Protein Information |
|
|---|---|
| Protein Name | Plasminogen activator inhibitor 1 RNA-binding protein |
| Accession Code | Q8NC51 |
| Gene | SERBP1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 408) | |
|
MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQKDRKN PLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEKPLEEKGEGGEFSVDRPIIDR PIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQK QISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWK KGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDD PEAFPALA |
|
Structure Viewer (PDB: 6Z6M) |
|---|
Description |
||
|---|---|---|
| Cytoplasm {Experimental EvidencePubMed:12505151, Experimental EvidencePubMed:28695742}. Nucleus {Experimental EvidencePubMed:12505151, Experimental EvidencePubMed:28695742}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:12505151}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Membrane (GO:0016020) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) |
|
Description |
|
|---|---|
| May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay. Seems to play a role in PML-nuclear bodies formation (PubMed:28695742). {Experimental EvidencePubMed:11001948, Experimental EvidencePubMed:28695742}. | Assigned Ontology terms |
| Biological Process | PML Body Organization (GO:0030578) Regulation Of MRNA Stability (GO:0043488) |
| Molecular Function | Cadherin Binding (GO:0045296) MRNA 3'-UTR Binding (GO:0003730) Ribosome Binding (GO:0043022) RNA Binding (GO:0003723) SUMO Binding (GO:0032183) |
Interactions with Nuclear Envelope proteins (6 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| A0A142I5B9 | RNA-directed RNA polymerase NS5 | EBI-20625330 | 0.35 |
| P0DTD1 | 2'-O-methyltransferase nsp16 | EBI-25509548 | 0.35 |
| Q8NC51 | Self | EBI-10486506 | 0.37 |
| Q9NRD5 | PRKCA-binding protein | EBI-24463602 | 0.56 |
| Q06787 | Fragile X messenger ribonucleoprotein 1 | EBI-8844408 | 0.35 |
| Q9NZI8 | Insulin-like growth factor 2 mRNA-binding protein 1 | EBI-13949271 | 0.35 | Interactions with other proteins (99 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q12873 | Chromodomain-helicase-DNA-binding protein 3 (CHD-3) (EC 3.6.4.12) (ATP-dependent helicase CHD3) (Mi-2 autoantigen 240 kDa protein) (Mi2-alpha) (Zinc finger helicase) (hZFH) | EBI-523588 | 0.58 |
| Q53HC9 | EARP and GARP complex-interacting protein 1 (Endosome-associated recycling protein-interacting protein) (Golgi-associated retrograde protein-interacting protein) (Tumor-suppressing STF cDNA 1 protein) (Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein) | EBI-1064285 | 0.00 |
| P62330 | ADP-ribosylation factor 6 (EC 3.6.5.2) | EBI-1068138 | 0.00 |
| Q15654 | Thyroid receptor-interacting protein 6 (TR-interacting protein 6) (TRIP-6) (Opa-interacting protein 1) (OIP-1) (Zyxin-related protein 1) (ZRP-1) | EBI-1069923 | 0.00 |
| P01889 | HLA class I histocompatibility antigen, B alpha chain (Human leukocyte antigen B) (HLA-B) | EBI-1076169 | 0.00 |
| Q14164 | Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i) | EBI-1079918 | 0.00 |
| O75815 | Breast cancer anti-estrogen resistance protein 3 (Novel SH2-containing protein 2) (SH2 domain-containing protein 3B) | EBI-1080874 | 0.00 |
| O94817 | Ubiquitin-like protein ATG12 (Autophagy-related protein 12) (APG12-like) | EBI-1085290 | 0.00 |
| P32121 | Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3) | EBI-1642567 | 0.35 |
| Q00005 | Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PP2A subunit B isoform B55-beta) (PP2A subunit B isoform PR55-beta) (PP2A subunit B isoform R2-beta) (PP2A subunit B isoform beta) | EBI-2211497 | 0.35 |
| Q8AZK7 | Epstein-Barr nuclear antigen leader protein (EBNA-LP) (EBV nuclear antigen leader protein) (Epstein-Barr nuclear antigen 5) (EBNA-5) (EBV nuclear antigen 5) | EBI-9632715 | 0.35 |
| O15264 | Mitogen-activated protein kinase 13 (MAP kinase 13) (MAPK 13) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) (Stress-activated protein kinase 4) | EBI-2255044 | 0.35 |
| P52735 | Guanine nucleotide exchange factor VAV2 (VAV-2) | EBI-2654400 | 0.00 |
| P01100 | Protein c-Fos (Cellular oncogene fos) (Fos proto-oncogene, AP-1 transcription factor subunit) (G0/G1 switch regulatory protein 7) (Proto-oncogene c-Fos) (Transcription factor AP-1 subunit c-Fos) | EBI-2679744 | 0.00 |
| P14921 | Protein C-ets-1 (p54) | EBI-2680135 | 0.00 |
| A0A6L8PVV9 | Group-specific protein | EBI-2828099 | 0.00 |
| A0A5P8YLY5 | Nitrite reductase (EC 1.7.1.4) | EBI-2861962 | 0.00 |
| Q92731 | Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2) | EBI-2880601 | 0.35 |
| Q9H492 | Microtubule-associated proteins 1A/1B light chain 3A (Autophagy-related protein LC3 A) (Autophagy-related ubiquitin-like modifier LC3 A) (MAP1 light chain 3-like protein 1) (MAP1A/MAP1B light chain 3 A) (MAP1A/MAP1B LC3 A) (Microtubule-associated protein 1 light chain 3 alpha) | EBI-3044058 | 0.35 |
| Q9GZQ8 | Microtubule-associated proteins 1A/1B light chain 3B (Autophagy-related protein LC3 B) (Autophagy-related ubiquitin-like modifier LC3 B) (MAP1 light chain 3-like protein 2) (MAP1A/MAP1B light chain 3 B) (MAP1A/MAP1B LC3 B) (Microtubule-associated protein 1 light chain 3 beta) | EBI-3045543 | 0.35 |
| P60520 | Gamma-aminobutyric acid receptor-associated protein-like 2 (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16) (MAP1 light chain 3-related protein) | EBI-3046676 | 0.35 |
| Q9H0R8 | Gamma-aminobutyric acid receptor-associated protein-like 1 (Early estrogen-regulated protein) (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1) | EBI-3048562 | 0.35 |
| O95166 | Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) (MM46) | EBI-3050465 | 0.35 |
| Q8TB96 | T-cell immunomodulatory protein (Protein TIP) (Integrin-alpha FG-GAP repeat-containing protein 1) (Linkin) | EBI-7383128 | 0.37 |
| P68400 | Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1) | EBI-5322101 | 0.44 |
| Q0HD54 | Non-structural protein 1 (NS1) (NS1A) | EBI-6155110 | 0.35 |
| Q77M19 | V protein | EBI-6270503 | 0.35 |
| Q86VP6 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-21322532 | 0.35 |
| Q13616 | Cullin-1 (CUL-1) | EBI-21323857 | 0.35 |
| Q15843 | NEDD8 (Neddylin) (Neural precursor cell expressed developmentally down-regulated protein 8) (NEDD-8) (Ubiquitin-like protein Nedd8) | EBI-21328206 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| Q9NR22 | Protein arginine N-methyltransferase 8 (EC 2.1.1.319) (Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4) | EBI-8481541 | 0.37 |
| O35182 | Mothers against decapentaplegic homolog 6 (MAD homolog 6) (Mothers against DPP homolog 6) (Mad homolog 7) (SMAD family member 6) (SMAD 6) (Smad6) | EBI-8456591 | 0.35 |
| Q4VGL6 | Roquin-1 (Roquin) (EC 2.3.2.27) (Protein Sanroque) (RING finger and C3H zinc finger protein 1) (RING finger and CCCH-type zinc finger domain-containing protein 1) | EBI-8759371 | 0.35 |
| P0C090 | Roquin-2 (EC 2.3.2.27) (Membrane-associated nucleic acid-binding protein) (RING finger and CCCH-type zinc finger domain-containing protein 2) (RING-type E3 ubiquitin transferase Roquin-2) | EBI-8759987 | 0.35 |
| Q99873 | Protein arginine N-methyltransferase 1 (EC 2.1.1.319) (Histone-arginine N-methyltransferase PRMT1) (Interferon receptor 1-bound protein 4) | EBI-8844279 | 0.35 |
| P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed] | EBI-8844279 | 0.43 |
| Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | EBI-8844325 | 0.35 |
| P51116 | RNA-binding protein FXR2 (FMR1 autosomal homolog 2) | EBI-8844325 | 0.35 |
| P19338 | Nucleolin (Protein C23) | EBI-8845229 | 0.27 |
| P31483 | Cytotoxic granule associated RNA binding protein TIA1 (Nucleolysin TIA-1 isoform p40) (RNA-binding protein TIA-1) (T-cell-restricted intracellular antigen-1) (TIA-1) (p40-TIA-1) | EBI-8844366 | 0.27 |
| P67809 | Y-box-binding protein 1 (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor) | EBI-8853354 | 0.50 |
| Q16666 | Gamma-interferon-inducible protein 16 (Ifi-16) (Interferon-inducible myeloid differentiation transcriptional activator) | EBI-9995438 | 0.35 |
| P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11323169 | 0.35 |
| P03182 | Apoptosis regulator BHRF1 (Early antigen protein R) (EA-R) (Nuclear antigen) | EBI-11721938 | 0.35 |
| Q6ZWV7 | 60S ribosomal protein L35 | EBI-10997876 | 0.35 |
| P23116 | Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Centrosomin) (Eukaryotic translation initiation factor 3 subunit 10) (eIF-3-theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (p162) | EBI-11020127 | 0.35 |
| Q9D287 | Pre-mRNA-splicing factor SPF27 (Breast carcinoma-amplified sequence 2 homolog) (DNA amplified in mammary carcinoma 1 protein) | EBI-11022935 | 0.35 |
| P27635 | 60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM) | EBI-11035646 | 0.35 |
| Q99PL5 | Ribosome-binding protein 1 (Ribosome receptor protein) (RRp) (mRRp) | EBI-11066888 | 0.35 |
| Q00839 | Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (GRIP120) (Nuclear p120 ribonucleoprotein) (Scaffold-attachment factor A) (SAF-A) (p120) (pp120) | EBI-11088773 | 0.35 |
| P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | EBI-11145880 | 0.35 |
| P19712 | Genome polyprotein [Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C (Core protein); E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3 (NS2-3); Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)] | EBI-10901232 | 0.35 |
| Q15813 | Tubulin-specific chaperone E (Tubulin-folding cofactor E) | EBI-21887754 | 0.40 |
| Q9BTM9 | Ubiquitin-related modifier 1 | EBI-15902832 | 0.35 |
| Q6ZNJ1 | Neurobeachin-like protein 2 | EBI-16749633 | 0.35 |
| P09622 | Dihydrolipoyl dehydrogenase, mitochondrial (EC 1.8.1.4) (Dihydrolipoamide dehydrogenase) (Glycine cleavage system L protein) | EBI-20304669 | 0.35 |
| O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | EBI-20305770 | 0.35 |
| Q99497 | Parkinson disease protein 7 (Maillard deglycase) (Oncogene DJ1) (Parkinsonism-associated deglycase) (Protein DJ-1) (DJ-1) (Protein/nucleic acid deglycase DJ-1) (EC 3.1.2.-, EC 3.5.1.-, EC 3.5.1.124) | EBI-20306366 | 0.35 |
| Q99714 | 3-hydroxyacyl-CoA dehydrogenase type-2 (EC 1.1.1.35) (17-beta-estradiol 17-dehydrogenase) (EC 1.1.1.62) (2-methyl-3-hydroxybutyryl-CoA dehydrogenase) (MHBD) (3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+))) (EC 1.1.1.239) (3-hydroxy-2-methylbutyryl-CoA dehydrogenase) (EC 1.1.1.178) (3-hydroxyacyl-CoA dehydrogenase type II) (3alpha(or 20beta)-hydroxysteroid dehydrogenase) (EC 1.1.1.53) (7-alpha-hydroxysteroid dehydrogenase) (EC 1.1.1.159) (Endoplasmic reticulum-associated amyloid beta-peptide-binding protein) (Mitochondrial ribonuclease P protein 2) (Mitochondrial RNase P protein 2) (Short chain dehydrogenase/reductase family 5C member 1) (Short-chain type dehydrogenase/reductase XH98G2) (Type II HADH) | EBI-20306067 | 0.35 |
| P08559 | Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I) | EBI-20306509 | 0.35 |
| P31040 | Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (EC 1.3.5.1) (Flavoprotein subunit of complex II) (Fp) | EBI-20306992 | 0.35 |
| P35610 | Sterol O-acyltransferase 1 (EC 2.3.1.26) (Acyl-coenzyme A:cholesterol acyltransferase 1) (ACAT-1) (Cholesterol acyltransferase 1) | EBI-20307233 | 0.35 |
| Q9HCE5 | N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14) | EBI-20595531 | 0.35 |
| P52298 | Nuclear cap-binding protein subunit 2 (20 kDa nuclear cap-binding protein) (Cell proliferation-inducing gene 55 protein) (NCBP 20 kDa subunit) (CBP20) (NCBP-interacting protein 1) (NIP1) | EBI-20623424 | 0.35 |
| P51957 | Serine/threonine-protein kinase Nek4 (EC 2.7.11.1) (Never in mitosis A-related kinase 4) (NimA-related protein kinase 4) (Serine/threonine-protein kinase 2) (Serine/threonine-protein kinase NRK2) | EBI-20721387 | 0.35 |
| P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | EBI-20798291 | 0.35 |
| P05067 | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] | EBI-20821761 | 0.35 |
| Q969X2 | Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 (EC 2.4.99.-) (GalNAc alpha-2,6-sialyltransferase VI) (ST6GalNAc VI) (ST6GalNAcVI) (hST6GalNAc VI) (Sialyltransferase 7F) (SIAT7-F) | EBI-20903424 | 0.40 |
| P30622 | CAP-Gly domain-containing linker protein 1 (Cytoplasmic linker protein 1) (Cytoplasmic linker protein 170 alpha-2) (CLIP-170) (Reed-Sternberg intermediate filament-associated protein) (Restin) | EBI-20908792 | 0.40 |
| P15918 | V(D)J recombination-activating protein 1 (RAG-1) (RING finger protein 74) [Includes: Endonuclease RAG1 (EC 3.1.-.-); E3 ubiquitin-protein ligase RAG1 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase RAG1)] | EBI-20921596 | 0.40 |
| P46783 | 40S ribosomal protein S10 (Small ribosomal subunit protein eS10) | EBI-20931200 | 0.40 |
| Q5VT25 | Serine/threonine-protein kinase MRCK alpha (EC 2.7.11.1) (CDC42-binding protein kinase alpha) (DMPK-like alpha) (Myotonic dystrophy kinase-related CDC42-binding kinase alpha) (MRCK alpha) (Myotonic dystrophy protein kinase-like alpha) | EBI-20938284 | 0.40 |
| A2A935 | Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1) | EBI-21022882 | 0.35 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| O96013 | Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4) | EBI-26962273 | 0.35 |
| P61981 | 14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed] | EBI-26966879 | 0.35 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-21360986 | 0.35 |
| F5H7Q8 | MHC class I polypeptide-related sequence B | EBI-21261537 | 0.35 |
| O95183 | Vesicle-associated membrane protein 5 (VAMP-5) (Myobrevin) | EBI-21267749 | 0.35 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-21301141 | 0.35 |
| P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-25416349 | 0.35 |
| Q16828 | Dual specificity protein phosphatase 6 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase PYST1) (Mitogen-activated protein kinase phosphatase 3) (MAP kinase phosphatase 3) (MKP-3) | EBI-25377680 | 0.35 |
| P06241 | Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn) | EBI-25385167 | 0.35 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| P41229 | Lysine-specific demethylase 5C (EC 1.14.11.67) (Histone demethylase JARID1C) (Jumonji/ARID domain-containing protein 1C) (Protein SmcX) (Protein Xe169) ([histone H3]-trimethyl-L-lysine(4) demethylase 5C) | EBI-25480257 | 0.35 |
| P69479 | Phosphoprotein (Protein P) (Protein M1) | EBI-25568051 | 0.35 |
| Q8NHP6 | Motile sperm domain-containing protein 2 | EBI-25617558 | 0.35 |
| P50454 | Serpin H1 (47 kDa heat shock protein) (Arsenic-transactivated protein 3) (AsTP3) (Cell proliferation-inducing gene 14 protein) (Collagen-binding protein) (Colligin) (Rheumatoid arthritis-related antigen RA-A47) | EBI-25836558 | 0.56 |
| P16284 | Platelet endothelial cell adhesion molecule (PECAM-1) (EndoCAM) (GPIIA') (PECA1) (CD antigen CD31) | EBI-25881385 | 0.56 |
| P37173 | TGF-beta receptor type-2 (TGFR-2) (EC 2.7.11.30) (TGF-beta type II receptor) (Transforming growth factor-beta receptor type II) (TGF-beta receptor type II) (TbetaR-II) | EBI-25892860 | 0.56 |
| Q09161 | Nuclear cap-binding protein subunit 1 (80 kDa nuclear cap-binding protein) (CBP80) (NCBP 80 kDa subunit) | EBI-26396507 | 0.35 |
| P14240 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (Large structural protein) (Replicase) (Transcriptase) [Includes: cap-snatching endonuclease (EC 3.1.-.-)] | EBI-26968430 | 0.35 |
| Q99608 | Necdin | EBI-26955247 | 0.27 |
| P0DTC9 | Nucleoprotein (N) (Nucleocapsid protein) (NC) (Protein N) | EBI-26994159 | 0.35 |
| Q13363 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) | EBI-27044482 | 0.35 |
| F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27108918 | 0.35 |
| Q99592 | Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171) | EBI-27093179 | 0.35 |
Database | Links |
| UNIPROT | Q8NC51 Q5VU19 Q5VU20 Q5VU22 Q8WUH0 Q96SE2 Q9BTY3 Q9BUM4 Q9Y367 Q9Y4S3 |
| PDB | 4V6X 6Z6M 6Z6N |
| Pfam | PF04774 PF16174 |
| OMIM | 607378 |
| DisGeNET | 26135 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory