Protein Information |
|
|---|---|
| Protein Name | Exocyst complex component 3 |
| Accession Code | O60645 |
| Gene | EXOC3 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 745) | |
|
MKETDREAVATAVQRVAGMLQRPDQLDKVEQYRRREARKKASVEARLKAAIQSQLDGVRTGLSQLHNALNDVKDIQQSLADVSKDWRQSINTIESLKDVKDAVVQHSQLAAAVENLKNIFSVPEIVRETQ DLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMVLQRSLVTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFTILERTVTTRI EGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCFPPHYEIFKNLLNMYHQALSTRMQDLASEDLEANEIVSLLTWVLNTYTSTEMMRNVELAPEVDVGTLEPLLSPHVVSELLDTYMSTLTSN IIAWLRKALETDKKDWVKETEPEADQDGYYQTTLPAIVFQMFEQNLQVAAQISEDLKTKVLVLCLQQMNSFLSRYKDEAQLYKEEHLRNRQHPHCYVQYMIAIINNCQTFKESIVSLKRKYLKNEVEEGV SPSQPSMDGILDAIAKEGCSGLLEEVFLDLEQHLNELMTKKWLLGSNAVDIICVTVEDYFNDFAKIKKPYKKRMTAEAHRRVVVEYLRAVMQKRISFRSPEERKEGAEKMVREAEQLRFLFRKLASGFGE DVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK |
|
Description |
||
|---|---|---|
| Cytoplasm {By SimilarityUniProtKB:O54921}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:O54921}. Cell projection, growth cone {By SimilarityUniProtKB:O54921}. Midbody {Experimental EvidencePubMed:18756269}. Golgi apparatus {ECO:0000305|PubMed:18756269}. Cell projection, neuron projection {ECO:0000250|UniProtKB:Q62825}. Note=Perinuclear in undifferentiated cells. Redistributes to growing neurites and growth cones during neuronal differentiation (By similarity). During mitosis, early recruitment to the midbody requires RALA, but not RALB, and EXOC2. In late stages of cytokinesis, localization to the midbody is RALB- dependent (PubMed:18756269). {By SimilarityUniProtKB:O54921, Experimental EvidencePubMed:18756269}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytosol (GO:0005829) Exocyst (GO:0000145) Golgi Apparatus (GO:0005794) Growth Cone (GO:0030426) Midbody (GO:0030496) Perinuclear Region Of Cytoplasm (GO:0048471) Presynaptic Membrane (GO:0042734) Secretory Granule Membrane (GO:0030667) |
|
Description |
|
|---|---|
| Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane. | Assigned Ontology terms |
| Biological Process | Exocyst Localization (GO:0051601) Exocytosis (GO:0006887) Membrane Fission (GO:0090148) Mitotic Cytokinesis (GO:0000281) Protein Transport (GO:0015031) Vesicle Docking Involved In Exocytosis (GO:0006904) Vesicle Tethering Involved In Exocytosis (GO:0090522) |
| Molecular Function | Cadherin Binding (GO:0045296) SNARE Binding (GO:0000149) |
Interactions with Nuclear Envelope proteins (5 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| A1L4K1 | Fibronectin type III and SPRY domain-containing protein 2 | EBI-25258050 | 0.56 |
| Q8IYI6 | Exocyst complex component 8 | EBI-21672932 | 0.51 |
| Q8TAG9 | Exocyst complex component 6 | EBI-21673041 | 0.51 |
| P00533 | Epidermal growth factor receptor | EBI-10764491 | 0.40 |
| Q9NV70 | Exocyst complex component 1 | EBI-12449995 | 0.51 | Interactions with other proteins (49 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | EBI-1074529 | 0.00 |
| O88738 | Baculoviral IAP repeat-containing protein 6 (EC 2.3.2.27) (BIR repeat-containing ubiquitin-conjugating enzyme) (BRUCE) (RING-type E3 ubiquitin transferase BIRC6) (Ubiquitin-conjugating BIR domain enzyme apollon) (APOLLON) | EBI-1765706 | 0.35 |
| Q8BHD1 | POC1 centriolar protein homolog B (WD repeat-containing protein 51B) | EBI-2557128 | 0.40 |
| A0A2U2H1F8 | Putative DedA-family membrane protein | EBI-2870328 | 0.00 |
| Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | EBI-7950968 | 0.35 |
| P40692 | DNA mismatch repair protein Mlh1 (MutL protein homolog 1) | EBI-2932395 | 0.37 |
| O43684 | Mitotic checkpoint protein BUB3 | EBI-3916000 | 0.37 |
| Q86VI4 | Lysosomal-associated transmembrane protein 4B (Lysosome-associated transmembrane protein 4-beta) | EBI-10764290 | 0.40 |
| Q8CAQ8 | MICOS complex subunit Mic60 (Mitochondrial inner membrane protein) (Mitofilin) | EBI-11096643 | 0.35 |
| Q9HBH9 | MAP kinase-interacting serine/threonine-protein kinase 2 (EC 2.7.11.1) (MAP kinase signal-integrating kinase 2) (MAPK signal-integrating kinase 2) (Mnk2) | EBI-11139967 | 0.35 |
| O00139 | Kinesin-like protein KIF2A (Kinesin-2) (hK2) | EBI-11140263 | 0.35 |
| Q9Z172 | Small ubiquitin-related modifier 3 (SUMO-3) (SMT3 homolog 1) (Ubiquitin-like protein SMT3A) (Smt3A) | EBI-11157923 | 0.35 |
| Q86X19 | Transmembrane protein 17 | EBI-11372615 | 0.27 |
| Q96KP1 | Exocyst complex component 2 (Exocyst complex component Sec5) | EBI-12450028 | 0.64 |
| Q9UPT5 | Exocyst complex component 7 (Exocyst complex component Exo70) | EBI-12450043 | 0.51 |
| Q13445 | Transmembrane emp24 domain-containing protein 1 (Interleukin-1 receptor-like 1 ligand) (Putative T1/ST2 receptor-binding protein) (p24 family protein gamma-1) (Tp24) (p24gamma1) | EBI-12450043 | 0.51 |
| Q96A65 | Exocyst complex component 4 (Exocyst complex component Sec8) | EBI-12450043 | 0.64 |
| O00471 | Exocyst complex component 5 (Exocyst complex component Sec10) (hSec10) | EBI-12450093 | 0.64 |
| Q9BZL4 | Protein phosphatase 1 regulatory subunit 12C (Protein phosphatase 1 myosin-binding subunit of 85 kDa) (Protein phosphatase 1 myosin-binding subunit p85) | EBI-24371831 | 0.56 |
| Q96IK5 | Germ cell-less protein-like 1 (Spermatogenesis-associated protein 29) | EBI-24472724 | 0.56 |
| Q13049 | E3 ubiquitin-protein ligase TRIM32 (EC 2.3.2.27) (72 kDa Tat-interacting protein) (RING-type E3 ubiquitin transferase TRIM32) (Tripartite motif-containing protein 32) (Zinc finger protein HT2A) | EBI-11902318 | 0.00 |
| P11234 | Ras-related protein Ral-B (EC 3.6.5.2) | EBI-11902309 | 0.00 |
| O75386 | Tubby-related protein 3 (Tubby-like protein 3) | EBI-11902300 | 0.00 |
| Q9Y2D4 | Exocyst complex component 6B (Exocyst complex component Sec15B) (SEC15-like protein 2) | EBI-21672799 | 0.35 |
| P35613 | Basigin (5F7) (Collagenase stimulatory factor) (Extracellular matrix metalloproteinase inducer) (EMMPRIN) (Hepatoma-associated antigen) (HAb18G) (Leukocyte activation antigen M6) (OK blood group antigen) (Tumor cell-derived collagenase stimulatory factor) (TCSF) (CD antigen CD147) | EBI-21560440 | 0.35 |
| P34741 | Syndecan-2 (SYND2) (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (CD antigen CD362) | EBI-21628438 | 0.35 |
| Q96EV8 | Dysbindin (Biogenesis of lysosome-related organelles complex 1 subunit 8) (BLOC-1 subunit 8) (Dysbindin-1) (Dystrobrevin-binding protein 1) (Hermansky-Pudlak syndrome 7 protein) (HPS7 protein) | EBI-21651992 | 0.35 |
| P27930 | Interleukin-1 receptor type 2 (IL-1R-2) (IL-1RT-2) (IL-1RT2) (CD121 antigen-like family member B) (CDw121b) (IL-1 type II receptor) (Interleukin-1 receptor beta) (IL-1R-beta) (Interleukin-1 receptor type II) (CD antigen CD121b) [Cleaved into: Interleukin-1 receptor type 2, membrane form (mIL-1R2) (mIL-1RII); Interleukin-1 receptor type 2, soluble form (sIL-1R2) (sIL-1RII)] | EBI-21662122 | 0.35 |
| Q13563 | Polycystin-2 (PC2) (Autosomal dominant polycystic kidney disease type II protein) (Polycystic kidney disease 2 protein) (Polycystwin) (R48321) (Transient receptor potential cation channel subfamily P member 2) | EBI-21672799 | 0.35 |
| Q9Y496 | Kinesin-like protein KIF3A (Microtubule plus end-directed kinesin motor 3A) | EBI-21672799 | 0.35 |
| Q9H0B6 | Kinesin light chain 2 (KLC 2) | EBI-21672799 | 0.35 |
| Q9BQD3 | KxDL motif-containing protein 1 | EBI-21672799 | 0.35 |
| Q9BQ69 | ADP-ribose glycohydrolase MACROD1 (MACRO domain-containing protein 1) (O-acetyl-ADP-ribose deacetylase MACROD1) (EC 3.1.1.106) (Protein LRP16) ([Protein ADP-ribosylaspartate] hydrolase MACROD1) (EC 3.2.2.-) ([Protein ADP-ribosylglutamate] hydrolase MACROD1) (EC 3.2.2.-) | EBI-21672799 | 0.35 |
| Q99666 | RANBP2-like and GRIP domain-containing protein 5/6 (Ran-binding protein 2-like 1/2) (RanBP2-like 1/2) (RanBP2L1) (RanBP2L2) (Sperm membrane protein BS-63) | EBI-21672799 | 0.35 |
| Q96NL6 | Sodium channel and clathrin linker 1 (Sodium channel-associated protein 1) | EBI-21672799 | 0.35 |
| Q96JN2 | Coiled-coil domain-containing protein 136 (Nasopharyngeal carcinoma-associated gene 6 protein) | EBI-21672799 | 0.35 |
| Q8WXW3 | Progesterone-induced-blocking factor 1 (PIBF) (Centrosomal protein of 90 kDa) (CEP90) | EBI-21672799 | 0.35 |
| Q8IY31 | Intraflagellar transport protein 20 homolog (hIFT20) | EBI-21672799 | 0.35 |
| Q8IWJ2 | GRIP and coiled-coil domain-containing protein 2 (185 kDa Golgi coiled-coil protein) (GCC185) (CLL-associated antigen KW-11) (CTCL tumor antigen se1-1) (Ran-binding protein 2-like 4) (RanBP2L4) (Renal carcinoma antigen NY-REN-53) | EBI-21672799 | 0.35 |
| P0DJD1 | RANBP2-like and GRIP domain-containing protein 2 (Ran-binding protein 2-like 2) (RanBP2-like 2) (RanBP2L2) | EBI-21672799 | 0.35 |
| Q2M2Z5 | Centrosomal protein kizuna (Polo-like kinase 1 substrate 1) | EBI-21672799 | 0.35 |
| Q15643 | Thyroid receptor-interacting protein 11 (TR-interacting protein 11) (TRIP-11) (Clonal evolution-related gene on chromosome 14 protein) (Golgi-associated microtubule-binding protein 210) (GMAP-210) (Trip230) | EBI-21672799 | 0.35 |
| Q07866 | Kinesin light chain 1 (KLC 1) | EBI-21672799 | 0.35 |
| Q32P51 | Heterogeneous nuclear ribonucleoprotein A1-like 2 (hnRNP A1-like 2) (hnRNP core protein A1-like 2) | EBI-20938684 | 0.40 |
| P12004 | Proliferating cell nuclear antigen (PCNA) (Cyclin) | EBI-21238234 | 0.37 |
| Q96T52 | Mitochondrial inner membrane protease subunit 2 (EC 3.4.21.-) (IMP2-like protein) | EBI-27050444 | 0.35 |
| F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
| P18433 | Receptor-type tyrosine-protein phosphatase alpha (Protein-tyrosine phosphatase alpha) (R-PTP-alpha) (EC 3.1.3.48) | EBI-27116377 | 0.27 |
| Q9HD43 | Receptor-type tyrosine-protein phosphatase H (R-PTP-H) (EC 3.1.3.48) (Stomach cancer-associated protein tyrosine phosphatase 1) (SAP-1) (Transmembrane-type protein-tyrosine phosphatase type H) | EBI-27116527 | 0.27 |
Database | Links |
| UNIPROT | O60645 Q6P2E8 Q8TEN6 Q8WUW0 Q96DI4 |
| Pfam | PF06046 |
| OMIM | 608186 |
| DisGeNET | 11336 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory