Protein MLP1 - Saccharomyces cerevisiae S288C

Protein MLP1 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Protein MLP1
Accession Code	Q02455
Gene	MLP1
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 1875)
MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDL TEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNNDVL KQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRLSSITDEADEDNENLSAKSSSDFIFLK KQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTI TESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRIEELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQI TRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSL RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETINDDSLRKELE KSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQ NNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKM LRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSD YEKLESEIENLKEELENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEIT TLKEEIEKQRQIQQQLQATSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLNQPSNINMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVE ERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPPKSVNNVQNPL LGLPRKIEENSNSPFNPLLSGEKLLKLNSKSSSGGFNPFTSPSPNKHLQNDNDKRESLANKTDPPTHLEPSFNIPASRGLISSSSTLSTDTNDEELTSNNPAQKDSSNRNVQSEEDTEKKKEGEPVKRGE AIEEQTKSNKRPIDEVGELKNDEDDTTENINESKKIKTEDEEEKETDKVNDENSI

Subcellular Location

Description
Nucleus {Experimental EvidencePubMed:14718167, Experimental EvidencePubMed:16027220}. Nucleus, nuclear pore complex {Experimental EvidencePubMed:24152732}. Note=Distributed fairly evenly along a C-shaped portion of the nuclear periphery, where the spindle pole body localizes in 90% of the cases. {Experimental EvidencePubMed:16027220}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Nuclear Envelope (GO:0005635) Nuclear Pore (GO:0005643) Nuclear Pore Nuclear Basket (GO:0044615) Nucleoplasm (GO:0005654)

Biology & Function

Description
Together with the closely related MLP2, involved in the structural and functional organization of perinuclear chromatin (PubMed:10638763). Together with MLP2, associates with the nuclear pore complex and form filamentous structures along the nuclear periphery (PubMed:10085285, PubMed:24152732). Has a role in the localization of Esc1 to nucleolar regions (PubMed:24152732). Together with MLP2, mediates tethering of the some telomeres to the nuclear periphery, probably mediated by YKU70/YKU80 (HDF1/HDF2) heterodimer and show perinuclear location dependent silencing (PubMed:11862215). MLP1 and MLP2 are involved in telomere length regulation but not silencing or telomere anchoring (PubMed:12490156). Recognizes the 5'-splice site of pre-mRNAs and retains unspliced pre-mRNA in the nucleus without affecting splicing itself (PubMed:12490156, PubMed:12531921, PubMed:14718167). {Experimental EvidencePubMed:10085285, Experimental EvidencePubMed:10638763, Experimental EvidencePubMed:11862215, Experimental EvidencePubMed:12490156, Experimental EvidencePubMed:12531921, Experimental EvidencePubMed:14718167, Experimental EvidencePubMed:24152732}.
Assigned Ontology terms

Biological Process	DNA Repair (GO:0006281) MRNA Export From Nucleus (GO:0006406) Negative Regulation Of Protein Import Into Nucleus During Spindle Assembly Checkpoint (GO:1901925) Nuclear MRNA Surveillance (GO:0071028) Nucleocytoplasmic Transport (GO:0006913) Poly(A)+ MRNA Export From Nucleus (GO:0016973) Protein Import Into Nucleus (GO:0006606) Protein Localization To Nuclear Pore (GO:0090204) Telomere Tethering At Nuclear Periphery (GO:0034398)
Molecular Function	MRNA Binding (GO:0003729) Promoter-Terminator Loop Anchoring Activity (GO:0140586) Ribonucleoprotein Complex Binding (GO:0043021) Structural Constituent Of Nuclear Pore (GO:0017056)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P14906	Protein translocation protein SEC63	EBI-3769967	0.35
P40457	Protein MLP2	EBI-2212926	0.40
P25491	Mitochondrial protein import protein MAS5	EBI-3765167	0.35
Interactions with other proteins (31 interactors)

Partner (UniProt)		IntAct	Confidence score
P32570	Mediator of RNA polymerase II transcription subunit 22 (Mediator complex subunit 22) (Suppressor of RNA polymerase B 6)	EBI-806450	0.35
P10592	Heat shock protein SSA2	EBI-808689	0.56
P40024	ABC transporter ATP-binding protein ARB1 (ATP-binding cassette protein involved in ribosome biogenesis 1)	EBI-816662	0.27
Q02336	Transcriptional adapter 2	EBI-820587	0.27
P23638	Proteasome subunit alpha type-3 (Macropain subunit Y13) (Multicatalytic endopeptidase complex subunit Y13) (Proteasome component Y13) (Proteinase YSCE subunit 13)	EBI-7553011	0.40
Q07622	Activator of C kinase protein 1	EBI-8225053	0.22
P32505	Nuclear polyadenylated RNA-binding protein NAB2	EBI-994908	0.58
Q01560	Serine/arginine (SR)-type shuttling mRNA binding protein NPL3 (Mitochondrial targeting suppressor 1 protein) (Nuclear polyadenylated RNA-binding protein 1) (Nuclear protein localization protein 3) (Polyadenylate-binding protein NPL3)	EBI-994992	0.40
P32491	MAP kinase kinase MKK2/SSP33 (EC 2.7.12.2)	EBI-2639782	0.40
P13186	Serine/threonine-protein kinase KIN2 (EC 2.7.11.1)	EBI-2640329	0.40
P32790	Actin cytoskeleton-regulatory complex protein SLA1	EBI-7514515	0.37
Q06677	Auxilin-like clathrin uncoating factor SWA2 (Bud site selection protein 24) (DnaJ-related protein SWA2) (J protein SWA2) (Synthetic lethal with ARF1 protein 2)	EBI-3758621	0.35
P40564	DnaJ-like protein 1 (Peroxisome assembly protein 22)	EBI-3760071	0.35
P39102	DnaJ protein homolog XDJ1	EBI-3761494	0.35
P53863	J protein JJJ1	EBI-3769389	0.35
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-3772409	0.35
P09435	Heat shock protein SSA3	EBI-3775414	0.35
P32590	Heat shock protein homolog SSE2	EBI-3776763	0.35
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-3781040	0.35
P39987	Heat shock protein SSC3, mitochondrial (Extracellular mutant protein 10)	EBI-3787826	0.35
P38788	Ribosome-associated complex subunit SSZ1 (DnaK-related protein SSZ1) (Heat shock protein 70 homolog SSZ1) (Pleiotropic drug resistance protein 13)	EBI-3790511	0.35
P40150	Ribosome-associated molecular chaperone SSB2 (EC 3.6.4.10) (Heat shock protein SSB2) (Hsp70 chaperone Ssb)	EBI-3799302	0.35
P32589	Heat shock protein homolog SSE1 (Chaperone protein MSI3)	EBI-3806004	0.35
P02829	ATP-dependent molecular chaperone HSP82 (82 kDa heat shock protein) (Heat shock protein Hsp90 heat-inducible isoform)	EBI-3812463	0.35
P39078	T-complex protein 1 subunit delta (TCP-1-delta) (CCT-delta)	EBI-3822418	0.35
P33416	Heat shock protein 78, mitochondrial	EBI-3825702	0.35
Q12329	Heat shock protein 42 (42 kDa heat shock protein)	EBI-3829128	0.35
Q04432	Glutathione-independent glyoxalase HSP31 (EC 4.2.1.130) (Glyoxalase 3 homolog 1) (Heat shock protein 31)	EBI-3830630	0.35
P22943	12 kDa heat shock protein (Glucose and lipid-regulated protein)	EBI-3831347	0.35
YGR032W		EBI-3952595	0.35
P39523	Uncharacterized protein YMR124W	EBI-9976090	0.35

Cross-References

Database	Links
UNIPROT	Q02455 D6VXF5
Pfam	PF07926
PROSITE	PS51450

Protein MLP1 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Interactions with other proteins (31 interactors)

Cross-References

Database

Links

Description

Description