E3 SUMO-protein ligase RanBP2 - Mus musculus

E3 SUMO-protein ligase RanBP2 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	E3 SUMO-protein ligase RanBP2
Accession Code	Q9ERU9
Gene	Ranbp2
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 3053)
MRRSKADVERYIASVQGSAPSPREKSMKGFYFAKLYYEAKEYDLAKKYISTYINVQERDPKAHRFLGLLYEVEENIDKAVECYKRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPA IYKLKEQLLDCKGEDGWNKLFDLIQSELYARPDDIHVNIRLVELYRSNKRLKDAVAHCHEADRNTALRSSLEWNLCVVQTLKEYLESLQCLDSDKSTWRATNKDLLLAYANLMLLTLSTRDVQEGRELLE SFDSALQSVKSSVGGNDELSATFLETKGHFYMHVGSLLLKMGQQSDIQWRALSELAALCYLVAFQVPRPKVKLIKGEAGQNLLETMAHDRLSQSGHMLLNLSRGKQDFLKEVVESFANKSGQSALCDALF SSQSSKERSFLGNDDIGNLDGQVPDPDDLARYDTGAVRAHNGSLQHLTWLGLQWNSLSTLPAIRKWLKQLFHHLPQETSRLETNAPESICILDLEVFLLGVIYTSHLQLKEKCNSHHTSYQPLCLPLPVC RQLCTERQKTWWDAVCTLIHRKALPGTSAKLRLLVQREINSLRGQEKHGLQPALLVHWAQSLQKTGSSLNSFYDQREYIGRSVHYWRKVLPLLKMIRKKNSIPEPIDPLFKHFHSVDIQASEIGEYEEDA HITFAILDAVNGNIEDAMTAFESIKNVVSYWNLALIFHRKAEDIENDALSPEEQEECKNYLRKTRDYLIRILDDSDSNTSVVQKLPVPLESVKEMLNSVMQELEDYSEGGTLYKNGCWRSADSELKHSTP SPTKYSLSPSKSYKYSPKTPPRWAEDQNSLLKMICQQVEAIKKEMQELKLNSNNSASPHRWPAEPYGQDPAPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGPVYGMNRLPP QQHIYAYSQQMHTPPVQSSSACMFSQEMYGPPLRFESPATGILSPRGDDYFNYNVQQTSTNPPLPEPGYFTKPPLVAHASRSAESKVIEFGKSNFVQPMQGEVIRPPLTTPAHTTQPTPFKFNSNFKSND GDFTFSSPQVVAQPPSTAYSNSESLLGLLTSDKPLQGDGYSGLKPISGQASGSRNTFSFGSKNTLTENMGPNQQKNFGFHRSDDMFAFHGPGKSVFTTAASELANKSHETDGGSAHGDEEDDGPHFEPVV PLPDKIEVKTGEEDEEEFFCNRAKLFRFDGESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQNILK ALGTNTSTAPNHTLRIVKESATQDNKDICKADGGNLNFEFQIVKKEGPYWNCNSCSFKNAATAKKCVSCQNTNPTSNKELLGPPLVENGFAPKTGLENAQDRFATMTANKEGHWDCSVCLVRNEPTVSRC IACQNTKSASSFVQTSFKFGQGDLPKSVDSDFRSVFSKKEGQWECSVCLVRNERSAKKCVACENPGKQFKEWHCSLCSVKNEAHAIKCVACNNPVTPSLSTAPPSFKFGTSEMSKPFRIGFEGMFAKKEG QWDCSLCFVRNEASATHCIACQYPNKQNQPTSCVSAPASSETSRSPKSGFEGLFPKKEGEWECAVCSVQNESSSLKCVACEASKPTHKPHEAPSAFTVGSKSQSNESAGSQVGTEFKSNFPEKNFKVGIS EQKFKFGHVDQEKTPSFAFQGGSNTEFKSIKDGFSFCIPVSADGFKFGIQEKGNQEKKSEKHLENDPSFQAHDTSGQKNGSGVVFGQTSSTFTFADLAKSTSREGFQFGKKDPNFKGFSGAGEKLFSSQS GKVAEKANTSSDLEKDDDAYKTEDSDDIHFEPVVQMPEKVELVTGEEDEKVLYSQRVKLFRFDAEISQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSGSDRAWMWLASDFS DGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFKTFLTNDQVKVTDEENASSGADAPSASDTTAKQNPDNTGPALEWDNYDLREDALDDSVSSSSV HASPLASSPVRKNLFRFGESTTGFNFSFKSALSPSKSPAKLNQSGASVGTDEESDVTQEEERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAKLYRYDKDVGQWKERGIGDIKILQNYDNKQVRIVMR RDQVLKLCANHRITPDMTLQTMKGTERVWVWTACDFADGERKIEHLAVRFKLQDVADSFKKIFDEAKTAQEKDSLITPHVSHLSTPRESPCGKIAIAVLEETTRERTDLTQGDEVIDTTSEAGETSSTSE TTPKAVVSPPKFVFGSESVKSIFSSEKSKPFAFGNSSATGSLFGFSFNAPLKNSNSEMTSRVQSGSEGKVKPDKCELPQNSDIKQSSDGKVKNLSAFSKENSSTSYTFKTPEKAQEKSKPEDLPSDNDIL IVYELTPTPEQKALAEKLLLPSTFFCYKNRPGYVSEEEEDDEDYEMAVKKLNGKLYLDDSEKPLEENLADNDKECVIVWEKKPTVEERAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELRKVCEAQK SQNEKVTDRVGIEHIGETEVTNPVGCKSEEPDSDTKHSSSSPVSGTMDKPVDLSTRKETDMEFPSKGENKPVLFGFGSGTGLSFADLASSNSGDFAFGSKDKNFQWANTGAAVFGTQTTSKGGEDEDGSD EDVVHNEDIHFEPIVSLPEVEVKSGEEDEEVLFKERAKLYRWDRDVSQWKERGIGDIKILWHTMKKYYRILMRRDQVFKVCANHVITKAMELKPLNVSNNALVWTASDYADGEAKVEQLAVRFKTKEMTE SFKKKFEECQQNIIKLQNGHTSLAAELSKDTNPVVFFDVCADGEPLGRIIMELFSNIVPQTAENFRALCTGEKGFGFKNSIFHRVVPDFICQGGDITKYNGTGGQSIYGDKFDDENFDLKHTGPGLLSMA NYGQNTNSSQFFITLKKAEHLDFKHVVFGFVKDGMDTVRKIESFGSPKGSVSRRICITECGQL

Subcellular Location

Description
Nucleus {By SimilarityUniProtKB:P49792}. Nucleus membrane {By SimilarityUniProtKB:P49792}. Nucleus, nuclear pore complex {By SimilarityUniProtKB:P49792}. Nucleus envelope {By SimilarityUniProtKB:P49792}. Note=Detected in diffuse and discrete intranuclear foci. Cytoplasmic filaments. {By SimilarityUniProtKB:P49792}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Annulate Lamellae (GO:0005642) Cytoplasm (GO:0005737) Cytoplasmic Periphery Of The Nuclear Pore Complex (GO:1990723) Intracellular Membrane-Bounded Organelle (GO:0043231) Nuclear Envelope (GO:0005635) Nuclear Inclusion Body (GO:0042405) Nuclear Membrane (GO:0031965) Nuclear Pore (GO:0005643) Nuclear Pore Cytoplasmic Filaments (GO:0044614) Nuclear Pore Nuclear Basket (GO:0044615) Nucleoplasm (GO:0005654) SUMO Ligase Complex (GO:0106068)

Biology & Function

Description
E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single- stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1 (By similarity). Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle. Probable inactive PPIase with no peptidyl-prolyl cis-trans isomerase activity. {By SimilarityUniProtKB:P49792}.
Assigned Ontology terms

Biological Process	Centrosome Localization (GO:0051642) MRNA Transport (GO:0051028) NLS-Bearing Protein Import Into Nucleus (GO:0006607) Nuclear Export (GO:0051168) Nucleocytoplasmic Transport (GO:0006913) Positive Regulation Of Glucokinase Activity (GO:0033133) Protein Folding (GO:0006457) Protein Peptidyl-Prolyl Isomerization (GO:0000413) Protein Sumoylation (GO:0016925) Regulation Of Gluconeogenesis (GO:0006111)
Molecular Function	Metal Ion Binding (GO:0046872) Peptidyl-Prolyl Cis-Trans Isomerase Activity (GO:0003755) Protein-Containing Complex Binding (GO:0044877) RNA Binding (GO:0003723) Small GTPase Binding (GO:0031267) SUMO Ligase Activity (GO:0061665) SUMO Transferase Activity (GO:0019789)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (39 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P55735	Protein SEC13 homolog	EBI-10999306	0.35
P63165	Small ubiquitin-related modifier 1	EBI-2555617	0.56
P63279	SUMO-conjugating enzyme UBC9	EBI-2555617	0.56
Q96EE3	Nucleoporin SEH1	EBI-10999306	0.35
Q9HC62	Sentrin-specific protease 2	EBI-10999306	0.35
Q9NRG9	Aladin	EBI-10999306	0.35
Q8TD16	Protein bicaudal D homolog 2	EBI-2555617	0.40
O43633	Charged multivesicular body protein 2a	EBI-10999306	0.35
Q9H444	Charged multivesicular body protein 4b	EBI-10999306	0.35
P35922	Fragile X messenger ribonucleoprotein 1	EBI-16728828	0.35
Q53GS7	mRNA export factor GLE1	EBI-10999306	0.35
Q14974	Importin subunit beta-1	EBI-2555617	0.56
Q9HD47	Ran guanine nucleotide release factor	EBI-10999306	0.35
Q9BTX1	Nucleoporin NDC1	EBI-10999306	0.35
O14524	Nuclear envelope integral membrane protein 1	EBI-10999306	0.35
P57740	Nuclear pore complex protein Nup107	EBI-10999306	0.35
Q8WUM0	Nuclear pore complex protein Nup133	EBI-10999306	0.35
P49790	Nuclear pore complex protein Nup153	EBI-10999306	0.35
O75694	Nuclear pore complex protein Nup155	EBI-10999306	0.35
Q12769	Nuclear pore complex protein Nup160	EBI-10999306	0.35
Q5SRE5	Nucleoporin NUP188	EBI-10999306	0.35
Q92621	Nuclear pore complex protein Nup205	EBI-10999306	0.35
P35658	Nuclear pore complex protein Nup214	EBI-10999306	0.35
Q8NFH5	Nucleoporin NUP35	EBI-10999306	0.35
Q8NFH4	Nucleoporin Nup37	EBI-10999306	0.35
O15504	Nucleoporin NUP42	EBI-10999306	0.35
Q8NFH3	Nucleoporin Nup43	EBI-10999306	0.35
Q9UKX7	Nuclear pore complex protein Nup50	EBI-10999306	0.35
P37198	Nuclear pore glycoprotein p62	EBI-10999306	0.35
Q9BW27	Nuclear pore complex protein Nup85	EBI-10999306	0.35
Q99567	Nuclear pore complex protein Nup88	EBI-10999306	0.35
Q8N1F7	Nuclear pore complex protein Nup93	EBI-10999306	0.35
P52948	Nuclear pore complex protein Nup96	EBI-10999306	0.35
Q9UBU9	Nuclear RNA export factor 1	EBI-2555617	0.56
A8CG34	Nuclear envelope pore membrane protein POM 121C	EBI-10999306	0.35
P78406	mRNA export factor RAE1	EBI-10999306	0.35
P46060	Ran GTPase-activating protein 1	EBI-2555617	0.56
P62826	GTP-binding nuclear protein Ran	EBI-2555617	0.56
P49792	E3 SUMO-protein ligase RanBP2	EBI-2555617	0.40
Interactions with other proteins (53 interactors)

Partner (UniProt)		IntAct	Confidence score
Q62077	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-gamma-1) (Phospholipase C-gamma-1) (PLC-gamma-1)	EBI-651424	0.37
Q9DBC7	cAMP-dependent protein kinase type I-alpha regulatory subunit [Cleaved into: cAMP-dependent protein kinase type I-alpha regulatory subunit, N-terminally processed]	EBI-654833	0.37
P63141	Potassium voltage-gated channel subfamily A member 2 (MK2) (Voltage-gated potassium channel subunit Kv1.2)	EBI-651684	0.37
Q9WVS6	E3 ubiquitin-protein ligase parkin (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase)	EBI-973674	0.40
Q01320	DNA topoisomerase 2-alpha (EC 5.6.2.2) (DNA topoisomerase II, alpha isozyme)	EBI-1773469	0.40
Q9Z0E3	Autoimmune regulator (Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein homolog) (APECED protein homolog)	EBI-2549816	0.35
P18754	Regulator of chromosome condensation (Cell cycle regulatory protein) (Chromosome condensation protein 1)	EBI-2555617	0.56
B4DQN6	cDNA FLJ54867, highly similar to Ran-binding protein 2-like 6	EBI-2555617	0.40
O00505	Importin subunit alpha-4 (Importin alpha Q2) (Qip2) (Karyopherin subunit alpha-3) (SRP1-gamma)	EBI-2555617	0.56
O00629	Importin subunit alpha-3 (Importin alpha Q1) (Qip1) (Karyopherin subunit alpha-4)	EBI-2555617	0.56
Q9BW19	Kinesin-like protein KIFC1 (Kinesin-like protein 2) (Kinesin-related protein HSET)	EBI-2555617	0.40
P43487	Ran-specific GTPase-activating protein (Ran-binding protein 1) (RanBP1)	EBI-2555617	0.40
A8K394	cDNA FLJ76708, highly similar to Homo sapiens nuclear mitotic apparatus protein 1 (NUMA1), mRNA	EBI-2555617	0.40
P55854	Small ubiquitin-related modifier 3 (SUMO-3) (SMT3 homolog 1) (SUMO-2) (Ubiquitin-like protein SMT3A) (Smt3A)	EBI-2555617	0.40
P52292	Importin subunit alpha-1 (Karyopherin subunit alpha-2) (RAG cohort protein 1) (SRP1-alpha)	EBI-2555617	0.40
Q9BXS6	Nucleolar and spindle-associated protein 1 (NuSAP)	EBI-2555617	0.40
Q99666	RANBP2-like and GRIP domain-containing protein 5/6 (Ran-binding protein 2-like 1/2) (RanBP2-like 1/2) (RanBP2L1) (RanBP2L2) (Sperm membrane protein BS-63)	EBI-2555617	0.56
Q80Z64	Homeobox protein NANOG (ES cell-associated protein 4) (Early embryo specific expression NK-type homeobox protein) (Homeobox transcription factor Nanog)	EBI-8820601	0.35
Q923J1	Transient receptor potential cation channel subfamily M member 7 (EC 2.7.11.1) (Channel-kinase 1) (Long transient receptor potential channel 7) (LTrpC-7) (LTrpC7) (Transient receptor potential-phospholipase C-interacting kinase) (TRP-PLIK)	EBI-9661302	0.35
Q9HD42	Charged multivesicular body protein 1a (Chromatin-modifying protein 1a) (CHMP1a) (Vacuolar protein sorting-associated protein 46-1) (Vps46-1) (hVps46-1)	EBI-10999306	0.35
Q6NUQ4	Transmembrane protein 214	EBI-10999306	0.35
Q5T4S7	E3 ubiquitin-protein ligase UBR4 (EC 2.3.2.27) (600 kDa retinoblastoma protein-associated factor) (N-recognin-4) (RING-type E3 ubiquitin transferase UBR4) (Retinoblastoma-associated factor of 600 kDa) (RBAF600) (p600) (Zinc finger UBR1-type protein 1)	EBI-10999306	0.35
Q9Y4R8	Telomere length regulation protein TEL2 homolog (Protein clk-2 homolog) (hCLK2)	EBI-10999306	0.35
P14373	Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (RING-type E3 ubiquitin transferase TRIM27) (Ret finger protein) (Tripartite motif-containing protein 27)	EBI-10999306	0.35
O95373	Importin-7 (Imp7) (Ran-binding protein 7) (RanBP7)	EBI-10999306	0.35
P98170	E3 ubiquitin-protein ligase XIAP (EC 2.3.2.27) (Baculoviral IAP repeat-containing protein 4) (IAP-like protein) (ILP) (hILP) (Inhibitor of apoptosis protein 3) (IAP-3) (hIAP-3) (hIAP3) (RING-type E3 ubiquitin transferase XIAP) (X-linked inhibitor of apoptosis protein) (X-linked IAP)	EBI-10999306	0.35
Q9H568	Actin-like protein 8 (Cancer/testis antigen 57) (CT57)	EBI-10999306	0.35
Q9NPJ8	NTF2-related export protein 2 (Protein p15-2)	EBI-10999306	0.35
Q9P0U3	Sentrin-specific protease 1 (EC 3.4.22.-) (Sentrin/SUMO-specific protease SENP1)	EBI-10999306	0.35
Q14527	Helicase-like transcription factor (EC 2.3.2.27) (EC 3.6.4.-) (DNA-binding protein/plasminogen activator inhibitor 1 regulator) (HIP116) (RING finger protein 80) (RING-type E3 ubiquitin transferase HLTF) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3) (Sucrose nonfermenting protein 2-like 3)	EBI-10999306	0.35
Q96SK2	Transmembrane protein 209	EBI-10999306	0.35
Q13751	Laminin subunit beta-3 (Epiligrin subunit bata) (Kalinin B1 chain) (Kalinin subunit beta) (Laminin B1k chain) (Laminin-5 subunit beta) (Nicein subunit beta)	EBI-10999306	0.35
Q96A33	PAT complex subunit CCDC47 (Calumin) (Coiled-coil domain-containing protein 47)	EBI-10999306	0.35
O14715	RANBP2-like and GRIP domain-containing protein 8 (Ran-binding protein 2-like 3) (RanBP2-like 3) (RanBP2L3)	EBI-10999306	0.35
O94905	Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2) (SPFH domain-containing protein 2)	EBI-10999306	0.35
Q8WUM4	Programmed cell death 6-interacting protein (PDCD6-interacting protein) (ALG-2-interacting protein 1) (ALG-2-interacting protein X) (Hp95)	EBI-10999306	0.35
Q8TB61	Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (PAPS transporter 1) (Putative MAPK-activating protein PM15) (Putative NF-kappa-B-activating protein 48) (Solute carrier family 35 member B2)	EBI-10999306	0.35
Q9UKK6	NTF2-related export protein 1 (Protein p15)	EBI-10999306	0.35
Q69YH5	Cell division cycle-associated protein 2 (Recruits PP1 onto mitotic chromatin at anaphase protein) (Repo-Man)	EBI-10999306	0.35
Q96KM6	Zinc finger protein 512B	EBI-10999306	0.35
Q7Z4Q2	HEAT repeat-containing protein 3	EBI-10999306	0.35
P36873	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit)	EBI-10999306	0.35
Q9H9B4	Sideroflexin-1	EBI-10999306	0.35
Q9UHQ1	Nuclear prelamin A recognition factor (Iron-only hydrogenase-like protein 2) (IOP2)	EBI-10999306	0.35
Q9UF83	Uncharacterized protein DKFZp434B061	EBI-10999306	0.35
A8K7Q2	Heat shock cognate 71 kDa protein (cDNA FLJ77848)	EBI-10999306	0.35
P61956	Small ubiquitin-related modifier 2 (SUMO-2) (HSMT3) (SMT3 homolog 2) (SUMO-3) (Sentrin-2) (Ubiquitin-like protein SMT3B) (Smt3B)	EBI-10999306	0.35
O60678	Protein arginine N-methyltransferase 3 (EC 2.1.1.319) (Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3)	EBI-10999306	0.35
Q9Y2D8	Afadin- and alpha-actinin-binding protein (ADIP) (Afadin DIL domain-interacting protein) (SSX2-interacting protein)	EBI-11694681	0.35
Q61584	RNA-binding protein FXR1 (mFxr1p)	EBI-16729686	0.35
Q9EPK7	Exportin-7 (Exp7) (Ran-binding protein 16)	EBI-17172030	0.35
Q9NRI5	Disrupted in schizophrenia 1 protein	EBI-26612017	0.35
Q8VI24	DNA-binding protein SATB2 (Special AT-rich sequence-binding protein 2)	EBI-26885104	0.35

Cross-References

Database	Links
UNIPROT	Q9ERU9 E9QM01 Q61992 Q8C9K9
Pfam	PF12185 PF00160 PF00638 PF00641
PROSITE	PS00170 PS50072 PS50196 PS50005 PS50293 PS01358 PS50199

E3 SUMO-protein ligase RanBP2 (Mus musculus)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (39 interactors)

Interactions with other proteins (53 interactors)

Cross-References

Database

Links

Description

Description