Protein translocation protein SEC63 - Saccharomyces cerevisiae S288C

Protein translocation protein SEC63 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Protein translocation protein SEC63
Accession Code	P14906
Gene	SEC63
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 663)
MPTNYEYDEASETWPSFILTGLLMVVGPMTLLQIYQIFFGANAEDGNSGKSKEFNEEVFKNLNEEYTSDEIKQFRRKFDK NSNKKSKIWSRRNIIIIVGWILVAILLQRINSNDAIKDAATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKG LTPDEKSVMEETYVQITKAYESLTDELVRQNYLKYGHPDGPQSTSHGIALPRFLVDGSASPLLVVCYVALLGLILPYFVS RWWARTQSYTKKGIHNVTASNFVSNLVNYKPSEIVTTDLILHWLSFAHEFKQFFPDLQPTDFEKLLQDHINRRDSGKLNN AKFRIVAKCHSLLHGLLDIACGFRNLDIALGAINTFKCIVQAVPLTPNCQILQLPNVDKEHFITKTGDIHTLGKLFTLED AKIGEVLGIKDQAKLNETLRVASHIPNLKIIKADFLVPGENQVTPSSTPYISLKVLVRSAKQPLIPTSLIPEENLTEPQD FESQRDPFAMMSKQPLVPYSFAPFFPTKRRGSWCCLVSSQKDGKILQTPIIIEKLSYKNLNDDKDFFDKRIKMDLTKHEK FDINDWEIGTIKIPLGQPAPETVGDFFFRVIVKSTDYFTTDLDITMNMKVRDSPAVEQVEVYSEEDDEYSTDDDETESDD ESDASDYTDIDTDTEAEDDESPE

Structure Viewer (PDB: 7KAH)

Subcellular Location

Description
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein. Nucleus inner membrane; Multi-pass membrane protein.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Inner Membrane	SL-0179	The inner membrane of the nucleus is the membrane which separates the nuclear matrix from the intermembrane space. In mammals, the inner nuclear membrane is associated with heterochromatin and the nuclear lamina.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Endoplasmic Reticulum (GO:0005783) Mitochondrion (GO:0005739) Nuclear Inner Membrane (GO:0005637) Rough Endoplasmic Reticulum Membrane (GO:0030867) Sec62/Sec63 Complex (GO:0031207) Translocon Complex (GO:0071256)

Biology & Function

Description
Acts as component of the Sec62/63 complex which is involved in SRP-independent post-translational translocation across the endoplasmic reticulum (ER) and functions together with the Sec61 complex and KAR2 in a channel-forming translocon complex. A cycle of assembly and disassembly of Sec62/63 complex from SEC61 may govern the activity of the translocon. SEC63 may affect SEC1-polypeptide interactions by increasing the affinity of targeting pathways for SEC61 and/or by modifying SEC61 to allow more efficient polypeptide interaction. May also be involved in SRP-dependent cotranslational translocation. Is essential for cell growth and for germination. {Experimental EvidencePubMed:11226176}.
Assigned Ontology terms

Biological Process	Cytosol To Endoplasmic Reticulum Transport (GO:0046967) Post-Translational Protein Targeting To Endoplasmic Reticulum Membrane (GO:0006620) Post-Translational Protein Targeting To Membrane, Translocation (GO:0031204) SRP-Dependent Cotranslational Protein Targeting To Membrane (GO:0006614)
Molecular Function	Protein Transmembrane Transporter Activity (GO:0008320)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P30822	Exportin-1	EBI-3665470	0.35
Q02455	Protein MLP1	EBI-3769967	0.35
P40457	Protein MLP2	EBI-3769975	0.35
Interactions with other proteins (154 interactors)

Partner (UniProt)		IntAct	Confidence score
P30605	Myo-inositol transporter 1	EBI-7743571	0.37
P39742	Translocation protein SEC72 (Sec62/63 complex 23 kDa subunit) (p23)	EBI-7750338	0.83
P04817	Arginine permease CAN1 (Canavanine resistance protein 1)	EBI-7750372	0.37
P33754	Translocation protein SEC66 (Protein HSS1) (Sec62/63 complex 31.5 kDa subunit)	EBI-7750388	0.83
P40073	High osmolarity signaling protein SHO1 (Osmosensor SHO1) (Suppressor of SUA8-1 mutation) (Synthetic high osmolarity-sensitive protein 1)	EBI-7757792	0.37
P33767	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 (Oligosaccharyl transferase subunit WBP1) (Oligosaccharyl transferase subunit beta)	EBI-7757893	0.37
P16151	Protein ERD1	EBI-7758032	0.37
P25621	Pantothenate transporter FEN2 (Fenpropimorph resistance protein 2)	EBI-7758150	0.37
P38353	Sec sixty-one protein homolog (Ssh1 complex subunit SSH1) (Ssh1 complex subunit alpha)	EBI-7758268	0.37
P38298	Alkaline ceramidase YPC1 (EC 3.5.1.-) (Acyl-CoA-independent ceramide synthase)	EBI-7758389	0.37
P38079	Protein YRO2	EBI-7758511	0.37
P16140	V-type proton ATPase subunit B (V-ATPase subunit B) (V-ATPase 57 kDa subunit) (Vacuolar proton pump subunit B)	EBI-797191	0.35
P10592	Heat shock protein SSA2	EBI-797191	0.35
P21825	Translocation protein SEC62 (Sec62/63 complex 30 kDa subunit)	EBI-797191	0.75
P32629	Mannan polymerase II complex ANP1 subunit (M-Pol II subunit ANP1) (Aminonitrophenyl propanediol resistance protein)	EBI-819187	0.27
Q02159	Ubiquitin-conjugating enzyme E2 7 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme 7) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme E2-18 kDa) (Ubiquitin-protein ligase)	EBI-860869	0.00
P47026	GPI-anchored wall transfer protein 1 (EC 2.3.-.-)	EBI-853504	0.35
P40217	Eukaryotic translation initiation factor 3 subunit I (eIF3i) (Eukaryotic translation initiation factor 3 39 kDa subunit) (eIF-3 39 kDa subunit) (eIF3 p39)	EBI-7678715	0.56
P16474	Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein homolog) (GRP-78) (Immunoglobulin heavy chain-binding protein homolog) (BiP)	EBI-966961	0.40
P32447	Histone chaperone ASF1 (Anti-silencing function protein 1) (yASF1)	EBI-3665462	0.35
P14922	General transcriptional corepressor CYC8 (Glucose repression mediator protein CYC8)	EBI-3665478	0.35
P39704	Protein ERP2	EBI-3665486	0.35
P21268	Cyclin-dependent kinase inhibitor FAR1 (CKI FAR1) (Factor arrest protein)	EBI-3665494	0.35
P00927	Threonine dehydratase, mitochondrial (EC 4.3.1.19) (Threonine deaminase)	EBI-3665502	0.35
P50946	Putative tyrosine-protein phosphatase OCA1 (EC 3.1.3.48) (Oxidant-induced cell-cycle arrest protein 1)	EBI-3665510	0.35
Q12524	Peroxisomal coenzyme A diphosphatase 1, peroxisomal (EC 3.6.1.55)	EBI-3665518	0.35
P54885	Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (GSA dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase)	EBI-3665526	0.35
P06103	Eukaryotic translation initiation factor 3 subunit B (eIF3b) (Cell cycle regulation and translation initiation protein) (Eukaryotic translation initiation factor 3 90 kDa subunit) (eIF3 p90) (Translation initiation factor eIF3 p90 subunit)	EBI-3665534	0.35
P40016	26S proteasome regulatory subunit RPN3	EBI-3665542	0.35
Q12250	26S proteasome regulatory subunit RPN5 (Proteasome non-ATPase subunit 5)	EBI-3665550	0.35
Q05543	Regulator of Ty1 transposition protein 103	EBI-3665558	0.35
O94742	26S proteasome complex subunit SEM1	EBI-3665566	0.35
P31376	SWR1-complex protein 3	EBI-3665574	0.35
P38326	SWR1-complex protein 5	EBI-3665582	0.35
P38123	COMPASS component SWD3 (Complex proteins associated with SET1 protein SWD3) (Set1C component SWD3)	EBI-3665590	0.35
Q05471	Helicase SWR1 (EC 3.6.4.12) (Swi2/Snf2-related 1)	EBI-3665598	0.35
Q04067	Eukaryotic translation initiation factor 3 subunit G (eIF3g) (Eukaryotic translation initiation factor 3 RNA-binding subunit) (eIF-3 RNA-binding subunit) (Translation initiation factor eIF3 p33 subunit) (eIF3 p33)	EBI-3665606	0.35
Q05946	U3 small nucleolar RNA-associated protein 13 (U3 snoRNA-associated protein 13) (U three protein 13)	EBI-3665614	0.35
P34110	Vacuolar protein sorting-associated protein 35 (Vacuolar protein-targeting protein 7)	EBI-3665622	0.35
P16521	Elongation factor 3A (EF-3) (EF-3A) (EC 3.6.4.-) (Eukaryotic elongation factor 3) (eEF3) (Translation elongation factor 3A) (Yeast elongation factor 3)	EBI-3665630	0.35
P53719	Uncharacterized protein YNR014W	EBI-3665638	0.35
P53740	Probable phospholipid translocase non-catalytic subunit CRF1 (CDC50/ROS3 family protein 1) (CRF1)	EBI-3665646	0.35
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-3665654	0.35
P38788	Ribosome-associated complex subunit SSZ1 (DnaK-related protein SSZ1) (Heat shock protein 70 homolog SSZ1) (Pleiotropic drug resistance protein 13)	EBI-3665662	0.35
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-3701587	0.35
P32589	Heat shock protein homolog SSE1 (Chaperone protein MSI3)	EBI-3733411	0.35
P39079	T-complex protein 1 subunit zeta (TCP-1-zeta) (CCT-zeta)	EBI-3740483	0.35
P37898	Alanine/arginine aminopeptidase (EC 3.4.11.-)	EBI-3769653	0.35
Q12168	Endo-1,3(4)-beta-glucanase 2 (Endo-1,3-beta-glucanase 2) (Endo-1,4-beta-glucanase 2) (EC 3.2.1.6) (Laminarinase-2)	EBI-3769661	0.35
P60010	Actin (EC 3.6.4.-)	EBI-3769669	0.35
P22108	Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase 2 (Ap4A phosphorylase 2) (EC 2.7.7.53) (ADP-sulfurylase) (EC 2.7.7.5) (ATP adenylyltransferase)	EBI-3769677	0.35
P08566	Pentafunctional AROM polypeptide [Includes: 3-dehydroquinate synthase (DHQS) (EC 4.2.3.4); 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS); Shikimate kinase (SK) (EC 2.7.1.71); 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10); Shikimate dehydrogenase (EC 1.1.1.25)]	EBI-3769687	0.35
Q06834	Alcohol-sensitive RING finger protein 1	EBI-3769695	0.35
Q08347	Alkyl/aryl-sulfatase BDS1 (EC 3.1.6.-) (Bacterially-derived sulfatase 1)	EBI-3769703	0.35
Q07457	E3 ubiquitin-protein ligase BRE1 (EC 2.3.2.27) (Brefeldin A-sensitivity protein 1) (RING-type E3 ubiquitin transferase BRE1)	EBI-3769711	0.35
P00549	Pyruvate kinase 1 (PK 1) (EC 2.7.1.40) (cell division cycle protein 19)	EBI-3769719	0.35
Q12018	Cell division control protein 53 (Cullin-A) (E3 ubiquitin ligase complex SCF subunit CDC53)	EBI-3769727	0.35
Q06697	Cell division control protein 73 (RNA polymerase-associated protein CDC73)	EBI-3769735	0.35
P53197	APC/C activator protein CDH1 (CDC20 homolog 1) (Homolog of CDC twenty 1)	EBI-3769743	0.35
P40094	Conserved oligomeric Golgi complex subunit 3 (COG complex subunit 3) (Component of oligomeric Golgi complex 3) (Protein SEC34)	EBI-3769751	0.35
Q01454	DNA polymerase alpha-binding protein (Chromosome replication protein CHL15) (Chromosome transmission fidelity protein 4) (Protein POB1)	EBI-3769759	0.35
P38865	Copper transport protein CTR2 (Copper transporter 2)	EBI-3769767	0.35
P31373	Cystathionine gamma-lyase (gamma-CTLase) (EC 4.4.1.1) (Gamma-cystathionase) (Sulfur transfer protein 1)	EBI-3769775	0.35
P32582	Cystathionine beta-synthase (EC 4.2.1.22) (Beta-thionase) (Serine sulfhydrase) (Sulfur transfer protein 4)	EBI-3769783	0.35
Q08496	Protein DIA2 (Digs into agar protein 2)	EBI-3769791	0.35
P53759	tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] (EC 1.3.1.88) (mRNA-dihydrouridine synthase DUS1) (EC 1.3.1.-) (tRNA-dihydrouridine synthase 1)	EBI-3769799	0.35
Q06053	tRNA-dihydrouridine(47) synthase [NAD(P)(+)] (EC 1.3.1.89) (mRNA-dihydrouridine synthase DUS3) (EC 1.3.1.-) (tRNA-dihydrouridine synthase 3)	EBI-3769807	0.35
P38737	Proteasome component ECM29 (Extracellular mutant protein 29)	EBI-3769815	0.35
P36053	Transcription elongation factor 1	EBI-3769823	0.35
P00924	Enolase 1 (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase 1) (2-phosphoglycerate dehydratase 1)	EBI-3769831	0.35
P00925	Enolase 2 (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase 2) (2-phosphoglycerate dehydratase 2)	EBI-3769839	0.35
P45976	Pre-mRNA polyadenylation factor FIP1	EBI-3769847	0.35
P15442	eIF-2-alpha kinase GCN2 (EC 2.7.11.1) (General control non-derepressible protein 2) (Serine/threonine-protein kinase GCN2)	EBI-3769855	0.35
Q12680	Glutamate synthase [NADH] (EC 1.4.1.14) (NADH-GOGAT)	EBI-3769863	0.35
P32347	Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37)	EBI-3769871	0.35
P28241	Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial (EC 1.1.1.41) (Isocitric dehydrogenase) (NAD(+)-specific ICDH)	EBI-3769879	0.35
P53982	Isocitrate dehydrogenase [NADP] (IDH) (EC 1.1.1.42) (IDP) (NADP(+)-specific ICDH) (Oxalosuccinate decarboxylase)	EBI-3769887	0.35
P47170	Vacuolar membrane-associated protein IML1 (Increased minichromosome loss protein 1) (SEH-associated protein 1)	EBI-3769895	0.35
P32361	Serine/threonine-protein kinase/endoribonuclease IRE1 (Endoplasmic reticulum-to-nucleus signaling 1) [Includes: Serine/threonine-protein kinase (EC 2.7.11.1); Endoribonuclease (EC 3.1.26.-)]	EBI-3769903	0.35
P48526	Isoleucine--tRNA ligase, mitochondrial (EC 6.1.1.5) (Isoleucyl-tRNA synthetase) (IleRS)	EBI-3769911	0.35
P38144	ISWI chromatin-remodeling complex ATPase ISW1 (EC 3.6.4.-)	EBI-3769919	0.35
Q12494	Inositol hexakisphosphate kinase 1 (InsP6 kinase 1) (EC 2.7.4.21) (InsP6 kinase KCS1) (PKC1 suppressor protein 1)	EBI-3769927	0.35
P38853	Kelch repeat-containing protein 1	EBI-3769935	0.35
Q02574	DNA damage checkpoint control protein MEC3	EBI-3769943	0.35
P00958	Methionine--tRNA ligase, cytoplasmic (EC 6.1.1.10) (Methionyl-tRNA synthetase) (MetRS)	EBI-3769951	0.35
Q07980	DNA mismatch repair protein MLH2 (MutL protein homolog 2)	EBI-3769959	0.35
P48563	Protein MON2	EBI-3769983	0.35
P30775	Peptide chain release factor 1, mitochondrial (MRF-1) (MtRF-1)	EBI-3769991	0.35
P53166	ATP-dependent RNA helicase MRH4, mitochondrial (EC 3.6.4.13) (Mitochondrial RNA helicase 4)	EBI-3769999	0.35
Q02950	37S ribosomal protein MRP51, mitochondrial (Mitochondrial small ribosomal subunit protein bS1m)	EBI-3770007	0.35
P47047	ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4)	EBI-3770015	0.35
P19524	Myosin-2 (Cell division control protein 66) (Class V unconventional myosin MYO2) (Type V myosin heavy chain MYO2) (Myosin V MYO2)	EBI-3770023	0.35
P33420	Protein NIP100 (Protein NIP80)	EBI-3770031	0.35
Q01560	Serine/arginine (SR)-type shuttling mRNA binding protein NPL3 (Mitochondrial targeting suppressor 1 protein) (Nuclear polyadenylated RNA-binding protein 1) (Nuclear protein localization protein 3) (Polyadenylate-binding protein NPL3)	EBI-3770039	0.35
P38271	Protein OPY1 (Overproduction-induced pheromone-resistant yeast protein 1)	EBI-3770047	0.35
Q12451	Oxysterol-binding protein homolog 2 (Oxysterol-binding protein-related protein 2) (ORP 2) (OSBP-related protein 2)	EBI-3770055	0.35
P40960	WD repeat-containing protein PAC11	EBI-3770063	0.35
P17558	37S ribosomal protein PET123, mitochondrial (Mitochondrial small ribosomal subunit protein mS26)	EBI-3770071	0.35
P40433	6-phosphofructo-2-kinase 1 (6PF-2-K 1) (EC 2.7.1.105) (Phosphofructokinase 2 I)	EBI-3770079	0.35
P00560	Phosphoglycerate kinase (EC 2.7.2.3)	EBI-3770087	0.35
P36093	Putative transcription factor PHD1	EBI-3770095	0.35
P07271	ATP-dependent DNA helicase PIF1 (EC 3.6.4.12) (DNA repair and recombination helicase PIF1) (Petite integration frequency protein 1) (Telomere stability protein 1)	EBI-3770103	0.35
P33334	Pre-mRNA-splicing factor 8	EBI-3770111	0.35
P52489	Pyruvate kinase 2 (PK 2) (EC 2.7.1.40)	EBI-3770119	0.35
P38344	Cytoplasmic 60S subunit biogenesis factor REI1 (Required for isotropic bud growth protein 1) (pre-60S factor REI1)	EBI-3770127	0.35
P29539	Telomere length regulator protein RIF1 (RAP1-interacting factor 1)	EBI-3770135	0.35
P53552	THO complex subunit 2 (Low dye-binding protein 5) (THO complex subunit RLR1) (Zinc-regulated gene 13 protein)	EBI-3770143	0.35
P05748	60S ribosomal protein L15-A (L13) (Large ribosomal subunit protein eL15-A) (RP15R) (YL10) (YP18)	EBI-3770151	0.35
P54780	60S ribosomal protein L15-B (L13) (Large ribosomal subunit protein eL15-B) (RP15R) (YL10) (YP18)	EBI-3770159	0.35
P05749	60S ribosomal protein L22-A (L1c) (Large ribosomal subunit protein eL22-A) (RP4) (YL31)	EBI-3770167	0.35
Q12149	Exosome complex exonuclease RRP6 (EC 3.1.13.-) (Ribosomal RNA-processing protein 6)	EBI-3770175	0.35
Q02206	Chromatin structure-remodeling complex subunit RSC4 (RSC complex subunit RSC4) (Remodel the structure of chromatin complex subunit 4)	EBI-3770183	0.35
P40482	Protein transport protein SEC24 (Abnormal nuclear morphology 1)	EBI-3770191	0.35
P11075	Protein transport protein SEC7	EBI-3770207	0.35
P34223	UBX domain-containing protein 1 (Suppressor of high-copy PP1 protein)	EBI-3770223	0.35
Q06315	Protein SKG3 (Suppressor of lethality of KEX2-GAS1 double null mutant protein 3)	EBI-3770231	0.35
P39928	Osmosensing histidine protein kinase SLN1 (EC 2.7.13.3) (Osmolarity two-component system protein SLN1) (Tyrosine phosphatase-dependent protein 2)	EBI-3770239	0.35
P32908	Structural maintenance of chromosomes protein 1 (DA-box protein SMC1)	EBI-3770247	0.35
P25357	Probable DNA-binding protein SNT1 (SANT domain-containing protein 1)	EBI-3770255	0.35
P36126	Phospholipase D1 (PLD 1) (EC 3.1.4.4) (Choline phosphatase 1) (Meiosis-specific sporulation-specific protein 14) (Phosphatidylcholine-hydrolyzing phospholipase D1)	EBI-3770263	0.35
P25567	RNA-binding protein SRO9 (Suppressor of RHO3 protein 9)	EBI-3770271	0.35
P36085	Protein STB6	EBI-3770280	0.35
P08153	Transcriptional factor SWI5	EBI-3770288	0.35
Q06510	Tafazzin (Taz) (EC 2.3.1.-)	EBI-3770296	0.35
P00359	Glyceraldehyde-3-phosphate dehydrogenase 3 (GAPDH 3) (EC 1.2.1.12)	EBI-3770304	0.35
P02994	Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A)	EBI-3770312	0.35
P32367	Transcription factor tau 95 kDa subunit (TFIIIC 95 kDa subunit) (Transcription factor C subunit 1)	EBI-3770320	0.35
P35169	Serine/threonine-protein kinase TOR1 (EC 2.7.11.1) (Dominant rapamycin resistance protein 1) (Phosphatidylinositol kinase homolog TOR1) (Target of rapamycin kinase 1)	EBI-3770336	0.35
P40061	Target of rapamycin complex 2 subunit TSC11 (TORC2 subunit TSC11) (Adheres voraciously to TOR2 protein 3) (Temperature-sensitive CSG2 suppressor protein 11)	EBI-3770344	0.35
P53874	Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10)	EBI-3770352	0.35
P07259	Protein URA2 [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)]	EBI-3770360	0.35
P34241	Nucleolar pre-ribosomal-associated protein 1 (Unhealthy ribosome biogenesis protein 1)	EBI-3770368	0.35
Q12339	rRNA-processing protein UTP23 (U three protein 23) (U3 small nucleolar RNA-associated protein 23) (U3 snoRNA-associated protein 23)	EBI-3770376	0.35
Q06685	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase (EC 2.7.4.24) (InsP6 and PP-IP5 kinase)	EBI-3770384	0.35
P22203	V-type proton ATPase subunit E (V-ATPase subunit E) (V-ATPase 27 kDa subunit) (Vacuolar proton pump subunit E)	EBI-3770392	0.35
O13584	Putative uncharacterized protein VPS69	EBI-3770400	0.35
P33301	DNA repair protein XRS2	EBI-3770408	0.35
P19880	AP-1-like transcription factor YAP1 (Phenanthroline resistance protein PAR1) (Pleiotropic drug resistance protein PDR4)	EBI-3770416	0.35
O13527	Truncated transposon Ty1-A Gag-Pol polyprotein (TY1B) (Transposon Ty1 TYB polyprotein) [Cleaved into: Integrase (IN) (Pol-p71) (p84) (p90); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (Pol-p63) (p60)]	EBI-3770424	0.35
P87264	Putative uncharacterized protein YDR467C	EBI-3770435	0.35
P39991	Uncharacterized protein YEL025C	EBI-3770443	0.35
P38854	Topoisomerase I damage affected protein 11	EBI-3770451	0.35
P34246	Maintenance of telomere capping protein 2	EBI-3770459	0.35
Q05948	Uncharacterized SVF1-like protein YLR225C	EBI-3770467	0.35
Q06567	ABC1 family protein MCP2 (MDM10-complementing protein 2) (MIOREX complex component 13) (Mitochondrial organization of gene expression protein 13)	EBI-3770475	0.35
Q03153	ATPase synthesis protein 25, mitochondrial (OLI1 mRNA stabilization factor)	EBI-3770483	0.35
Q12751	RNA polymerase II assembly factor RTP1 (Required for nuclear transport of RNA pol II protein 1) (Transport and Golgi organization protein 6 homolog)	EBI-3770491	0.35
P42842	Essential for maintenance of the cell wall protein 1	EBI-3770499	0.35
Q12697	Vacuolar cation-transporting ATPase YPK9 (EC 7.2.2.-) (PARK9 homolog)	EBI-3770513	0.35
Q08748	Uncharacterized protein YOR296W	EBI-3770521	0.35
Q06813	Uncharacterized protein YPR078C	EBI-3770529	0.35
P36019	GTP-binding protein YPT53	EBI-3770537	0.35
P31111	Synaptonemal complex protein ZIP1	EBI-3770545	0.35
P32915	Protein transport protein SEC61 (Sec61 complex subunit SEC61) (Sec61 complex subunit alpha)	EBI-9352295	0.79

Cross-References

Database	Links
UNIPROT	P14906 D6W2V5 Q08690
PDB	6N3Q 6ND1 7AFT 7KAH 7KAI 7KAJ 7KAO 7KAP 7KAQ 7KAR 7KAS 7KAT 7KAU 7KB5
Pfam	PF00226
PROSITE	PS00636 PS50076

Protein translocation protein SEC63 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Structure Viewer (PDB: 7KAH)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Interactions with other proteins (154 interactors)

Cross-References

Database

Links

Description

Description