Nuclear pore complex protein Nup155 - Homo sapiens

Nuclear pore complex protein Nup155 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Nuclear pore complex protein Nup155
Accession Code	O75694
Gene	NUP155
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 1391)
MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGMSDMDYPLQGPGLLSVPNLPE ISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPH VRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAY QAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQ NAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASS TVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDH IPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAA CDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGSPVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALG NPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEF LDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCE HQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANEL LQRSRQVQNKTEKERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIV GLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALY NWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIAR AILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAE CKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNW DVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGY LVELQSMSSSVAVQAITGNFKSLQAKLERLH

Structure Viewer (PDB: 5A9Q)

Subcellular Location

Description
Nucleus, nuclear pore complex {By SimilarityUniProtKB:P37199}. Nucleus membrane {By SimilarityUniProtKB:P37199}; Peripheral membrane protein {By SimilarityUniProtKB:P37199}; Cytoplasmic side {By SimilarityUniProtKB:P37199}. Nucleus membrane {By SimilarityUniProtKB:P37199}; Peripheral membrane protein {By SimilarityUniProtKB:P37199}; Nucleoplasmic side {By SimilarityUniProtKB:P37199}. Note=In mitosis, assumes a diffuse cytoplasmic distribution probably as a monomer, before reversing back into a punctate nuclear surface localization at the end of mitosis. {By SimilarityUniProtKB:P37199}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	By Similarity {ECO:0000250\|UniProtKB:P37199}
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) Membrane (GO:0016020) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Pore (GO:0005643) Nuclear Pore Inner Ring (GO:0044611)

Biology & Function

Description
Essential component of nuclear pore complex. Could be essessential for embryogenesis. Nucleoporins may be involved both in binding and translocating proteins during nucleocytoplasmic transport. {By SimilarityUniProtKB:Q99P88}.
Assigned Ontology terms

Biological Process	Atrial Cardiac Muscle Cell Action Potential (GO:0086014) MiRNA Processing (GO:0035196) MRNA Export From Nucleus (GO:0006406) Nuclear Envelope Organization (GO:0006998) Nucleocytoplasmic Transport (GO:0006913) Protein Import Into Nucleus (GO:0006606) Protein Localization To Nuclear Inner Membrane (GO:0036228) RNA Export From Nucleus (GO:0006405) Transcription-Dependent Tethering Of RNA Polymerase II Gene DNA At Nuclear Periphery (GO:0000972)
Molecular Function	Structural Constituent Of Nuclear Pore (GO:0017056)

Disease associations

Description
Atrial fibrillation, familial, 15 (ATFB15) [MIM:615770]: A familial form of atrial fibrillation, a common sustained cardiac rhythm disturbance. Atrial fibrillation is characterized by disorganized atrial electrical activity and ineffective atrial contraction promoting blood stasis in the atria and reduces ventricular filling. It can result in palpitations, syncope, thromboembolic stroke, and congestive heart failure. {Experimental EvidencePubMed:19070573}. Note=The disease is caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	606694 615770
DisGeNET	9631

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (11 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q99P88	Nuclear pore complex protein Nup155	EBI-2558136	0.40
Q9ERU9	E3 SUMO-protein ligase RanBP2	EBI-10999306	0.35
Q92621	Nuclear pore complex protein Nup205	EBI-26588212	0.35
P01112	GTPase HRas, N-terminally processed	EBI-27045317	0.27
P11802	Cyclin-dependent kinase 4	EBI-1065754	0.00
Q92905	COP9 signalosome complex subunit 5	EBI-21325777	0.35
P00533	Epidermal growth factor receptor	EBI-32720286	0.27
Q8WYP5	Protein ELYS	EBI-9050350	0.40
P04626	Receptor tyrosine-protein kinase erbB-2	EBI-32721465	0.27
Q53GS7	mRNA export factor GLE1	EBI-8873568	0.37
P02545	Lamin-A/C	EBI-16795756	0.67
Interactions with other proteins (74 interactors)

Partner (UniProt)		IntAct	Confidence score
O95405	Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation)	EBI-7255490	0.37
P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	EBI-1062521	0.00
P19532	Transcription factor E3 (Class E basic helix-loop-helix protein 33) (bHLHe33)	EBI-1070952	0.00
P23508	Colorectal mutant cancer protein (Protein MCC)	EBI-1072074	0.00
Q9Y4K3	TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6)	EBI-1075999	0.00
P11171	Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1)	EBI-1078988	0.00
P01889	HLA class I histocompatibility antigen, B alpha chain (Human leukocyte antigen B) (HLA-B)	EBI-1085884	0.00
Q8IY92	Structure-specific endonuclease subunit SLX4 (BTB/POZ domain-containing protein 12)	EBI-2371120	0.35
Q6GQQ9	OTU domain-containing protein 7B (EC 3.4.19.12) (Cellular zinc finger anti-NF-kappa-B protein) (Cezanne) (Zinc finger A20 domain-containing protein 1) (Zinc finger protein Cezanne)	EBI-2510717	0.40
Q09019	Dystrophia myotonica WD repeat-containing protein (Dystrophia myotonica-containing WD repeat motif protein) (Protein 59) (Protein DMR-N9)	EBI-2515767	0.40
A0A2U2H2G3	Trehalose operon repressor	EBI-2862410	0.00
Q13573	SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein)	EBI-7950968	0.35
Q99459	Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein)	EBI-7954144	0.55
Q5EWX9	Nuclear pore protein pom121 (nuclear envelope pore membrane protein POM 121)	EBI-8070469	0.35
Q8WVZ9	Kelch repeat and BTB domain-containing protein 7	EBI-3232144	0.35
O95758	Polypyrimidine tract-binding protein 3 (Regulator of differentiation 1) (Rod1)	EBI-7850130	0.35
P98078	Disabled homolog 2 (Adaptor molecule disabled-2) (Differentially expressed in ovarian carcinoma 2) (DOC-2) (Mitogen-responsive phosphoprotein)	EBI-6100356	0.35
P19320	Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106)	EBI-6189915	0.35
P02751	Fibronectin (FN) (Cold-insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl-Y1; Ugl-Y2; Ugl-Y3]	EBI-6285956	0.35
Q15843	NEDD8 (Neddylin) (Neural precursor cell expressed developmentally down-regulated protein 8) (NEDD-8) (Ubiquitin-like protein Nedd8)	EBI-21328206	0.35
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
O43281	Embryonal Fyn-associated substrate (hEFS) (Cas scaffolding protein family member 3)	EBI-10189017	0.56
Q15637	Splicing factor 1 (Mammalian branch point-binding protein) (BBP) (mBBP) (Transcription factor ZFM1) (Zinc finger gene in MEN1 locus) (Zinc finger protein 162)	EBI-11299723	0.00
P05412	Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39)	EBI-11323169	0.35
Q68CZ1	Protein fantom (Nephrocystin-8) (RPGR-interacting protein 1-like protein) (RPGRIP1-like protein)	EBI-11363154	0.35
Q86VQ0	Lebercilin (Leber congenital amaurosis 5 protein)	EBI-11363336	0.35
Q86X19	Transmembrane protein 17	EBI-11372615	0.27
Q9P0N5	Transmembrane protein 216	EBI-11378021	0.27
Q66GS9	Centrosomal protein of 135 kDa (Cep135) (Centrosomal protein 4)	EBI-11386281	0.27
Q86UK5	Limbin (Ellis-van Creveld syndrome protein 2) (EVC2)	EBI-11389870	0.27
Q8IVT5	Kinase suppressor of Ras 1 (EC 2.7.11.1)	EBI-14035520	0.35
P43353	Aldehyde dehydrogenase family 3 member B1 (EC 1.2.1.28) (EC 1.2.1.5) (EC 1.2.1.7) (Aldehyde dehydrogenase 7)	EBI-21500028	0.35
P09067	Homeobox protein Hox-B5 (Homeobox protein HHO.C10) (Homeobox protein Hox-2A) (Homeobox protein Hu-1)	EBI-21543288	0.35
Q9H813	Proton-activated chloride channel (PAC) (hPAC) (Acid-sensitive outwardly-rectifying anion channel) (ASOR) (Proton-activated outwardly rectifying anion channel) (PAORAC) (Transmembrane protein 206) (hTMEM206)	EBI-21593240	0.35
O15155	BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18)	EBI-16788067	0.27
P27824	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	EBI-16788621	0.27
Q96I36	Cytochrome c oxidase assembly protein COX14	EBI-16791250	0.27
Q9HBL7	Plasminogen receptor (KT) (Plg-R(KT))	EBI-16797780	0.27
Q15388	Mitochondrial import receptor subunit TOM20 homolog (Mitochondrial 20 kDa outer membrane protein) (Outer mitochondrial membrane receptor Tom20)	EBI-16801791	0.27
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-21360986	0.35
Q8IY21	Probable ATP-dependent RNA helicase DDX60 (EC 3.6.4.13) (DEAD box protein 60)	EBI-21259607	0.35
Q9Y586	Protein mab-21-like 2	EBI-21261050	0.35
Q15077	P2Y purinoceptor 6 (P2Y6)	EBI-21262943	0.35
P51159	Ras-related protein Rab-27A (Rab-27) (EC 3.6.5.2) (GTP-binding protein Ram)	EBI-21264064	0.35
Q9Y275	Tumor necrosis factor ligand superfamily member 13B (B lymphocyte stimulator) (BLyS) (B-cell-activating factor) (BAFF) (Dendritic cell-derived TNF-like molecule) (TNF- and APOL-related leukocyte expressed ligand 1) (TALL-1) (CD antigen CD257) [Cleaved into: Tumor necrosis factor ligand superfamily member 13b, membrane form; Tumor necrosis factor ligand superfamily member 13b, soluble form]	EBI-21266480	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
P0DTC5	Membrane protein (M) (E1 glycoprotein) (Matrix glycoprotein) (Membrane glycoprotein)	EBI-26495256	0.35
P01116	GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]	EBI-27041844	0.27
P01111	GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)	EBI-27042293	0.27
A0A0H3NG92	Type III secretion system effector protein-regulates and maintains the SCV (Type III secretion systems effector SseF)	EBI-27055968	0.27
A0A0H3NB75	Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV)	EBI-27055983	0.27
P51617	Interleukin-1 receptor-associated kinase 1 (IRAK-1) (EC 2.7.11.1)	EBI-28935882	0.35
Q99952	Tyrosine-protein phosphatase non-receptor type 18 (EC 3.1.3.48) (Brain-derived phosphatase)	EBI-27114698	0.35
Q92932	Receptor-type tyrosine-protein phosphatase N2 (R-PTP-N2) (EC 3.1.3.-) (EC 3.1.3.48) (Islet cell autoantigen-related protein) (IAR) (ICAAR) (Phogrin) [Cleaved into: IA-2beta60]	EBI-27116679	0.27
Q13283	Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1)	EBI-28955349	0.35
Q8WUM4	Programmed cell death 6-interacting protein (PDCD6-interacting protein) (ALG-2-interacting protein 1) (ALG-2-interacting protein X) (Hp95)	EBI-30834760	0.44
Q9UM73	ALK tyrosine kinase receptor (EC 2.7.10.1) (Anaplastic lymphoma kinase) (CD antigen CD246)	EBI-32719830	0.27
P30530	Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene)	EBI-32719959	0.27
P54756	Ephrin type-A receptor 5 (EC 2.7.10.1) (Brain-specific kinase) (EPH homology kinase 1) (EHK-1) (EPH-like kinase 7) (EK7) (hEK7)	EBI-32720907	0.27
P29322	Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK)	EBI-32721175	0.27
P11362	Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331)	EBI-32721578	0.27
P22607	Fibroblast growth factor receptor 3 (FGFR-3) (EC 2.7.10.1) (CD antigen CD333)	EBI-32721979	0.27
P22455	Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334)	EBI-32722168	0.27
P17948	Vascular endothelial growth factor receptor 1 (VEGFR-1) (EC 2.7.10.1) (Fms-like tyrosine kinase 1) (FLT-1) (Tyrosine-protein kinase FRT) (Tyrosine-protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor)	EBI-32722433	0.27
P36888	Receptor-type tyrosine-protein kinase FLT3 (EC 2.7.10.1) (FL cytokine receptor) (Fetal liver kinase-2) (FLK-2) (Fms-like tyrosine kinase 3) (FLT-3) (Stem cell tyrosine kinase 1) (STK-1) (CD antigen CD135)	EBI-32722567	0.27
P35916	Vascular endothelial growth factor receptor 3 (VEGFR-3) (EC 2.7.10.1) (Fms-like tyrosine kinase 4) (FLT-4) (Tyrosine-protein kinase receptor FLT4)	EBI-32722728	0.27
P08069	Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain]	EBI-32722947	0.27
P35968	Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase insert domain receptor) (KDR) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309)	EBI-32723270	0.27
Q12866	Tyrosine-protein kinase Mer (EC 2.7.10.1) (Proto-oncogene c-Mer) (Receptor tyrosine kinase MerTK)	EBI-32723870	0.27
P04629	High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (p140-TrkA)	EBI-32724282	0.27
Q16288	NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)	EBI-32724526	0.27
P07949	Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment]	EBI-32725031	0.27
Q01973	Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Neurotrophic tyrosine kinase, receptor-related 1)	EBI-32725295	0.27
Q6J9G0	Tyrosine-protein kinase STYK1 (EC 2.7.10.2) (Novel oncogene with kinase domain) (Protein PK-unique) (Serine/threonine/tyrosine kinase 1)	EBI-32731895	0.27

Cross-References

Database	Links
UNIPROT	O75694 Q9UBE9 Q9UFL5
PDB	5A9Q 5IJN 5IJO 7PER
Pfam	PF03177 PF08801
OMIM	606694 615770
DisGeNET	9631

Nuclear pore complex protein Nup155 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 5A9Q)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (11 interactors)

Interactions with other proteins (74 interactors)

Cross-References

Database

Links

Description

Description