Protein Information |
|
|---|---|
| Protein Name | Keratin, type I cytoskeletal 18 |
| Accession Code | P05783 |
| Gene | KRT18 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 430) | |
|
MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYF KIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELA RKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDF NLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH |
|
Description |
||
|---|---|---|
| Nucleus matrix {By SimilarityUniProtKB:Q5BJY9}. Cytoplasm, perinuclear region. Nucleus, nucleolus {Experimental EvidencePubMed:22002106}. Cytoplasm {By SimilarityUniProtKB:Q5BJY9}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Adherens Junction (GO:0005912) Cell Periphery (GO:0071944) Centriolar Satellite (GO:0034451) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Intermediate Filament (GO:0005882) Keratin Filament (GO:0045095) Microtubule Organizing Center (GO:0005815) Nucleolus (GO:0005730) Perinuclear Region Of Cytoplasm (GO:0048471) |
|
Description |
|
|---|---|
| Cirrhosis (CIRRH) [MIM:215600]: A liver disease characterized by severe panlobular liver-cell swelling with Mallory body formation, prominent pericellular fibrosis, and marked deposits of copper. Clinical features include abdomen swelling, jaundice and pulmonary hypertension. {Experimental EvidencePubMed:12724528, Experimental EvidencePubMed:9011570}. Note=The disease is caused by variants affecting the gene represented in this entry. | Database Associations |
| OMIM | 148070 215600 |
| DisGeNET | 3875 |
Interactions with Nuclear Envelope proteins (9 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O15027 | Protein transport protein Sec16A | EBI-11083608 | 0.35 |
| P01112 | GTPase HRas, N-terminally processed | EBI-3930926 | 0.37 |
| P27958 | RNA-directed RNA polymerase | EBI-9350927 | 0.35 |
| P05783 | Self | EBI-10483950 | 0.37 |
| Q14094 | Cyclin-I | EBI-3915486 | 0.37 |
| Q5SQX6 | Cytoplasmic FMR1-interacting protein 2 | EBI-16086797 | 0.35 |
| O75190 | DnaJ homolog subfamily B member 6 | EBI-1255173 | 0.62 |
| Q8WYP5 | Protein ELYS | EBI-20924394 | 0.40 |
| Q8IYI6 | Exocyst complex component 8 | EBI-756712 | 0.37 | Interactions with other proteins (111 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q925J2 | Polycystin 1 | EBI-7985760 | 0.53 |
| P62993 | Growth factor receptor-bound protein 2 (Adapter protein GRB2) (Protein Ash) (SH2/SH3 adapter GRB2) | EBI-297464 | 0.35 |
| P29353 | SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1) | EBI-298042 | 0.27 |
| P05787 | Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) (Type-II keratin Kb8) | EBI-445615 | 0.94 |
| P04049 | RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (Proto-oncogene c-RAF) (cRaf) (Raf-1) | EBI-7291105 | 0.49 |
| P63104 | 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1) | EBI-7293055 | 0.67 |
| Q9BVR6 | Gamma-tubulin complex component | EBI-753352 | 0.37 |
| P19012 | Keratin, type I cytoskeletal 15 (Cytokeratin-15) (CK-15) (Keratin-15) (K15) | EBI-754231 | 0.55 |
| O95751 | Protein LDOC1 (Leucine zipper protein down-regulated in cancer cells) | EBI-756694 | 0.37 |
| Q15834 | Coiled-coil domain-containing protein 85B (Hepatitis delta antigen-interacting protein A) (Delta-interacting protein A) | EBI-757168 | 0.37 |
| O14964 | Hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) (Protein pp110) | EBI-758998 | 0.78 |
| Q9Y5B8 | Nucleoside diphosphate kinase 7 (NDK 7) (NDP kinase 7) (EC 2.7.4.6) (nm23-H7) | EBI-759004 | 0.67 |
| O75688 | Protein phosphatase 1B (EC 3.1.3.16) (Protein phosphatase 2C isoform beta) (PP2C-beta) | EBI-1060989 | 0.00 |
| P23508 | Colorectal mutant cancer protein (Protein MCC) | EBI-1078134 | 0.00 |
| P05452 | Tetranectin (TN) (C-type lectin domain family 3 member B) (Plasminogen kringle 4-binding protein) | EBI-1085136 | 0.00 |
| P02671 | Fibrinogen alpha chain [Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain] | EBI-1255726 | 0.37 |
| P27348 | 14-3-3 protein theta (14-3-3 protein T-cell) (14-3-3 protein tau) (Protein HS1) | EBI-1255734 | 0.37 |
| Q15628 | Tumor necrosis factor receptor type 1-associated DEATH domain protein (TNFR1-associated DEATH domain protein) (TNFRSF1A-associated via death domain) | EBI-1371586 | 0.60 |
| Q8NFJ9 | Bardet-Biedl syndrome 1 protein (BBS2-like protein 2) | EBI-1805760 | 0.44 |
| Q96RK4 | Bardet-Biedl syndrome 4 protein | EBI-1805921 | 0.44 |
| Q9BXC9 | Bardet-Biedl syndrome 2 protein | EBI-1805991 | 0.44 |
| Q8IWZ6 | Bardet-Biedl syndrome 7 protein (BBS2-like protein 1) | EBI-1806052 | 0.44 |
| Q99816 | Tumor susceptibility gene 101 protein (ESCRT-I complex subunit TSG101) | EBI-2339235 | 0.67 |
| Q8NFA0 | Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.4.19.12) (Deubiquitinating enzyme 32) (Renal carcinoma antigen NY-REN-60) (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) | EBI-2513538 | 0.40 |
| O46385 | Supervillin (Archvillin) (p205/p250) | EBI-7872249 | 0.37 |
| P63103 | 14-3-3 protein zeta/delta (Factor activating exoenzyme S) (FAS) (Protein kinase C inhibitor protein 1) (KCIP-1) | EBI-8673294 | 0.35 |
| P63101 | 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1) (SEZ-2) | EBI-8686577 | 0.35 |
| P61981 | 14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed] | EBI-3453257 | 0.00 |
| P28799 | Progranulin (PGRN) (Acrogranin) (Epithelin precursor) (Glycoprotein of 88 Kda) (GP88) (Glycoprotein 88) (Granulin precursor) (PC cell-derived growth factor) (PCDGF) (Proepithelin) (PEPI) [Cleaved into: Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Epithelin-2) (Granulin B); Granulin-4 (Epithelin-1) (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Granulin E)] | EBI-3909889 | 0.37 |
| Q9Y6K9 | NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | EBI-3911087 | 0.57 |
| Q9NUX5 | Protection of telomeres protein 1 (hPot1) (POT1-like telomere end-binding protein) | EBI-3917886 | 0.49 |
| Q99459 | Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein) | EBI-3926990 | 0.37 |
| Q09472 | Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) | EBI-3929095 | 0.37 |
| P52292 | Importin subunit alpha-1 (Karyopherin subunit alpha-2) (RAG cohort protein 1) (SRP1-alpha) | EBI-3931399 | 0.37 |
| O43913 | Origin recognition complex subunit 5 | EBI-3931539 | 0.37 |
| Q96GM5 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (60 kDa BRG-1/Brm-associated factor subunit A) (BRG1-associated factor 60A) (BAF60A) (SWI/SNF complex 60 kDa subunit) | EBI-3931549 | 0.37 |
| Q5VU43 | Myomegalin (Cardiomyopathy-associated protein 2) (Phosphodiesterase 4D-interacting protein) | EBI-3931569 | 0.44 |
| Q14161 | ARF GTPase-activating protein GIT2 (ARF GAP GIT2) (Cool-interacting tyrosine-phosphorylated protein 2) (CAT-2) (CAT2) (G protein-coupled receptor kinase-interactor 2) (GRK-interacting protein 2) | EBI-3931579 | 0.44 |
| Q92837 | Proto-oncogene FRAT1 (Frequently rearranged in advanced T-cell lymphomas 1) (FRAT-1) | EBI-3934896 | 0.37 |
| Q99757 | Thioredoxin, mitochondrial (MTRX) (Mt-Trx) (Thioredoxin-2) | EBI-3938277 | 0.37 |
| Q6PKC3 | Thioredoxin domain-containing protein 11 (EF-hand-binding protein 1) | EBI-3939414 | 0.37 |
| Q8N2W9 | E3 SUMO-protein ligase PIAS4 (EC 2.3.2.27) (PIASy) (Protein inhibitor of activated STAT protein 4) (Protein inhibitor of activated STAT protein gamma) (PIAS-gamma) | EBI-3939424 | 0.37 |
| Q96MU7 | YTH domain-containing protein 1 (Splicing factor YT521) (YT521-B) | EBI-3939434 | 0.37 |
| P15336 | Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response element-binding protein CRE-BP1) | EBI-5529812 | 0.35 |
| Q12815 | Tastin (Trophinin-assisting protein) (Trophinin-associated protein) | EBI-5652482 | 0.31 |
| Q13895 | Bystin | EBI-5652463 | 0.31 |
| P19320 | Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106) | EBI-6190694 | 0.53 |
| P02751 | Fibronectin (FN) (Cold-insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl-Y1; Ugl-Y2; Ugl-Y3] | EBI-6285956 | 0.35 |
| P04792 | Heat shock protein beta-1 (HspB1) (28 kDa heat shock protein) (Estrogen-regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP 27) (Stress-responsive protein 27) (SRP27) | EBI-6871566 | 0.37 |
| P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-6898303 | 0.53 |
| Q99959 | Plakophilin-2 | EBI-9074403 | 0.40 |
| Q13835 | Plakophilin-1 (Band 6 protein) (B6P) | EBI-9073560 | 0.58 |
| Q08379 | Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95) | EBI-10194630 | 0.78 |
| Q8IYE0 | Coiled-coil domain-containing protein 146 | EBI-10263041 | 0.56 |
| Q96CS2 | HAUS augmin-like complex subunit 1 (Coiled-coil domain-containing protein 5) (Enhancer of invasion-cluster) (HEI-C) | EBI-10283572 | 0.56 |
| Q9D7I8 | Protein FAM83D | EBI-11048266 | 0.35 |
| P63167 | Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) | EBI-11051725 | 0.35 |
| A0A0S2Z505 | Proline-serine-threonine phosphatase interacting protein 2 isoform 3 (Proline-serine-threonine phosphatase interacting protein 2, isoform CRA_a) | EBI-16437711 | 0.56 |
| P07196 | Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein) | EBI-16437697 | 0.56 |
| A0A0S2Z4Q4 | Hepatocyte growth factor-regulated tyrosine kinase substrate | EBI-16437687 | 0.56 |
| Q5JVL4 | EF-hand domain-containing protein 1 (Myoclonin-1) | EBI-24291369 | 0.56 |
| Q3SY84 | Keratin, type II cytoskeletal 71 (Cytokeratin-71) (CK-71) (Keratin-71) (K71) (Type II inner root sheath-specific keratin-K6irs1) (Keratin 6 irs) (hK6irs) (hK6irs1) (Type-II keratin Kb34) | EBI-24361934 | 0.56 |
| P02538 | Keratin, type II cytoskeletal 6A (Cytokeratin-6A) (CK-6A) (Cytokeratin-6D) (CK-6D) (Keratin-6A) (K6A) (Type-II keratin Kb6) (allergen Hom s 5) | EBI-24367348 | 0.56 |
| Q5XKE5 | Keratin, type II cytoskeletal 79 (Cytokeratin-79) (CK-79) (Keratin-6-like) (Keratin-6L) (Keratin-79) (K79) (Type-II keratin Kb38) | EBI-24620654 | 0.56 |
| Q9NX04 | Ribosome biogenesis protein C1orf109 | EBI-24396239 | 0.56 |
| P48668 | Keratin, type II cytoskeletal 6C (Cytokeratin-6C) (CK-6C) (Cytokeratin-6E) (CK-6E) (Keratin K6h) (Keratin-6C) (K6C) (Type-II keratin Kb12) | EBI-24419624 | 0.68 |
| Q9P2K3 | REST corepressor 3 | EBI-24420285 | 0.56 |
| Q9BVG8 | Kinesin-like protein KIFC3 | EBI-24553060 | 0.56 |
| Q8WW24 | Tektin-4 | EBI-24557965 | 0.56 |
| Q14533 | Keratin, type II cuticular Hb1 (Hair keratin K2.9) (Keratin, hair, basic, 1) (Keratin-81) (K81) (Metastatic lymph node 137 gene protein) (MLN 137) (Type II hair keratin Hb1) (Type-II keratin Kb21) (ghHKb1) (ghHb1) | EBI-24563479 | 0.56 |
| Q8TD31 | Coiled-coil alpha-helical rod protein 1 (Alpha-helical coiled-coil rod protein) (Putative gene 8 protein) (Pg8) | EBI-24572327 | 0.56 |
| Q8N0S2 | Synaptonemal complex central element protein 1 (Cancer/testis antigen 76) (CT76) | EBI-12703058 | 0.56 |
| O75022 | Leukocyte immunoglobulin-like receptor subfamily B member 3 (LIR-3) (Leukocyte immunoglobulin-like receptor 3) (CD85 antigen-like family member A) (Immunoglobulin-like transcript 5) (ILT-5) (Monocyte inhibitory receptor HL9) (CD antigen CD85a) | EBI-14032442 | 0.43 |
| Q14457 | Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa] | EBI-16020615 | 0.50 |
| Q9BQ69 | ADP-ribose glycohydrolase MACROD1 (MACRO domain-containing protein 1) (O-acetyl-ADP-ribose deacetylase MACROD1) (EC 3.1.1.106) (Protein LRP16) ([Protein ADP-ribosylaspartate] hydrolase MACROD1) (EC 3.2.2.-) ([Protein ADP-ribosylglutamate] hydrolase MACROD1) (EC 3.2.2.-) | EBI-16880214 | 0.65 |
| P61417 | Chaperone protein YscY (Yop proteins translocation protein Y) | EBI-20817152 | 0.37 |
| P61416 | Yop proteins translocation protein X | EBI-20817281 | 0.37 |
| P68640 | Outer membrane protein YopN (LcrE) (Yop4b) | EBI-20817402 | 0.37 |
| O30878 | Putative type III secretion protein (Type III secretion protein) (Type III secretion spans bacterial envelope protein) (Yop proteins translocation protein O) (YscO) | EBI-20817508 | 0.37 |
| P69974 | Yop proteins translocation protein K (Low calcium response locus protein KB) | EBI-20817667 | 0.37 |
| A0A5P8YI02 | Attachment invasion locus protein | EBI-20818482 | 0.37 |
| Q0WD22 | Putative fimbrial biogenesis protein | EBI-20818419 | 0.37 |
| Q86U44 | N6-adenosine-methyltransferase catalytic subunit (EC 2.1.1.348) (Methyltransferase-like protein 3) (hMETTL3) (N6-adenosine-methyltransferase 70 kDa subunit) (MT-A70) | EBI-20594935 | 0.35 |
| Q9HCE5 | N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14) | EBI-20595531 | 0.35 |
| A0A087WXM9 | Meiosis-specific kinetochore protein | EBI-20917996 | 0.40 |
| P08670 | Vimentin | EBI-20917772 | 0.40 |
| Q5HYC2 | Uncharacterized protein KIAA2026 | EBI-20918276 | 0.40 |
| Q15149 | Plectin (PCN) (PLTN) (Hemidesmosomal protein 1) (HD1) (Plectin-1) | EBI-20919124 | 0.40 |
| Q96M95 | Coiled-coil domain-containing protein 42 | EBI-20921148 | 0.40 |
| Q12860 | Contactin-1 (Glycoprotein gp135) (Neural cell surface protein F3) | EBI-20920940 | 0.40 |
| Q8WWL7 | G2/mitotic-specific cyclin-B3 | EBI-20922150 | 0.40 |
| Q8IYB4 | PEX5-related protein (PEX2-related protein) (PEX5-like protein) (Peroxin-5-related protein) (Peroxisome biogenesis factor 5-like) (Tetratricopeptide repeat-containing Rab8b-interacting protein) (Pex5Rp) (TRIP8b) | EBI-20926658 | 0.40 |
| P01730 | T-cell surface glycoprotein CD4 (T-cell surface antigen T4/Leu-3) (CD antigen CD4) | EBI-20930576 | 0.40 |
| Q9Y616 | Interleukin-1 receptor-associated kinase 3 (IRAK-3) (IL-1 receptor-associated kinase M) (IRAK-M) (Inactive IL-1 receptor-associated kinase 3) | EBI-20935164 | 0.40 |
| Q9NY99 | Gamma-2-syntrophin (G2SYN) (Syntrophin-5) (SYN5) | EBI-20938524 | 0.40 |
| Q66PJ3 | ADP-ribosylation factor-like protein 6-interacting protein 4 (ARL-6-interacting protein 4) (Aip-4) (HSP-975) (HSVI-binding protein) (SR-15) (SRp25) (SR-25) (Splicing factor SRrp37) | EBI-20938316 | 0.40 |
| A2A935 | Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1) | EBI-21022882 | 0.35 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| Q14108 | Lysosome membrane protein 2 (85 kDa lysosomal membrane sialoglycoprotein) (LGP85) (CD36 antigen-like 2) (Lysosome membrane protein II) (LIMP II) (Scavenger receptor class B member 2) (CD antigen CD36) | EBI-21264396 | 0.35 |
| B7UM99 | Translocated intimin receptor Tir (Secreted effector protein Tir) | EBI-22228314 | 0.66 |
| P61158 | Actin-related protein 3 (Actin-like protein 3) | EBI-22229062 | 0.27 |
| Q96CS3 | FAS-associated factor 2 (Protein ETEA) (UBX domain-containing protein 3B) (UBX domain-containing protein 8) | EBI-25770166 | 0.35 |
| Q8IWF2 | FAD-dependent oxidoreductase domain-containing protein 2 (Endoplasmic reticulum flavoprotein associated with degradation) | EBI-25770736 | 0.35 |
| P42858 | Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment] | EBI-25951430 | 0.56 |
| P51114 | RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p) | EBI-26510698 | 0.37 |
| P51116 | RNA-binding protein FXR2 (FMR1 autosomal homolog 2) | EBI-26511933 | 0.37 |
| Q53F19 | Nuclear cap-binding protein subunit 3 (Protein ELG) | EBI-26396827 | 0.35 |
| F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27109494 | 0.35 |
| Q9UNH5 | Dual specificity protein phosphatase CDC14A (EC 3.1.3.16) (EC 3.1.3.48) (CDC14 cell division cycle 14 homolog A) | EBI-27115490 | 0.27 |
| Q13283 | Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1) | EBI-28955349 | 0.35 |
Database | Links |
| UNIPROT | P05783 Q53G38 Q5U0N8 Q9BW26 |
| Pfam | PF00038 |
| PROSITE | PS00226 PS51842 |
| OMIM | 148070 215600 |
| DisGeNET | 3875 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory