI-24292384 | 0.56 |
| Q7L273 | BTB/POZ domain-containing protein KCTD9 | EBI-24293130 | 0.56 |
| Q8N554 | Zinc finger protein 276 (Zfp-276) (Zinc finger protein 477) | EBI-24294832 | 0.56 |
| Q13043 | Serine/threonine-protein kinase 4 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 1) (MST-1) (STE20-like kinase MST1) (Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit (MST1/N); Serine/threonine-protein kinase 4 18kDa subunit (MST1/C)] | EBI-24295848 | 0.56 |
| P61457 | Pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (DCoH) (Dimerization cofactor of HNF1) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) | EBI-24296668 | 0.56 |
| Q8IYH5 | ZZ-type zinc finger-containing protein 3 | EBI-24298036 | 0.56 |
| Q6ZNH5 | Zinc finger protein 497 | EBI-24297929 | 0.56 |
| P49910 | Zinc finger protein 165 (Cancer/testis antigen 53) (CT53) (LD65) (Zinc finger and SCAN domain-containing protein 7) | EBI-24298635 | 0.56 |
| Q8IW40 | Coiled-coil domain-containing protein 103 | EBI-24299060 | 0.56 |
| Q9BYV2 | Tripartite motif-containing protein 54 (Muscle-specific RING finger protein) (MuRF) (Muscle-specific RING finger protein 3) (MuRF-3) (MuRF3) (RING finger protein 30) | EBI-24300061 | 0.56 |
| Q6NX45 | Zinc finger protein 774 | EBI-24301397 | 0.56 |
| O95983 | Methyl-CpG-binding domain protein 3 (Methyl-CpG-binding protein MBD3) | EBI-24302986 | 0.56 |
| Q9BPX1 | 17-beta-hydroxysteroid dehydrogenase 14 (17-beta-HSD 14) (EC 1.1.1.62) (17-beta-hydroxysteroid dehydrogenase DHRS10) (Dehydrogenase/reductase SDR family member 10) (Retinal short-chain dehydrogenase/reductase retSDR3) (Short chain dehydrogenase/reductase family 47C member 1) | EBI-24303900 | 0.56 |
| Q9ULW3 | Activator of basal transcription 1 (hABT1) (Basal transcriptional activator) | EBI-24305866 | 0.56 |
| Q5W5X9 | Tetratricopeptide repeat protein 23 (TPR repeat protein 23) (Cervical cancer proto-oncogene 8 protein) (HCC-8) | EBI-24305955 | 0.56 |
| P43358 | Melanoma-associated antigen 4 (Cancer/testis antigen 1.4) (CT1.4) (MAGE-4 antigen) (MAGE-41 antigen) (MAGE-X2 antigen) | EBI-24307997 | 0.56 |
| P42772 | Cyclin-dependent kinase 4 inhibitor B (Multiple tumor suppressor 2) (MTS-2) (p14-INK4b) (p15-INK4b) (p15INK4B) | EBI-24308278 | 0.56 |
| Q8WWY3 | U4/U6 small nuclear ribonucleoprotein Prp31 (Pre-mRNA-processing factor 31) (Serologically defined breast cancer antigen NY-BR-99) (U4/U6 snRNP 61 kDa protein) (Protein 61K) (hPrp31) | EBI-24308705 | 0.56 |
| Q08117 | TLE family member 5 (Amino-terminal enhancer of split) (Amino enhancer of split) (Gp130-associated protein GAM) (Grg-5) (Groucho-related protein 5) (Protein ESP1) (Protein GRG) (TLE family member 5, transcriptional modulator) | EBI-24309537 | 0.56 |
| Q7Z4V0 | Zinc finger protein 438 | EBI-24309655 | 0.56 |
| Q9BSW7 | Synaptotagmin-17 (Protein B/K) (Synaptotagmin XVII) (SytXVII) | EBI-24310347 | 0.56 |
| Q13895 | Bystin | EBI-24310949 | 0.56 |
| Q9HC52 | Chromobox protein homolog 8 (Polycomb 3 homolog) (Pc3) (hPc3) (Rectachrome 1) | EBI-24311604 | 0.56 |
| Q15772 | Striated muscle preferentially expressed protein kinase (EC 2.7.11.1) (Aortic preferentially expressed protein 1) (APEG-1) | EBI-24312386 | 0.56 |
| Q9C086 | INO80 complex subunit B (High mobility group AT-hook 1-like 4) (IES2 homolog) (hIes2) (PAP-1-associated protein 1) (PAPA-1) (Zinc finger HIT domain-containing protein 4) | EBI-24314142 | 0.56 |
| Q8N6Y0 | Harmonin-binding protein USHBP1 (AIE-75-binding protein) (Mutated in colon cancer protein 2) (MCC-2) (Usher syndrome type-1C protein-binding protein 1) (USH1C-binding protein 1) | EBI-24314498 | 0.56 |
| Q9Y250 | Leucine zipper putative tumor suppressor 1 (F37/esophageal cancer-related gene-coding leucine-zipper motif) (Fez1) | EBI-24315716 | 0.56 |
| Q96G04 | Protein-lysine N-methyltransferase EEF2KMT (EC 2.1.1.-) (eEF2-lysine methyltransferase) (eEF2-KMT) | EBI-24317376 | 0.56 |
| Q8N9N8 | Probable RNA-binding protein EIF1AD (Eukaryotic translation initiation factor 1A domain-containing protein) (Haponin) | EBI-24317590 | 0.56 |
| Q96H86 | Zinc finger protein 764 | EBI-24318883 | 0.56 |
| P23025 | DNA repair protein complementing XP-A cells (Xeroderma pigmentosum group A-complementing protein) | EBI-24319146 | 0.56 |
| Q12824 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (BRG1-associated factor 47) (BAF47) (Integrase interactor 1 protein) (SNF5 homolog) (hSNF5) | EBI-24323353 | 0.56 |
| P61966 | AP-1 complex subunit sigma-1A (Adaptor protein complex AP-1 subunit sigma-1A) (Adaptor-related protein complex 1 subunit sigma-1A) (Clathrin assembly protein complex 1 sigma-1A small chain) (Clathrin coat assembly protein AP19) (Golgi adaptor HA1/AP1 adaptin sigma-1A subunit) (HA1 19 kDa subunit) (Sigma 1a subunit of AP-1 clathrin) (Sigma-adaptin 1A) (Sigma1A-adaptin) | EBI-24324433 | 0.56 |
| Q9NX01 | Thioredoxin-like protein 4B (Dim1-like protein) | EBI-24326050 | 0.56 |
| Q9H1K1 | Iron-sulfur cluster assembly enzyme ISCU, mitochondrial (NifU-like N-terminal domain-containing protein) (NifU-like protein) | EBI-24326107 | 0.56 |
| P32321 | Deoxycytidylate deaminase (EC 3.5.4.12) (dCMP deaminase) | EBI-24327302 | 0.56 |
| Q7L5A3 | Protein FAM214B | EBI-24329389 | 0.56 |
| Q9UGP5 | DNA polymerase lambda (Pol Lambda) (EC 2.7.7.7) (EC 4.2.99.-) (DNA polymerase beta-2) (Pol beta2) (DNA polymerase kappa) | EBI-24329540 | 0.56 |
| Q5JST6 | EF-hand domain-containing family member C2 | EBI-24329690 | 0.56 |
| Q9Y5B8 | Nucleoside diphosphate kinase 7 (NDK 7) (NDP kinase 7) (EC 2.7.4.6) (nm23-H7) | EBI-24330141 | 0.56 |
| Q96MY7 | Protein FAM161B | EBI-24331110 | 0.56 |
| Q9NQZ8 | Endothelial zinc finger protein induced by tumor necrosis factor alpha (Zinc finger protein 71) | EBI-24332534 | 0.56 |
| Q6ZN57 | Zinc finger protein ZFP2 (Zfp-2) (Zinc finger protein 751) | EBI-24332969 | 0.56 |
| Q68J44 | Dual specificity phosphatase 29 (Dual specificity phosphatase 27) (Dual specificity phosphatase DUPD1) (EC 3.1.3.16, EC 3.1.3.48) | EBI-24333287 | 0.56 |
| Q504U0 | Renal cancer differentiation gene 1 protein | EBI-24333616 | 0.56 |
| Q9HBT8 | Zinc finger protein 286A | EBI-24334718 | 0.56 |
| Q6P1J9 | Parafibromin (Cell division cycle protein 73 homolog) (Hyperparathyroidism 2 protein) | EBI-24334924 | 0.56 |
| Q8N680 | Zinc finger and BTB domain-containing protein 2 | EBI-24336367 | 0.56 |
| Q8TCE9 | Placental protein 13-like (Charcot-Leyden crystal protein 2) (CLC2) (Galectin-14) (Gal-14) | EBI-24336562 | 0.56 |
| Q8WYJ6 | Septin-1 (LARP) (Peanut-like protein 3) (Serologically defined breast cancer antigen NY-BR-24) | EBI-24341060 | 0.56 |
| A0A024R4Z4 | HCG2039447, isoform CRA_d (HCG2042749, isoform CRA_c) | EBI-24342526 | 0.56 |
| Q9HAN9 | Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 (NMN/NaMN adenylyltransferase 1) (EC 2.7.7.1) (EC 2.7.7.18) (Nicotinamide-nucleotide adenylyltransferase 1) (NMN adenylyltransferase 1) (Nicotinate-nucleotide adenylyltransferase 1) (NaMN adenylyltransferase 1) | EBI-24343045 | 0.56 |
| Q4VC12 | Putative protein MSS51 homolog, mitochondrial (Zinc finger MYND domain-containing protein 17) | EBI-24344148 | 0.56 |
| Q7LBR1 | Charged multivesicular body protein 1b (CHMP1.5) (Chromatin-modifying protein 1b) (CHMP1b) (Vacuolar protein sorting-associated protein 46-2) (Vps46-2) (hVps46-2) | EBI-24347130 | 0.56 |
| Q86T90 | Protein hinderin | EBI-24351146 | 0.56 |
| Q5T6S3 | PHD finger protein 19 (Polycomb-like protein 3) (hPCL3) | EBI-24353562 | 0.56 |
| Q92917 | G-patch domain and KOW motifs-containing protein (G-patch domain-containing protein 5) (Protein MOS2 homolog) (Protein T54) | EBI-24353414 | 0.56 |
| Q5QJE6 | Deoxynucleotidyltransferase terminal-interacting protein 2 (Estrogen receptor-binding protein) (LPTS-interacting protein 2) (LPTS-RP2) (Terminal deoxynucleotidyltransferase-interacting factor 2) (TdIF2) (TdT-interacting factor 2) | EBI-24353678 | 0.56 |
| Q9H147 | Deoxynucleotidyltransferase terminal-interacting protein 1 (Terminal deoxynucleotidyltransferase-interacting factor 1) (TdIF1) (TdT-interacting factor 1) | EBI-24359365 | 0.56 |
| P40938 | Replication factor C subunit 3 (Activator 1 38 kDa subunit) (A1 38 kDa subunit) (Activator 1 subunit 3) (Replication factor C 38 kDa subunit) (RF-C 38 kDa subunit) (RFC38) | EBI-24360427 | 0.56 |
| Q17RB8 | LON peptidase N-terminal domain and RING finger protein 1 (RING finger protein 191) | EBI-24360679 | 0.56 |
| Q9BQP7 | Mitochondrial genome maintenance exonuclease 1 (EC 3.1.-.-) | EBI-24360919 | 0.56 |
| Q96T60 | Bifunctional polynucleotide phosphatase/kinase (DNA 5'-kinase/3'-phosphatase) (Polynucleotide kinase-3'-phosphatase) [Includes: Polynucleotide 3'-phosphatase (EC 3.1.3.32) (2'(3')-polynucleotidase); Polynucleotide 5'-hydroxyl-kinase (EC 2.7.1.78)] | EBI-24360963 | 0.56 |
| Q9UJW9 | SERTA domain-containing protein 3 (Replication protein-binding trans-activator) (RPA-binding trans-activator) | EBI-24361138 | 0.56 |
| Q96QA6 | Protein yippee-like 2 | EBI-24361956 | 0.56 |
| P61086 | Ubiquitin-conjugating enzyme E2 K (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme K) (Huntingtin-interacting protein 2) (HIP-2) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme E2-25 kDa) (Ubiquitin-conjugating enzyme E2(25K)) (Ubiquitin-conjugating enzyme E2-25K) (Ubiquitin-protein ligase) | EBI-24362532 | 0.56 |
| Q969R5 | Lethal(3)malignant brain tumor-like protein 2 (H-l(3)mbt-like protein 2) (L(3)mbt-like protein 2) | EBI-24363925 | 0.56 |
| P31751 | RAC-beta serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase Akt-2) (Protein kinase B beta) (PKB beta) (RAC-PK-beta) | EBI-25246907 | 0.56 |
| Q16512 | Serine/threonine-protein kinase N1 (EC 2.7.11.13) (Protease-activated kinase 1) (PAK-1) (Protein kinase C-like 1) (Protein kinase C-like PKN) (Protein kinase PKN-alpha) (Protein-kinase C-related kinase 1) (Serine-threonine protein kinase N) | EBI-25246962 | 0.56 |
| P47897 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | EBI-25248117 | 0.56 |
| Q3SY00 | Testis-specific protein 10-interacting protein (Tsga10-interacting protein) | EBI-25249747 | 0.56 |
| Q96MU7 | YTH domain-containing protein 1 (Splicing factor YT521) (YT521-B) | EBI-25249902 | 0.56 |
| Q9NSI2 | Ribosome biogenesis protein SLX9 homolog | EBI-25249983 | 0.56 |
| Q14119 | Vascular endothelial zinc finger 1 (Putative transcription factor DB1) (Zinc finger protein 161) | EBI-25251633 | 0.56 |
| Q9BV90 | U11/U12 small nuclear ribonucleoprotein 25 kDa protein (U11/U12 snRNP 25 kDa protein) (U11/U12-25K) (Minus-99 protein) | EBI-25252778 | 0.56 |
| Q9NQT4 | Exosome complex component RRP46 (Chronic myelogenous leukemia tumor antigen 28) (Exosome component 5) (Ribosomal RNA-processing protein 46) (p12B) | EBI-25253504 | 0.56 |
| Q14451 | Growth factor receptor-bound protein 7 (B47) (Epidermal growth factor receptor GRB-7) (GRB7 adapter protein) | EBI-25254111 | 0.56 |
| Q8NEH6 | Meiosis-specific nuclear structural protein 1 | EBI-25254288 | 0.56 |
| Q9BXS5 | AP-1 complex subunit mu-1 (AP-mu chain family member mu1A) (Adaptor protein complex AP-1 subunit mu-1) (Adaptor-related protein complex 1 subunit mu-1) (Clathrin assembly protein complex 1 mu-1 medium chain 1) (Clathrin coat assembly protein AP47) (Clathrin coat-associated protein AP47) (Golgi adaptor HA1/AP1 adaptin mu-1 subunit) (Mu-adaptin 1) (Mu1A-adaptin) | EBI-25254630 | 0.56 |
| Q96MN5 | Transcription elongation factor A N-terminal and central domain-containing protein 2 | EBI-25254880 | 0.56 |
| Q96HH0 | ROBO3 protein | EBI-25255196 | 0.56 |
| Q08AG9 | Cytochrome P450, family 21, subfamily A, polypeptide 2 | EBI-25256463 | 0.56 |
| P08311 | Cathepsin G (CG) (EC 3.4.21.20) [Cleaved into: Cathepsin G, C-terminal truncated form] | EBI-25256928 | 0.56 |
| Q8IVS8 | Glycerate kinase (EC 2.7.1.31) (HBeAg-binding protein 4) | EBI-25256884 | 0.56 |
| Q969R2 | Oxysterol-binding protein 2 (Oxysterol-binding protein-related protein 4) (ORP-4) (OSBP-related protein 4) | EBI-25257560 | 0.56 |
| Q9BZR8 | Apoptosis facilitator Bcl-2-like protein 14 (Bcl2-L-14) (Apoptosis regulator Bcl-G) | EBI-25257945 | 0.56 |
| Q96C55 | Zinc finger protein 524 | EBI-24364583 | 0.56 |
| Q9BX10 | GTP-binding protein 2 | EBI-24365161 | 0.56 |
| Q8NC69 | BTB/POZ domain-containing protein KCTD6 (KCASH3 protein) (Potassium channel tetramerization domain-containing protein 6) | EBI-24366062 | 0.56 |
| P57086 | SCAN domain-containing protein 1 | EBI-24366391 | 0.56 |
| Q08426 | Peroxisomal bifunctional enzyme (PBE) (PBFE) (L-bifunctional protein) (LBP) (Multifunctional enzyme 1) (MFE1) [Includes: Enoyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase (EC 4.2.1.17) (EC 5.3.3.8); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)] | EBI-24366679 | 0.56 |
| P52564 | Dual specificity mitogen-activated protein kinase kinase 6 (MAP kinase kinase 6) (MAPKK 6) (EC 2.7.12.2) (MAPK/ERK kinase 6) (MEK 6) (Stress-activated protein kinase kinase 3) (SAPK kinase 3) (SAPKK-3) (SAPKK3) | EBI-24366773 | 0.56 |
| O75400 | Pre-mRNA-processing factor 40 homolog A (Fas ligand-associated factor 1) (Formin-binding protein 11) (Formin-binding protein 3) (Huntingtin yeast partner A) (Huntingtin-interacting protein 10) (HIP-10) (Huntingtin-interacting protein A) (Renal carcinoma antigen NY-REN-6) | EBI-24368824 | 0.56 |
| P15622 | Zinc finger protein 250 (Zinc finger protein 647) | EBI-24368717 | 0.56 |
| Q9BU76 | Multiple myeloma tumor-associated protein 2 (hMMTAG2) | EBI-24369460 | 0.56 |
| Q9BUI4 | DNA-directed RNA polymerase III subunit RPC3 (RNA polymerase III subunit C3) (DNA-directed RNA polymerase III subunit C) (RNA polymerase III 62 kDa subunit) (RPC62) | EBI-24478617 | 0.56 |
| O75487 | Glypican-4 (K-glypican) [Cleaved into: Secreted glypican-4] | EBI-24478788 | 0.56 |
| Q86YS7 | C2 domain-containing protein 5 (C2 domain-containing phosphoprotein of 138 kDa) | EBI-24479316 | 0.56 |
| Q9HC98 | Serine/threonine-protein kinase Nek6 (EC 2.7.11.1) (Never in mitosis A-related kinase 6) (NimA-related protein kinase 6) (Protein kinase SID6-1512) | EBI-24481182 | 0.56 |
| Q15014 | Mortality factor 4-like protein 2 (MORF-related gene X protein) (Protein MSL3-2) (Transcription factor-like protein MRGX) | EBI-24482268 | 0.56 |
| Q8TAU3 | Zinc finger protein 417 | EBI-24483381 | 0.56 |
| P00540 | Proto-oncogene serine/threonine-protein kinase mos (EC 2.7.11.1) (Oocyte maturation factor mos) (Proto-oncogene c-Mos) | EBI-24484736 | 0.56 |
| P61289 | Proteasome activator complex subunit 3 (11S regulator complex subunit gamma) (REG-gamma) (Activator of multicatalytic protease subunit 3) (Ki nuclear autoantigen) (Proteasome activator 28 subunit gamma) (PA28g) (PA28gamma) | EBI-24485685 | 0.56 |
| O43296 | Zinc finger protein 264 | EBI-24486434 | 0.56 |
| Q9H9D4 | Zinc finger protein 408 (PR domain zinc finger protein 17) | EBI-24487140 | 0.56 |
| O60437 | Periplakin (190 kDa paraneoplastic pemphigus antigen) (195 kDa cornified envelope precursor protein) | EBI-24486864 | 0.56 |
| P08579 | U2 small nuclear ribonucleoprotein B'' (U2 snRNP B'') | EBI-24487243 | 0.56 |
| P25786 | Proteasome subunit alpha type-1 (30 kDa prosomal protein) (PROS-30) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome component C2) (Proteasome nu chain) | EBI-24489535 | 0.56 |
| Q8NHY3 | GAS2-like protein 2 (GAS2-related protein on chromosome 17) (Growth arrest-specific protein 2-like 2) | EBI-24489781 | 0.56 |
| Q6FHY5 | MEOX2 protein | EBI-24490101 | 0.56 |
| Q7L590 | Protein MCM10 homolog (HsMCM10) | EBI-24491037 | 0.56 |
| O75564 | Jerky protein homolog | EBI-24492868 | 0.56 |
| Q96MH2 | Protein HEXIM2 (Hexamethylene bis-acetamide-inducible protein 2) | EBI-24493184 | 0.56 |
| Q6ZN18 | Zinc finger protein AEBP2 (Adipocyte enhancer-binding protein 2) (AE-binding protein 2) | EBI-24493171 | 0.56 |
| Q96GE4 | Centrosomal protein of 95 kDa (Cep95) (Coiled-coil domain-containing protein 45) | EBI-24496817 | 0.56 |
| P26196 | Probable ATP-dependent RNA helicase DDX6 (EC 3.6.4.13) (ATP-dependent RNA helicase p54) (DEAD box protein 6) (Oncogene RCK) | EBI-24497555 | 0.56 |
| Q96DX7 | Tripartite motif-containing protein 44 (Protein DIPB) | EBI-24499846 | 0.56 |
| Q29RF7 | Sister chromatid cohesion protein PDS5 homolog A (Cell proliferation-inducing gene 54 protein) (Sister chromatid cohesion protein 112) (SCC-112) | EBI-24499780 | 0.56 |
| Q9UJD0 | Regulating synaptic membrane exocytosis protein 3 (Nim3) (RIM3 gamma) (Rab-3-interacting molecule 3) (RIM 3) | EBI-24502869 | 0.56 |
| Q12905 | Interleukin enhancer-binding factor 2 (Nuclear factor of activated T-cells 45 kDa) | EBI-24504771 | 0.56 |
| Q969T4 | Ubiquitin-conjugating enzyme E2 E3 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme E3) (UbcH9) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (Ubiquitin-protein ligase E3) | EBI-24505369 | 0.56 |
| Q9BTE7 | DCN1-like protein 5 (DCNL5) (DCUN1 domain-containing protein 5) (Defective in cullin neddylation protein 1-like protein 5) (Squamous cell carcinoma-related oncogene 5) | EBI-24505977 | 0.56 |
| Q02363 | DNA-binding protein inhibitor ID-2 (Class B basic helix-loop-helix protein 26) (bHLHb26) (Inhibitor of DNA binding 2) (Inhibitor of differentiation 2) | EBI-24512109 | 0.56 |
| Q9BYU1 | Pre-B-cell leukemia transcription factor 4 (Homeobox protein PBX4) | EBI-24516770 | 0.56 |
| Q9NQ48 | Leucine zipper transcription factor-like protein 1 | EBI-24395147 | 0.56 |
| Q9UII2 | ATPase inhibitor, mitochondrial (ATP synthase F1 subunit epsilon) (Inhibitor of F(1)F(o)-ATPase) (IF(1)) (IF1) | EBI-24530813 | 0.56 |
| Q8IZU1 | Protein FAM9A | EBI-24607193 | 0.56 |
| Q13322 | Growth factor receptor-bound protein 10 (GRB10 adapter protein) (Insulin receptor-binding protein Grb-IR) | EBI-24618876 | 0.56 |
| O14613 | Cdc42 effector protein 2 (Binder of Rho GTPases 1) | EBI-24622916 | 0.56 |
| P17021 | Zinc finger protein 17 (Zinc finger protein HPF3) (Zinc finger protein KOX10) | EBI-24369822 | 0.56 |
| P25800 | Rhombotin-1 (Cysteine-rich protein TTG-1) (LIM domain only protein 1) (LMO-1) (T-cell translocation protein 1) | EBI-24371855 | 0.56 |
| Q9NUL5 | Shiftless antiviral inhibitor of ribosomal frameshifting protein (SFL) (SHFL) (Interferon-regulated antiviral protein) (IRAV) (Repressor of yield of DENV protein) (RyDEN) | EBI-24372255 | 0.56 |
| Q15041 | ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL-6-interacting protein 1) (Aip-1) (Apoptotic regulator in the membrane of the endoplasmic reticulum) | EBI-24372801 | 0.56 |
| Q5VV52 | Zinc finger protein 691 | EBI-24373417 | 0.56 |
| Q8IVW4 | Cyclin-dependent kinase-like 3 (EC 2.7.11.22) (Serine/threonine-protein kinase NKIAMRE) | EBI-24373579 | 0.56 |
| P29084 | Transcription initiation factor IIE subunit beta (TFIIE-beta) (General transcription factor IIE subunit 2) | EBI-24374306 | 0.56 |
| Q9UKT7 | F-box/LRR-repeat protein 3 (F-box and leucine-rich repeat protein 3A) (F-box/LRR-repeat protein 3A) | EBI-24376141 | 0.56 |
| P67936 | Tropomyosin alpha-4 chain (TM30p1) (Tropomyosin-4) | EBI-24377202 | 0.56 |
| P30086 | Phosphatidylethanolamine-binding protein 1 (PEBP-1) (HCNPpp) (Neuropolypeptide h3) (Prostatic-binding protein) (Raf kinase inhibitor protein) (RKIP) [Cleaved into: Hippocampal cholinergic neurostimulating peptide (HCNP)] | EBI-24377450 | 0.56 |
| Q9P291 | Armadillo repeat-containing X-linked protein 1 (ARM protein lost in epithelial cancers on chromosome X 1) (Protein ALEX1) | EBI-24377941 | 0.56 |
| Q9UJV3 | Probable E3 ubiquitin-protein ligase MID2 (EC 2.3.2.27) (Midin-2) (Midline defect 2) (Midline-2) (RING finger protein 60) (RING-type E3 ubiquitin transferase MID2) (Tripartite motif-containing protein 1) | EBI-24378214 | 0.56 |
| O15371 | Eukaryotic translation initiation factor 3 subunit D (eIF3d) (Eukaryotic translation initiation factor 3 subunit 7) (eIF-3-zeta) (eIF3 p66) | EBI-24378913 | 0.56 |
| Q9NR46 | Endophilin-B2 (SH3 domain-containing GRB2-like protein B2) | EBI-24379419 | 0.56 |
| Q86YV0 | RAS protein activator like-3 | EBI-24379784 | 0.56 |
| P08397 | Porphobilinogen deaminase (PBG-D) (EC 2.5.1.61) (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) | EBI-24380711 | 0.56 |
| Q6IPR3 | tRNA wybutosine-synthesizing protein 3 homolog (tRNA-yW-synthesizing protein 3) (EC 2.1.1.282) (tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase) | EBI-24380890 | 0.56 |
| Q719H9 | BTB/POZ domain-containing protein KCTD1 (Potassium channel tetramerization domain-containing protein 1) | EBI-24381244 | 0.56 |
| Q96LK0 | Centrosomal protein of 19 kDa (Cep19) | EBI-24382692 | 0.56 |
| Q9NU19 | TBC1 domain family member 22B | EBI-24384246 | 0.56 |
| O76064 | E3 ubiquitin-protein ligase RNF8 (hRNF8) (EC 2.3.2.27) (RING finger protein 8) (RING-type E3 ubiquitin transferase RNF8) | EBI-24384325 | 0.56 |
| Q86XF7 | Zinc finger protein 575 | EBI-24384959 | 0.56 |
| Q92785 | Zinc finger protein ubi-d4 (Apoptosis response zinc finger protein) (BRG1-associated factor 45D) (BAF45D) (D4, zinc and double PHD fingers family 2) (Protein requiem) | EBI-24386803 | 0.56 |
| P51946 | Cyclin-H (MO15-associated protein) (p34) (p37) | EBI-24387020 | 0.56 |
| Q8IVT4 | Hypothetical MGC50722 | EBI-24388553 | 0.56 |
| Q9BV20 | Methylthioribose-1-phosphate isomerase (M1Pi) (MTR-1-P isomerase) (EC 5.3.1.23) (Mediator of RhoA-dependent invasion) (S-methyl-5-thioribose-1-phosphate isomerase) (Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein) | EBI-24389069 | 0.56 |
| Q8IYX8 | Centrosomal protein CEP57L1 (Centrosomal protein 57kDa-like protein 1) (Centrosomal protein of 57 kDa-related protein) (Cep57R) (Cep57-related protein) | EBI-24389157 | 0.56 |
| Q6NT76 | Homeobox-containing protein 1 (Homeobox telomere-binding protein 1) (Telomere-associated homeobox-containing protein 1) | EBI-24389102 | 0.56 |
| Q8TBE0 | Bromo adjacent homology domain-containing 1 protein (BAH domain-containing protein 1) | EBI-24389462 | 0.56 |
| P63241 | Eukaryotic translation initiation factor 5A-1 (eIF-5A-1) (eIF-5A1) (Eukaryotic initiation factor 5A isoform 1) (eIF-5A) (Rev-binding factor) (eIF-4D) | EBI-24390128 | 0.56 |
| Q15102 | Platelet-activating factor acetylhydrolase IB subunit alpha1 (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH subunit gamma) (PAFAH subunit gamma) | EBI-24390311 | 0.56 |
| Q5MJ10 | Sperm protein associated with the nucleus on the X chromosome N2 (Nuclear-associated protein SPAN-Xn2) (SPANX-N2) (SPANX family member N2) | EBI-24391549 | 0.56 |
| Q2TBE0 | CWF19-like protein 2 | EBI-24392096 | 0.56 |
| Q9GZM8 | Nuclear distribution protein nudE-like 1 (Protein Nudel) (Mitosin-associated protein 1) | EBI-24393020 | 0.56 |
| Q5T7W7 | Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (Rhodanese domain-containing protein 2) | EBI-24394814 | 0.56 |
| Q9BPY8 | Homeodomain-only protein (Lung cancer-associated Y protein) (Not expressed in choriocarcinoma protein 1) (Odd homeobox protein 1) | EBI-24394561 | 0.56 |
| O43167 | Zinc finger and BTB domain-containing protein 24 (Zinc finger protein 450) | EBI-24395737 | 0.56 |
| Q9H7E9 | UPF0488 protein C8orf33 | EBI-24396085 | 0.56 |
| Q6ZSB9 | Zinc finger and BTB domain-containing protein 49 (Zinc finger protein 509) | EBI-24396546 | 0.56 |
| O15078 | Centrosomal protein of 290 kDa (Cep290) (Bardet-Biedl syndrome 14 protein) (Cancer/testis antigen 87) (CT87) (Nephrocystin-6) (Tumor antigen se2-2) | EBI-24396419 | 0.56 |
| Q96GM5 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (60 kDa BRG-1/Brm-associated factor subunit A) (BRG1-associated factor 60A) (BAF60A) (SWI/SNF complex 60 kDa subunit) | EBI-24397745 | 0.56 |
| Q9NTM9 | Copper homeostasis protein cutC homolog | EBI-24398287 | 0.56 |
| O43159 | Ribosomal RNA-processing protein 8 (EC 2.1.1.-) (Cerebral protein 1) (Nucleomethylin) | EBI-24399822 | 0.56 |
| Q9NW75 | G patch domain-containing protein 2 | EBI-24400845 | 0.67 |
| Q6IQ23 | Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7) | EBI-24401489 | 0.56 |
| Q49AN0 | Cryptochrome-2 | EBI-24401410 | 0.56 |
| Q9UPY8 | Microtubule-associated protein RP/EB family member 3 (EB1 protein family member 3) (EBF3) (End-binding protein 3) (EB3) (RP3) | EBI-24401669 | 0.56 |
| P45984 | Mitogen-activated protein kinase 9 (MAP kinase 9) (MAPK 9) (EC 2.7.11.24) (JNK-55) (Stress-activated protein kinase 1a) (SAPK1a) (Stress-activated protein kinase JNK2) (c-Jun N-terminal kinase 2) | EBI-24403198 | 0.56 |
| Q13214 | Semaphorin-3B (Sema A(V)) (Semaphorin-V) (Sema V) | EBI-24403974 | 0.56 |
| Q70IA8 | MOB kinase activator 3C (Mob1 homolog 2C) (Mps one binder kinase activator-like 2C) | EBI-24404275 | 0.56 |
| Q86YD7 | Protein FAM90A1 | EBI-24404691 | 0.56 |
| O60941 | Dystrobrevin beta (DTN-B) (Beta-dystrobrevin) | EBI-24405462 | 0.56 |
| Q15631 | Translin (EC 3.1.-.-) (Component 3 of promoter of RISC) (C3PO) | EBI-24406696 | 0.56 |
| Q8TBB0 | THAP domain-containing protein 6 | EBI-24407185 | 0.56 |
| Q92551 | Inositol hexakisphosphate kinase 1 (InsP6 kinase 1) (EC 2.7.4.21) (Inositol hexaphosphate kinase 1) | EBI-24408028 | 0.56 |
| Q14005 | Pro-interleukin-16 [Cleaved into: Interleukin-16 (IL-16) (Lymphocyte chemoattractant factor) (LCF)] | EBI-24408787 | 0.56 |
| Q9H257 | Caspase recruitment domain-containing protein 9 (hCARD9) | EBI-24409408 | 0.56 |
| Q96IQ9 | Zinc finger protein 414 | EBI-24411745 | 0.56 |
| Q04864 | Proto-oncogene c-Rel | EBI-24413327 | 0.56 |
| Q96CD0 | F-box/LRR-repeat protein 8 (F-box and leucine-rich repeat protein 8) (F-box protein FBL8) | EBI-24413904 | 0.56 |
| Q68D86 | Coiled-coil domain-containing protein 102B | EBI-24413834 | 0.56 |
| Q96GN5 | Cell division cycle-associated 7-like protein (Protein JPO2) (Transcription factor RAM2) | EBI-24414466 | 0.56 |
| P28702 | Retinoic acid receptor RXR-beta (Nuclear receptor subfamily 2 group B member 2) (Retinoid X receptor beta) | EBI-24414850 | 0.56 |
| P56524 | Histone deacetylase 4 (HD4) (EC 3.5.1.98) | EBI-24415246 | 0.56 |
| Q9H788 | SH2 domain-containing protein 4A (Protein SH(2)A) (Protein phosphatase 1 regulatory subunit 38) | EBI-24415751 | 0.56 |
| P19784 | Casein kinase II subunit alpha' (CK II alpha') (EC 2.7.11.1) | EBI-24416093 | 0.56 |
| O95696 | Bromodomain-containing protein 1 (BR140-like protein) (Bromodomain and PHD finger-containing protein 2) | EBI-25260284 | 0.56 |
| P26367 | Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) | EBI-25260785 | 0.56 |
| P59910 | DnaJ homolog subfamily B member 13 (Testis and spermatogenesis cell-related protein 6) (Testis spermatocyte apoptosis-related gene 6 protein) (Testis spermatogenesis apoptosis-related gene 3 protein) (Testis spermatogenesis apoptosis-related gene 6 protein) | EBI-25260844 | 0.56 |
| O96006 | E3 SUMO-protein ligase ZBED1 (EC 2.3.2.-) (DNA replication-related element-binding factor) (Putative Ac-like transposable element) (Zinc finger BED domain-containing protein 1) (dREF homolog) | EBI-25261606 | 0.56 |
| Q96FN4 | Copine-2 (Copine II) | EBI-25261540 | 0.56 |
| O14530 | Thioredoxin domain-containing protein 9 (ATP-binding protein associated with cell differentiation) (Protein 1-4) | EBI-25262634 | 0.56 |
| Q3MJ62 | Zinc finger and SCAN domain-containing protein 23 (Zinc finger protein 390) (Zinc finger protein 453) | EBI-25263054 | 0.56 |
| Q8N8B7 | Transcription elongation factor A N-terminal and central domain-containing protein (TFIIS central domain-containing protein 1) | EBI-25263780 | 0.56 |
| Q13541 | Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I) | EBI-24416710 | 0.56 |
| Q3B820 | Protein FAM161A | EBI-24416662 | 0.56 |
| O43320 | Fibroblast growth factor 16 (FGF-16) | EBI-24417591 | 0.56 |
| Q8N6N6 | Protein NATD1 (N-acetyltransferase domain-containing protein 1) | EBI-24418647 | 0.56 |
| Q9UBB9 | Tuftelin-interacting protein 11 (Septin and tuftelin-interacting protein 1) (STIP-1) | EBI-24420579 | 0.56 |
| Q9BWG6 | Sodium channel modifier 1 | EBI-24422624 | 0.56 |
| Q9UHV2 | SERTA domain-containing protein 1 (CDK4-binding protein p34SEI1) (SEI-1) (p34(SEI-1)) (Transcriptional regulator interacting with the PHD-bromodomain 1) (TRIP-Br1) | EBI-24422762 | 0.56 |
| Q9GZT3 | SRA stem-loop-interacting RNA-binding protein, mitochondrial | EBI-24423161 | 0.56 |
| Q9NR81 | Rho guanine nucleotide exchange factor 3 (Exchange factor found in platelets and leukemic and neuronal tissues) (XPLN) | EBI-24423597 | 0.56 |
| Q96NC0 | Zinc finger matrin-type protein 2 | EBI-24425015 | 0.56 |
| Q9HBH7 | Protein BEX1 (Brain-expressed X-linked protein 1) | EBI-24425308 | 0.56 |
| Q53S33 | BolA-like protein 3 | EBI-24425720 | 0.56 |
| O75344 | Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (Inactive PPIase FKBP6) (36 kDa FK506-binding protein) (36 kDa FKBP) (FKBP-36) (FK506-binding protein 6) (FKBP-6) (Immunophilin FKBP36) | EBI-24425856 | 0.56 |
| Q8TAE8 | Growth arrest and DNA damage-inducible proteins-interacting protein 1 (39S ribosomal protein L59, mitochondrial) (MRP-L59) (CKII beta-associating protein) (CR6-interacting factor 1) (CRIF1) (Mitochondrial large ribosomal subunit protein mL64) (Papillomavirus L2-interacting nuclear protein 1) (PLINP) (PLINP-1) (p53-responsive gene 6 protein) | EBI-24426925 | 0.56 |
| O15481 | Melanoma-associated antigen B4 (MAGE-B4 antigen) | EBI-24428439 | 0.56 |
| Q9H609 | Zinc finger protein 576 | EBI-24428748 | 0.56 |
| O00463 | TNF receptor-associated factor 5 (RING finger protein 84) | EBI-24430288 | 0.56 |
| P11532 | Dystrophin | EBI-24430507 | 0.56 |
| O00488 | Zinc finger protein 593 (Zinc finger protein T86) | EBI-24430913 | 0.56 |
| Q9NQZ2 | Something about silencing protein 10 (Charged amino acid-rich leucine zipper 1) (CRL1) (Disrupter of silencing SAS10) (UTP3 homolog) | EBI-24431310 | 0.56 |
| A8MXD5 | Glutaredoxin domain-containing cysteine-rich protein 1 | EBI-24431411 | 0.56 |
| P41223 | Protein BUD31 homolog (Protein EDG-2) (Protein G10 homolog) | EBI-24432260 | 0.56 |
| Q9UFW8 | CGG triplet repeat-binding protein 1 (CGG-binding protein 1) (20 kDa CGG-binding protein) (p20-CGGBP DNA-binding protein) | EBI-24432238 | 0.56 |
| Q8N954 | G patch domain-containing protein 11 (Coiled-coil domain-containing protein 75) | EBI-24432937 | 0.56 |
| Q4G0R1 | PIBF1 protein | EBI-24434657 | 0.56 |
| P19544 | Wilms tumor protein (WT33) | EBI-24435564 | 0.56 |
| P38919 | Eukaryotic initiation factor 4A-III (eIF-4A-III) (eIF4A-III) (EC 3.6.4.13) (ATP-dependent RNA helicase DDX48) (ATP-dependent RNA helicase eIF4A-3) (DEAD box protein 48) (Eukaryotic initiation factor 4A-like NUK-34) (Eukaryotic translation initiation factor 4A isoform 3) (Nuclear matrix protein 265) (NMP 265) (hNMP 265) [Cleaved into: Eukaryotic initiation factor 4A-III, N-terminally processed] | EBI-24435989 | 0.56 |
| P51451 | Tyrosine-protein kinase Blk (EC 2.7.10.2) (B lymphocyte kinase) (p55-Blk) | EBI-24437371 | 0.56 |
| Q9NRX1 | RNA-binding protein PNO1 (Partner of NOB1) | EBI-24437947 | 0.56 |
| Q8NBZ0 | INO80 complex subunit E (Coiled-coil domain-containing protein 95) | EBI-24438358 | 0.56 |
| Q8NHQ9 | ATP-dependent RNA helicase DDX55 (EC 3.6.4.13) (DEAD box protein 55) | EBI-24438211 | 0.56 |
| Q96JC9 | ELL-associated factor 1 | EBI-24439310 | 0.56 |
| Q5XKK7 | Protein FAM219B | EBI-24439630 | 0.56 |
| P56270 | Myc-associated zinc finger protein (MAZI) (Pur-1) (Purine-binding transcription factor) (Serum amyloid A-activating factor-1) (SAF-1) (Transcription factor Zif87) (ZF87) (Zinc finger protein 801) | EBI-24440260 | 0.56 |
| Q9HAT0 | Ropporin-1A (Cancer/testis antigen 91) (CT91) (Rhophilin-associated protein 1A) | EBI-24441340 | 0.56 |
| O43805 | Microtubule nucleation factor SSNA1 (Nuclear autoantigen of 14 kDa) (Sjoegren syndrome nuclear autoantigen 1) | EBI-24442839 | 0.56 |
| Q9NP66 | High mobility group protein 20A (HMG box-containing protein 20A) (HMG domain-containing protein 1) (HMG domain-containing protein HMGX1) | EBI-24443445 | 0.56 |
| Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | EBI-24446534 | 0.56 |
| Q9BRG1 | Vacuolar protein-sorting-associated protein 25 (hVps25) (Dermal papilla-derived protein 9) (ELL-associated protein of 20 kDa) (ESCRT-II complex subunit VPS25) | EBI-24447109 | 0.56 |
| B7ZLI8 | Serine/threonine kinase 19 (Serine/threonine-protein kinase 19) | EBI-24447554 | 0.56 |
| Q13671 | Ras and Rab interactor 1 (Ras inhibitor JC99) (Ras interaction/interference protein 1) | EBI-24447914 | 0.56 |
| Q96HR9 | Receptor expression-enhancing protein 6 (Polyposis locus protein 1-like 1) | EBI-24448669 | 0.56 |
| Q14919 | Dr1-associated corepressor (Dr1-associated protein 1) (Negative cofactor 2-alpha) (NC2-alpha) | EBI-24449156 | 0.56 |
| Q9BUL9 | Ribonuclease P protein subunit p25 (RNase P protein subunit p25) | EBI-24450780 | 0.56 |
| Q9P0N9 | TBC1 domain family member 7 (Cell migration-inducing protein 23) | EBI-24450912 | 0.56 |
| Q9H0I2 | Enkurin domain-containing protein 1 | EBI-24451265 | 0.56 |
| Q9Y530 | ADP-ribose glycohydrolase OARD1 (O-acetyl-ADP-ribose deacetylase 1) (EC 3.5.1.-) (Terminal ADP-ribose protein glycohydrolase 1) ([Protein ADP-ribosylglutamate] hydrolase OARD1) (EC 3.2.2.-) | EBI-24452827 | 0.56 |
| Q15560 | Transcription elongation factor A protein 2 (Testis-specific S-II) (Transcription elongation factor S-II protein 2) (Transcription elongation factor TFIIS.l) | EBI-24454204 | 0.56 |
| Q03933 | Heat shock factor protein 2 (HSF 2) (Heat shock transcription factor 2) (HSTF 2) | EBI-24456616 | 0.56 |
| Q7L775 | EPM2A-interacting protein 1 (Laforin-interacting protein) | EBI-24460252 | 0.56 |
| Q5SQQ9 | Ventral anterior homeobox 1 | EBI-24460787 | 0.56 |
| Q9Y3S2 | Zinc finger protein 330 (Nucleolar autoantigen 36) (Nucleolar cysteine-rich protein) | EBI-24462021 | 0.56 |
| Q6UWP7 | Lysocardiolipin acyltransferase 1 (EC 2.3.1.-) (1-acylglycerol-3-phosphate O-acyltransferase 8) (1-AGP acyltransferase 8) (1-AGPAT 8) (EC 2.3.1.51) (Acyl-CoA:lysocardiolipin acyltransferase 1) | EBI-24461920 | 0.56 |
| P48775 | Tryptophan 2,3-dioxygenase (TDO) (EC 1.13.11.11) (Tryptamin 2,3-dioxygenase) (Tryptophan oxygenase) (TO) (TRPO) (Tryptophan pyrrolase) (Tryptophanase) | EBI-24463913 | 0.56 |
| Q14565 | Meiotic recombination protein DMC1/LIM15 homolog | EBI-24463865 | 0.56 |
| P20719 | Homeobox protein Hox-A5 (Homeobox protein Hox-1C) | EBI-24464716 | 0.56 |
| Q9BT49 | THAP domain-containing protein 7 | EBI-24465323 | 0.56 |
| Q86UD4 | Zinc finger protein 329 | EBI-24465290 | 0.56 |
| Q8IXL7 | Methionine-R-sulfoxide reductase B3 (MsrB3) (EC 1.8.4.12) (EC 1.8.4.14) | EBI-24466095 | 0.56 |
| O14737 | Programmed cell death protein 5 (TF-1 cell apoptosis-related protein 19) (Protein TFAR19) | EBI-24467314 | 0.56 |
| Q5JTD7 | Leucine-rich repeat-containing protein 73 | EBI-24468020 | 0.56 |
| O95201 | Zinc finger protein 205 (Zinc finger protein 210) | EBI-24469813 | 0.56 |
| Q9Y5A6 | Zinc finger and SCAN domain-containing protein 21 (Renal carcinoma antigen NY-REN-21) (Zinc finger protein 38 homolog) (Zfp-38) | EBI-24470493 | 0.56 |
| Q4VC44 | FLYWCH-type zinc finger-containing protein 1 | EBI-24470388 | 0.56 |
| Q15735 | Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A (EC 3.1.3.56) (Inositol polyphosphate 5-phosphatase J) | EBI-24470900 | 0.56 |
| Q9UBU8 | Mortality factor 4-like protein 1 (MORF-related gene 15 protein) (Protein MSL3-1) (Transcription factor-like protein MRG15) | EBI-24471970 | 0.56 |
| Q8IZ69 | tRNA (uracil-5-)-methyltransferase homolog A (EC 2.1.1.35) (mRNA (uracil-5-)-methyltransferase TRMT2A) (EC 2.1.1.-) | EBI-24473683 | 0.56 |
| Q15287 | RNA-binding protein with serine-rich domain 1 (SR-related protein LDC2) | EBI-24473661 | 0.56 |
| Q8IYA8 | Interactor of HORMAD1 protein 1 (Cancer/testis antigen 74) (CT74) (Coiled-coil domain-containing protein 36) | EBI-24475631 | 0.56 |
| Q9H1K6 | Talin rod domain-containing protein 1 (Mesoderm development candidate 1) | EBI-24476134 | 0.56 |
| Q9UBL6 | Copine-7 (Copine VII) | EBI-24477247 | 0.56 |
| Q86Y79 | Probable peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | EBI-24477236 | 0.56 |
| P80188 | Neutrophil gelatinase-associated lipocalin (NGAL) (25 kDa alpha-2-microglobulin-related subunit of MMP-9) (Lipocalin-2) (Oncogene 24p3) (Siderocalin) (p25) | EBI-24533066 | 0.56 |
| Q6QNY1 | Biogenesis of lysosome-related organelles complex 1 subunit 2 (BLOC-1 subunit 2) (Centrosome-associated protein) | EBI-24535192 | 0.56 |
| P48443 | Retinoic acid receptor RXR-gamma (Nuclear receptor subfamily 2 group B member 3) (Retinoid X receptor gamma) | EBI-24539056 | 0.56 |
| O14519 | Cyclin-dependent kinase 2-associated protein 1 (CDK2-associated protein 1) (Deleted in oral cancer 1) (DOC-1) (Putative oral cancer suppressor) | EBI-24546970 | 0.56 |
| Q9H0C1 | Zinc finger MYND domain-containing protein 12 | EBI-24564635 | 0.56 |
| Q5T686 | Arginine vasopressin-induced protein 1 (AVP-induced protein 1) | EBI-24574195 | 0.56 |
| Q8N7C3 | Probable E3 ubiquitin-protein ligase TRIML2 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIML2) (SPRY domain-containing protein 6) (Tripartite motif family-like protein 2) | EBI-24578447 | 0.56 |
| Q6PF05 | Tetratricopeptide repeat protein 23-like | EBI-24582383 | 0.56 |
| Q96BT7 | Alkylated DNA repair protein alkB homolog 8 (Probable alpha-ketoglutarate-dependent dioxygenase ABH8) (S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8) (tRNA (carboxymethyluridine(34)-5-O)-methyltransferase ABH8) (EC 2.1.1.229) | EBI-24593875 | 0.56 |
| Q6NTE8 | MRN complex-interacting protein (MRN-interacting protein) | EBI-24637325 | 0.56 |
| P16444 | Dipeptidase 1 (EC 3.4.13.19) (Beta-lactamase) (EC 3.5.2.6) (Dehydropeptidase-I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP) | EBI-21514808 | 0.35 |
| Q92692 | Nectin-2 (Herpes virus entry mediator B) (Herpesvirus entry mediator B) (HveB) (Nectin cell adhesion molecule 2) (Poliovirus receptor-related protein 2) (CD antigen CD112) | EBI-21519718 | 0.35 |
| Q13563 | Polycystin-2 (PC2) (Autosomal dominant polycystic kidney disease type II protein) (Polycystic kidney disease 2 protein) (Polycystwin) (R48321) (Transient receptor potential cation channel subfamily P member 2) | EBI-21519718 | 0.35 |
| P52799 | Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L) | EBI-21519718 | 0.35 |
| Q9Y697 | Cysteine desulfurase, mitochondrial (EC 2.8.1.7) | EBI-21519718 | 0.35 |
| Q9Y624 | Junctional adhesion molecule A (JAM-A) (Junctional adhesion molecule 1) (JAM-1) (Platelet F11 receptor) (Platelet adhesion molecule 1) (PAM-1) (CD antigen CD321) | EBI-21519718 | 0.35 |
| Q9Y613 | FH1/FH2 domain-containing protein 1 (Formin homolog overexpressed in spleen 1) (FHOS) (Formin homology 2 domain-containing protein 1) | EBI-21519718 | 0.35 |
| Q9UL01 | Dermatan-sulfate epimerase (DS epimerase) (EC 5.1.3.19) (Chondroitin-glucuronate 5-epimerase) (Squamous cell carcinoma antigen recognized by T-cells 2) (SART-2) | EBI-21519718 | 0.35 |
| Q9UGV2 | Protein NDRG3 (N-myc downstream-regulated gene 3 protein) | EBI-21519718 | 0.35 |
| Q9NVR0 | Kelch-like protein 11 | EBI-21519718 | 0.35 |
| Q9NQY0 | Bridging integrator 3 | EBI-21519718 | 0.35 |
| Q9C073 | Protein FAM117A (C/EBP-induced protein) | EBI-21519718 | 0.35 |
| Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | EBI-21519718 | 0.55 |
| Q8NDH6 | Islet cell autoantigen 1-like protein (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 14 protein) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein) | EBI-21519718 | 0.35 |
| Q86WK6 | Amphoterin-induced protein 1 (AMIGO-1) (Alivin-2) | EBI-21519718 | 0.35 |
| Q86U70 | LIM domain-binding protein 1 (LDB-1) (Carboxyl-terminal LIM domain-binding protein 2) (CLIM-2) (LIM domain-binding factor CLIM2) (hLdb1) (Nuclear LIM interactor) | EBI-21519718 | 0.35 |
| Q7RTV5 | Peroxiredoxin-like 2C (AhpC/TSA antioxidant enzyme domain-containing protein 1) (Thioredoxin-like protein AAED1) | EBI-21519718 | 0.35 |
| Q3T906 | N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (EC 2.7.8.17) (GlcNAc-1-phosphotransferase subunits alpha/beta) (Stealth protein GNPTAB) (UDP-N-acetylglucosamine-1-phosphotransferase subunits alpha/beta) [Cleaved into: N-acetylglucosamine-1-phosphotransferase subunit alpha; N-acetylglucosamine-1-phosphotransferase subunit beta] | EBI-21519718 | 0.35 |
| Q15904 | V-type proton ATPase subunit S1 (V-ATPase subunit S1) (Protein XAP-3) (V-ATPase Ac45 subunit) (V-ATPase S1 accessory protein) (Vacuolar proton pump subunit S1) | EBI-21519718 | 0.35 |
| Q15375 | Ephrin type-A receptor 7 (EC 2.7.10.1) (EPH homology kinase 3) (EHK-3) (EPH-like kinase 11) (EK11) (hEK11) | EBI-21519718 | 0.35 |
| Q05084 | Islet cell autoantigen 1 (69 kDa islet cell autoantigen) (ICA69) (Islet cell autoantigen p69) (ICAp69) (p69) | EBI-21519718 | 0.35 |
| P98196 | Phospholipid-transporting ATPase IH (EC 7.6.2.1) (ATPase IS) (ATPase class VI type 11A) (P4-ATPase flippase complex alpha subunit ATP11A) | EBI-21519718 | 0.35 |
| P98172 | Ephrin-B1 (EFL-3) (ELK ligand) (ELK-L) (EPH-related receptor tyrosine kinase ligand 2) (LERK-2) [Cleaved into: Ephrin-B1 C-terminal fragment (Ephrin-B1 CTF); Ephrin-B1 intracellular domain (Ephrin-B1 ICD)] | EBI-21519718 | 0.35 |
| P53367 | Arfaptin-1 (ADP-ribosylation factor-interacting protein 1) | EBI-21519718 | 0.35 |
| P23229 | Integrin alpha-6 (CD49 antigen-like family member F) (VLA-6) (CD antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain; Integrin alpha-6 light chain; Processed integrin alpha-6 (Alpha6p)] | EBI-21519718 | 0.35 |
| P17028 | Zinc finger protein 24 (Retinoic acid suppression protein A) (RSG-A) (Zinc finger and SCAN domain-containing protein 3) (Zinc finger protein 191) (Zinc finger protein KOX17) | EBI-21519718 | 0.35 |
| A1L0T0 | 2-hydroxyacyl-CoA lyase 2 (EC 4.1.2.-) (Acetolactate synthase-like protein) (IlvB-like protein) | EBI-21519718 | 0.35 |
| Q02833 | Ras association domain-containing protein 7 (HRAS1-related cluster protein 1) | EBI-21525884 | 0.35 |
| Q8TDR4 | T-complex protein 10A homolog 1 (T-complex protein 10A-1) (TCP10A-1) (TCP10-like) | EBI-21617027 | 0.35 |
| P43355 | Melanoma-associated antigen 1 (Antigen MZ2-E) (Cancer/testis antigen 1.1) (CT1.1) (MAGE-1 antigen) | EBI-21634905 | 0.35 |
| O75787 | Renin receptor (ATPase H(+)-transporting lysosomal accessory protein 2) (ATPase H(+)-transporting lysosomal-interacting protein 2) (ER-localized type I transmembrane adapter) (Embryonic liver differentiation factor 10) (N14F) (Renin/prorenin receptor) (Vacuolar ATP synthase membrane sector-associated protein M8-9) (ATP6M8-9) (V-ATPase M8.9 subunit) [Cleaved into: Renin receptor N-terminal fragment; Renin receptor C-terminal fragment] | EBI-21856696 | 0.35 |
| Q92844 | TRAF family member-associated NF-kappa-B activator (TRAF-interacting protein) (I-TRAF) | EBI-20737201 | 0.35 |
| Q99996 | A-kinase anchor protein 9 (AKAP-9) (A-kinase anchor protein 350 kDa) (AKAP 350) (hgAKAP 350) (A-kinase anchor protein 450 kDa) (AKAP 450) (AKAP 120-like protein) (Centrosome- and Golgi-localized PKN-associated protein) (CG-NAP) (Protein hyperion) (Protein kinase A-anchoring protein 9) (PRKA9) (Protein yotiao) | EBI-21369499 | 0.00 |
| P07196 | Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein) | EBI-21380808 | 0.00 |
| P08621 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | EBI-21387006 | 0.00 |
| Q01082 | Spectrin beta chain, non-erythrocytic 1 (Beta-II spectrin) (Fodrin beta chain) (Spectrin, non-erythroid beta chain 1) | EBI-21387372 | 0.00 |
| P82094 | TATA element modulatory factor (TMF) (Androgen receptor coactivator 160 kDa protein) (Androgen receptor-associated protein of 160 kDa) | EBI-21387842 | 0.00 |
| B5ME19 | Eukaryotic translation initiation factor 3 subunit C-like protein | EBI-21388090 | 0.00 |
| Q8TDR0 | TRAF3-interacting protein 1 (Interleukin-13 receptor alpha 1-binding protein 1) (Intraflagellar transport protein 54 homolog) (Microtubule-interacting protein associated with TRAF3) (MIP-T3) | EBI-21392320 | 0.00 |
| P42858 | Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment] | EBI-25962458 | 0.56 |
| Q96QS3 | Homeobox protein ARX (Aristaless-related homeobox) | EBI-26508337 | 0.51 |
| P26358 | DNA (cytosine-5)-methyltransferase 1 (Dnmt1) (EC 2.1.1.37) (CXXC-type zinc finger protein 9) (DNA methyltransferase HsaI) (DNA MTase HsaI) (M.HsaI) (MCMT) | EBI-26508381 | 0.51 |
| Q13936 | Voltage-dependent L-type calcium channel subunit alpha-1C (Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle) (Voltage-gated calcium channel subunit alpha Cav1.2) | EBI-26508359 | 0.51 |
| P60484 | Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (EC 3.1.3.16) (EC 3.1.3.48) (EC 3.1.3.67) (Mutated in multiple advanced cancers 1) (Phosphatase and tensin homolog) | EBI-26508587 | 0.51 |
| Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2) | EBI-26508663 | 0.51 |
| P49815 | Tuberin (Tuberous sclerosis 2 protein) | EBI-26508755 | 0.51 |
| Q92574 | Hamartin (Tuberous sclerosis 1 protein) | EBI-26508735 | 0.51 |
| P51531 | Probable global transcription activator SNF2L2 (EC 3.6.4.-) (ATP-dependent helicase SMARCA2) (BRG1-associated factor 190B) (BAF190B) (Protein brahma homolog) (hBRM) (SNF2-alpha) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2) | EBI-26508695 | 0.51 |
| P78352 | Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90) | EBI-26509348 | 0.37 |
| P51116 | RNA-binding protein FXR2 (FMR1 autosomal homolog 2) | EBI-26512077 | 0.37 |
| Q9NZ94 | Neuroligin-3 (Gliotactin homolog) | EBI-26513344 | 0.37 |
| Q7TLC7 | Uncharacterized protein 14 | EBI-26377368 | 0.35 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27108918 | 0.35 |
Database | Links |
| UNIPROT | Q9NRD5 B3KS52 O95906 |
| PDB | 2GZV 6AR4 6BJN 6BJO |
| Pfam | PF06456 PF00595 |
| PROSITE | PS50870 PS50106 |
| OMIM | 605926 |
| DisGeNET | 9463 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory