Proto-oncogene tyrosine-protein kinase Src - Homo sapiens

Proto-oncogene tyrosine-protein kinase Src (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Proto-oncogene tyrosine-protein kinase Src
Accession Code	P12931
Gene	SRC
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 536)
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAG PLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRE SERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKL RHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGEN LVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL

Structure Viewer (PDB: 1A1C)

Subcellular Location

Description
Cell membrane {Experimental EvidencePubMed:7525268}; Lipid-anchor {Experimental EvidencePubMed:22801373}. Mitochondrion inner membrane {Experimental EvidencePubMed:12615910}. Nucleus {Experimental EvidencePubMed:7853507}. Cytoplasm, cytoskeleton {Experimental EvidencePubMed:7525268}. Cytoplasm, perinuclear region {ECO:0000269\|PubMed:19307596}. Cell junction, focal adhesion {Experimental EvidencePubMed:22801373}. Note=Localizes to focal adhesion sites following integrin engagement (PubMed:22801373). Localization to focal adhesion sites requires myristoylation and the SH3 domain (PubMed:7525268). Colocalizes with PDLIM4 at the perinuclear region, but not at focal adhesions (PubMed:19307596). {ECO:0000269\|PubMed:19307596, Experimental EvidencePubMed:22801373, Experimental EvidencePubMed:7525268}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	Experimental Evidence {ECO:0000269\|PubMed:7525268}
Assigned Ontology terms

Cellular Component	Actin Filament (GO:0005884) Caveola (GO:0005901) Cell Junction (GO:0030054) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Dendritic Filopodium (GO:1902737) Dendritic Growth Cone (GO:0044294) Extracellular Exosome (GO:0070062) Extrinsic Component Of Cytoplasmic Side Of Plasma Membrane (GO:0031234) Focal Adhesion (GO:0005925) Glutamatergic Synapse (GO:0098978) Late Endosome (GO:0005770) Lysosome (GO:0005764) Membrane Raft (GO:0045121) Mitochondrial Inner Membrane (GO:0005743) Mitochondrion (GO:0005739) Neuronal Cell Body (GO:0043025) Nucleoplasm (GO:0005654) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Podosome (GO:0002102) Postsynaptic Density (GO:0014069) Postsynaptic Specialization, Intracellular Component (GO:0099091) Ruffle Membrane (GO:0032587) Synaptic Membrane (GO:0097060)

Biology & Function

Description
Non-receptor protein tyrosine kinase which is activated following engagement of many different classes of cellular receptors including immune response receptors, integrins and other adhesion receptors, receptor protein tyrosine kinases, G protein-coupled receptors as well as cytokine receptors. Participates in signaling pathways that control a diverse spectrum of biological activities including gene transcription, immune response, cell adhesion, cell cycle progression, apoptosis, migration, and transformation. Due to functional redundancy between members of the SRC kinase family, identification of the specific role of each SRC kinase is very difficult. SRC appears to be one of the primary kinases activated following engagement of receptors and plays a role in the activation of other protein tyrosine kinase (PTK) families. Receptor clustering or dimerization leads to recruitment of SRC to the receptor complexes where it phosphorylates the tyrosine residues within the receptor cytoplasmic domains. Plays an important role in the regulation of cytoskeletal organization through phosphorylation of specific substrates such as AFAP1. Phosphorylation of AFAP1 allows the SRC SH2 domain to bind AFAP1 and to localize to actin filaments. Cytoskeletal reorganization is also controlled through the phosphorylation of cortactin (CTTN) (Probable). When cells adhere via focal adhesions to the extracellular matrix, signals are transmitted by integrins into the cell resulting in tyrosine phosphorylation of a number of focal adhesion proteins, including PTK2/FAK1 and paxillin (PXN) (PubMed:21411625). In addition to phosphorylating focal adhesion proteins, SRC is also active at the sites of cell-cell contact adherens junctions and phosphorylates substrates such as beta-catenin (CTNNB1), delta-catenin (CTNND1), and plakoglobin (JUP). Another type of cell- cell junction, the gap junction, is also a target for SRC, which phosphorylates connexin-43 (GJA1). SRC is implicated in regulation of pre-mRNA-processing and phosphorylates RNA-binding proteins such as KHDRBS1 (Probable). Also plays a role in PDGF-mediated tyrosine phosphorylation of both STAT1 and STAT3, leading to increased DNA binding activity of these transcription factors (By similarity). Involved in the RAS pathway through phosphorylation of RASA1 and RASGRF1 (PubMed:11389730). Plays a role in EGF-mediated calcium- activated chloride channel activation (PubMed:18586953). Required for epidermal growth factor receptor (EGFR) internalization through phosphorylation of clathrin heavy chain (CLTC and CLTCL1) at 'Tyr- 1477'. Involved in beta-arrestin (ARRB1 and ARRB2) desensitization through phosphorylation and activation of GRK2, leading to beta- arrestin phosphorylation and internalization. Has a critical role in the stimulation of the CDK20/MAPK3 mitogen-activated protein kinase cascade by epidermal growth factor (Probable). Might be involved not only in mediating the transduction of mitogenic signals at the level of the plasma membrane but also in controlling progression through the cell cycle via interaction with regulatory proteins in the nucleus (PubMed:7853507). Plays an important role in osteoclastic bone resorption in conjunction with PTK2B/PYK2. Both the formation of a SRC- PTK2B/PYK2 complex and SRC kinase activity are necessary for this function. Recruited to activated integrins by PTK2B/PYK2, thereby phosphorylating CBL, which in turn induces the activation and recruitment of phosphatidylinositol 3-kinase to the cell membrane in a signaling pathway that is critical for osteoclast function (PubMed:8755529, PubMed:14585963). Promotes energy production in osteoclasts by activating mitochondrial cytochrome C oxidase (PubMed:12615910). Phosphorylates DDR2 on tyrosine residues, thereby promoting its subsequent autophosphorylation (PubMed:16186108). Phosphorylates RUNX3 and COX2 on tyrosine residues, TNK2 on 'Tyr-284' and CBL on 'Tyr-731' (PubMed:20100835, PubMed:21309750). Enhances DDX58/RIG-I-elicited antiviral signaling (PubMed:19419966). Phosphorylates PDPK1 at 'Tyr-9', 'Tyr-373' and 'Tyr-376' (PubMed:14585963). Phosphorylates BCAR1 at 'Tyr-128' (PubMed:22710723). Phosphorylates CBLC at multiple tyrosine residues, phosphorylation at 'Tyr-341' activates CBLC E3 activity (PubMed:20525694). Phosphorylates synaptic vesicle protein synaptophysin (SYP) (By similarity). Involved in anchorage-independent cell growth (PubMed:19307596). Required for podosome formation (By similarity). Mediates IL6 signaling by activating YAP1-NOTCH pathway to induce inflammation-induced epithelial regeneration (PubMed:25731159). {By SimilarityUniProtKB:P05480, By SimilarityUniProtKB:Q9WUD9, Experimental EvidencePubMed:11389730, Experimental EvidencePubMed:12615910, Experimental EvidencePubMed:14585963, Experimental EvidencePubMed:16186108, Experimental EvidencePubMed:18586953, Experimental EvidencePubMed:19307596, Experimental EvidencePubMed:19419966, Experimental EvidencePubMed:20100835, Experimental EvidencePubMed:20525694, Experimental EvidencePubMed:21309750, Experimental EvidencePubMed:21411625, Experimental EvidencePubMed:22710723, Experimental EvidencePubMed:25731159, Experimental EvidencePubMed:7853507, Experimental EvidencePubMed:8755529, Experimental EvidencePubMed:8759729, Curator InferencePubMed:11964124, Curator InferencePubMed:8672527, Curator InferencePubMed:9442882}. [Isoform 1]: Non-receptor protein tyrosine kinase which phosphorylates synaptophysin with high affinity. {By SimilarityUniProtKB:Q9WUD9}. [Isoform 2]: Non-receptor protein tyrosine kinase which shows higher basal kinase activity than isoform 1, possibly due to weakened intramolecular interactions which enhance autophosphorylation of Tyr- 419 and subsequent activation (By similarity). The SH3 domain shows reduced affinity with the linker sequence between the SH2 and kinase domains which may account for the increased basal activity (By similarity). Displays altered substrate specificity compared to isoform 1, showing weak affinity for synaptophysin and for peptide substrates containing class I or class II SH3 domain-binding motifs (By similarity). Plays a role in L1CAM-mediated neurite elongation, possibly by acting downstream of L1CAM to drive cytoskeletal rearrangements involved in neurite outgrowth (By similarity). {By SimilarityUniProtKB:Q9WUD9}. [Isoform 3]: Non-receptor protein tyrosine kinase which shows higher basal kinase activity than isoform 1, possibly due to weakened intramolecular interactions which enhance autophosphorylation of Tyr- 419 and subsequent activation (By similarity). The SH3 domain shows reduced affinity with the linker sequence between the SH2 and kinase domains which may account for the increased basal activity (By similarity). Displays altered substrate specificity compared to isoform 1, showing weak affinity for synaptophysin and for peptide substrates containing class I or class II SH3 domain-binding motifs (By similarity). Plays a role in neurite elongation (By similarity). {By SimilarityUniProtKB:Q9WUD9}.
Assigned Ontology terms

Biological Process	Activation Of Protein Kinase B Activity (GO:0032148) Adherens Junction Organization (GO:0034332) Angiotensin-Activated Signaling Pathway Involved In Heart Process (GO:0086098) Bone Resorption (GO:0045453) Branching Involved In Mammary Gland Duct Morphogenesis (GO:0060444) Cell Adhesion (GO:0007155) Cell Cycle (GO:0007049) Cell Differentiation (GO:0030154) Cell-Cell Adhesion (GO:0098609) Cellular Response To Fatty Acid (GO:0071398) Cellular Response To Fluid Shear Stress (GO:0071498) Cellular Response To Hydrogen Peroxide (GO:0070301) Cellular Response To Hypoxia (GO:0071456) Cellular Response To Insulin Stimulus (GO:0032869) Cellular Response To Lipopolysaccharide (GO:0071222) Cellular Response To Peptide Hormone Stimulus (GO:0071375) Cellular Response To Platelet-Derived Growth Factor Stimulus (GO:0036120) Cellular Response To Progesterone Stimulus (GO:0071393) Cellular Response To Prolactin (GO:1990646) DNA Biosynthetic Process (GO:0071897) Entry Of Bacterium Into Host Cell (GO:0035635) Ephrin Receptor Signaling Pathway (GO:0048013) Epidermal Growth Factor Receptor Signaling Pathway (GO:0007173) ERBB2 Signaling Pathway (GO:0038128) Fc-Gamma Receptor Signaling Pathway Involved In Phagocytosis (GO:0038096) Focal Adhesion Assembly (GO:0048041) Forebrain Development (GO:0030900) Innate Immune Response (GO:0045087) Integrin-Mediated Signaling Pathway (GO:0007229) Interleukin-6-Mediated Signaling Pathway (GO:0070102) Intestinal Epithelial Cell Development (GO:0060576) Intracellular Signal Transduction (GO:0035556) Learning Or Memory (GO:0007611) Leukocyte Migration (GO:0050900) Macroautophagy (GO:0016236) Myoblast Proliferation (GO:0051450) Negative Regulation Of Anoikis (GO:2000811) Negative Regulation Of Apoptotic Process (GO:0043066) Negative Regulation Of Cysteine-Type Endopeptidase Activity Involved In Apoptotic Process (GO:0043154) Negative Regulation Of DNA-Templated Transcription (GO:0045892) Negative Regulation Of Extrinsic Apoptotic Signaling Pathway (GO:2001237) Negative Regulation Of Focal Adhesion Assembly (GO:0051895) Negative Regulation Of Inflammatory Response To Antigenic Stimulus (GO:0002862) Negative Regulation Of Intrinsic Apoptotic Signaling Pathway (GO:2001243) Negative Regulation Of Mitochondrial Depolarization (GO:0051902) Negative Regulation Of Protein-Containing Complex Assembly (GO:0031333) Negative Regulation Of Telomerase Activity (GO:0051974) Negative Regulation Of Telomere Maintenance Via Telomerase (GO:0032211) Neurotrophin TRK Receptor Signaling Pathway (GO:0048011) Odontogenesis (GO:0042476) Oogenesis (GO:0048477) Osteoclast Development (GO:0036035) Peptidyl-Serine Phosphorylation (GO:0018105) Peptidyl-Tyrosine Autophosphorylation (GO:0038083) Peptidyl-Tyrosine Phosphorylation (GO:0018108) Platelet Activation (GO:0030168) Positive Regulation Of Apoptotic Process (GO:0043065) Positive Regulation Of Bone Resorption (GO:0045780) Positive Regulation Of Canonical Wnt Signaling Pathway (GO:0090263) Positive Regulation Of Cyclin-Dependent Protein Serine/Threonine Kinase Activity (GO:0045737) Positive Regulation Of Cytokine Production (GO:0001819) Positive Regulation Of Dephosphorylation (GO:0035306) Positive Regulation Of DNA Biosynthetic Process (GO:2000573) Positive Regulation Of DNA-Templated Transcription (GO:0045893) Positive Regulation Of Epithelial Cell Migration (GO:0010634) Positive Regulation Of ERK1 And ERK2 Cascade (GO:0070374) Positive Regulation Of Glucose Metabolic Process (GO:0010907) Positive Regulation Of Hippo Signaling (GO:0035332) Positive Regulation Of Insulin Receptor Signaling Pathway (GO:0046628) Positive Regulation Of Integrin Activation (GO:0033625) Positive Regulation Of Lamellipodium Morphogenesis (GO:2000394) Positive Regulation Of Male Germ Cell Proliferation (GO:2000256) Positive Regulation Of MAP Kinase Activity (GO:0043406) Positive Regulation Of Non-Membrane Spanning Protein Tyrosine Kinase Activity (GO:1903997) Positive Regulation Of Notch Signaling Pathway (GO:0045747) Positive Regulation Of Ovarian Follicle Development (GO:2000386) Positive Regulation Of Peptidyl-Tyrosine Phosphorylation (GO:0050731) Positive Regulation Of Phosphatidylinositol 3-Kinase Activity (GO:0043552) Positive Regulation Of Phosphatidylinositol 3-Kinase Signaling (GO:0014068) Positive Regulation Of Platelet-Derived Growth Factor Receptor-Beta Signaling Pathway (GO:2000588) Positive Regulation Of Podosome Assembly (GO:0071803) Positive Regulation Of Protein Autophosphorylation (GO:0031954) Positive Regulation Of Protein Kinase B Signaling (GO:0051897) Positive Regulation Of Protein Localization To Nucleus (GO:1900182) Positive Regulation Of Protein Processing (GO:0010954) Positive Regulation Of Protein Serine/Threonine Kinase Activity (GO:0071902) Positive Regulation Of Protein Transport (GO:0051222) Positive Regulation Of Ras Protein Signal Transduction (GO:0046579) Positive Regulation Of Small GTPase Mediated Signal Transduction (GO:0051057) Positive Regulation Of Smooth Muscle Cell Migration (GO:0014911) Positive Regulation Of Vascular Associated Smooth Muscle Cell Proliferation (GO:1904707) Primary Ovarian Follicle Growth (GO:0001545) Progesterone Receptor Signaling Pathway (GO:0050847) Protein Autophosphorylation (GO:0046777) Protein Destabilization (GO:0031648) Regulation Of Bone Resorption (GO:0045124) Regulation Of Caveolin-Mediated Endocytosis (GO:2001286) Regulation Of Cell Projection Assembly (GO:0060491) Regulation Of Cell-Cell Adhesion (GO:0022407) Regulation Of Early Endosome To Late Endosome Transport (GO:2000641) Regulation Of Epithelial Cell Migration (GO:0010632) Regulation Of Intracellular Estrogen Receptor Signaling Pathway (GO:0033146) Regulation Of Postsynaptic Neurotransmitter Receptor Activity (GO:0098962) Regulation Of Protein Binding (GO:0043393) Regulation Of Vascular Permeability (GO:0043114) Response To Acidic PH (GO:0010447) Response To Electrical Stimulus (GO:0051602) Response To Interleukin-1 (GO:0070555) Response To Mechanical Stimulus (GO:0009612) Response To Mineralocorticoid (GO:0051385) Response To Nutrient Levels (GO:0031667) Response To Virus (GO:0009615) Response To Xenobiotic Stimulus (GO:0009410) Signal Complex Assembly (GO:0007172) Signal Transduction (GO:0007165) Skeletal Muscle Cell Proliferation (GO:0014856) Spermatogenesis (GO:0007283) Stimulatory C-Type Lectin Receptor Signaling Pathway (GO:0002223) Stress Fiber Assembly (GO:0043149) Substrate Adhesion-Dependent Cell Spreading (GO:0034446) T Cell Costimulation (GO:0031295) Transcytosis (GO:0045056) Transforming Growth Factor Beta Receptor Signaling Pathway (GO:0007179) Transmembrane Receptor Protein Tyrosine Kinase Signaling Pathway (GO:0007169) Uterus Development (GO:0060065) Vascular Endothelial Growth Factor Receptor Signaling Pathway (GO:0048010)
Molecular Function	ATP Binding (GO:0005524) ATPase Binding (GO:0051117) BMP Receptor Binding (GO:0070700) Cadherin Binding (GO:0045296) Connexin Binding (GO:0071253) Enzyme Binding (GO:0019899) Ephrin Receptor Binding (GO:0046875) Growth Factor Receptor Binding (GO:0070851) Heme Binding (GO:0020037) Insulin Receptor Binding (GO:0005158) Integrin Binding (GO:0005178) Lipid Binding (GO:0008289) Non-Membrane Spanning Protein Tyrosine Kinase Activity (GO:0004715) Nuclear Estrogen Receptor Binding (GO:0030331) Phospholipase Activator Activity (GO:0016004) Phospholipase Binding (GO:0043274) Phosphoprotein Binding (GO:0051219) Protein C-Terminus Binding (GO:0008022) Protein Kinase Activity (GO:0004672) Protein Kinase C Binding (GO:0005080) Protein Tyrosine Kinase Activity (GO:0004713) Scaffold Protein Binding (GO:0097110) SH2 Domain Binding (GO:0042169) Signaling Receptor Binding (GO:0005102) Transmembrane Transporter Binding (GO:0044325)

Disease associations

Description
Note=SRC kinase activity has been shown to be increased in several tumor tissues and tumor cell lines such as colon carcinoma cells. {Experimental EvidencePubMed:2498394, Experimental EvidencePubMed:3093483}. Thrombocytopenia 6 (THC6) [MIM:616937]: A form of thrombocytopenia, a hematologic disorder defined by a decrease in the number of platelets in circulating blood, resulting in the potential for increased bleeding and decreased ability for clotting. THC6 is an autosomal dominant form. Affected individuals may also have bone abnormalities and an increased risk for myelofibrosis. {Experimental EvidencePubMed:26936507}. Note=The disease is caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	190090 616937
DisGeNET	6714

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (21 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P12931	Self	EBI-7173747	0.44
P21980	Protein-glutamine gamma-glutamyltransferase 2	EBI-15828007	0.40
Q9WUD9	Proto-oncogene tyrosine-protein kinase Src	EBI-22249049	0.35
Q8TEL6	Short transient receptor potential channel 4-associated protein	EBI-28931938	0.35
P00519	Tyrosine-protein kinase ABL1	EBI-7286298	0.59
O43707	Alpha-actinin-4	EBI-25384369	0.35
Q13023	A-kinase anchor protein 6	EBI-1960946	0.40
Q9NQI0	Probable ATP-dependent RNA helicase DDX4	EBI-7609853	0.40
P00533	Epidermal growth factor receptor	EBI-7248693	0.90
P04626	Receptor tyrosine-protein kinase erbB-2	EBI-8289901	0.71
P70424	Receptor tyrosine-protein kinase erbB-2	EBI-5451946	0.40
Q05397	Focal adhesion kinase 1	EBI-968957	0.92
P34152	Focal adhesion kinase 1	EBI-7921275	0.56
Q14289	Protein-tyrosine kinase 2-beta	EBI-7095687	0.64
Q05655	Protein kinase C delta type catalytic subunit	EBI-7607017	0.40
Q14693	Phosphatidate phosphatase LPIN1	EBI-25892196	0.56
Q96AG4	Leucine-rich repeat-containing protein 59, N-terminally processed	EBI-25384369	0.35
P07948	Tyrosine-protein kinase Lyn	EBI-11359552	0.67
Q13177	PAK-2p34	EBI-7975714	0.52
P0DTD1	2'-O-methyltransferase nsp16	EBI-27092586	0.44
P01112	GTPase HRas, N-terminally processed	EBI-8633225	0.57
Interactions with other proteins (380 interactors)

Partner (UniProt)		IntAct	Confidence score
P25962	Beta-3 adrenergic receptor (Beta-3 adrenoreceptor) (Beta-3 adrenoceptor)	EBI-7406154	0.54
P15941	Mucin-1 (MUC-1) (Breast carcinoma-associated antigen DF3) (Cancer antigen 15-3) (CA 15-3) (Carcinoma-associated mucin) (Episialin) (H23AG) (Krebs von den Lungen-6) (KL-6) (PEMT) (Peanut-reactive urinary mucin) (PUM) (Polymorphic epithelial mucin) (PEM) (Tumor-associated epithelial membrane antigen) (EMA) (Tumor-associated mucin) (CD antigen CD227) [Cleaved into: Mucin-1 subunit alpha (MUC1-NT) (MUC1-alpha); Mucin-1 subunit beta (MUC1-beta) (MUC1-CT)]	EBI-7913825	0.75
P17302	Gap junction alpha-1 protein (Connexin-43) (Cx43) (Gap junction 43 kDa heart protein)	EBI-7413469	0.35
Q16832	Discoidin domain-containing receptor 2 (Discoidin domain receptor 2) (EC 2.7.10.1) (CD167 antigen-like family member B) (Discoidin domain-containing receptor tyrosine kinase 2) (Neurotrophic tyrosine kinase, receptor-related 3) (Receptor protein-tyrosine kinase TKT) (Tyrosine-protein kinase TYRO10) (CD antigen CD167b)	EBI-8168082	0.40
Q03135	Caveolin-1	EBI-8675931	0.32
Q02248	Catenin beta-1 (Beta-catenin)	EBI-8624542	0.44
Q8R5G7	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 (Centaurin-delta-3) (Cnt-d3) (Dual specificity Rho- and Arf-GTPase-activating protein 1)	EBI-621510	0.56
Q9H5V8	CUB domain-containing protein 1 (Membrane glycoprotein gp140) (Subtractive immunization M plus HEp3-associated 135 kDa protein) (SIMA135) (Transmembrane and associated with src kinases) (CD antigen CD318)	EBI-7606952	0.79
Q05193	Dynamin-1 (EC 3.6.5.5)	EBI-7591679	0.44
P50570	Dynamin-2 (EC 3.6.5.5)	EBI-7591812	0.44
Q60749	KH domain-containing, RNA-binding, signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68)	EBI-697861	0.44
Q9Y6K9	NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)	EBI-697929	0.50
O15111	Inhibitor of nuclear factor kappa-B kinase subunit alpha (I-kappa-B kinase alpha) (IKK-A) (IKK-alpha) (IkBKA) (IkappaB kinase) (EC 2.7.11.10) (Conserved helix-loop-helix ubiquitous kinase) (I-kappa-B kinase 1) (IKK1) (Nuclear factor NF-kappa-B inhibitor kinase alpha) (NFKBIKA) (Transcription factor 16) (TCF-16)	EBI-697951	0.35
O14920	Inhibitor of nuclear factor kappa-B kinase subunit beta (I-kappa-B-kinase beta) (IKK-B) (IKK-beta) (IkBKB) (EC 2.7.11.10) (I-kappa-B kinase 2) (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB) (Serine/threonine protein kinase IKBKB) (EC 2.7.11.1)	EBI-697951	0.35
Q07666	KH domain-containing, RNA-binding, signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68)	EBI-2437436	0.57
Q8WUM4	Programmed cell death 6-interacting protein (PDCD6-interacting protein) (ALG-2-interacting protein 1) (ALG-2-interacting protein X) (Hp95)	EBI-7397413	0.65
P03407	Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein]	EBI-7355101	0.40
Q9QPN3	Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein]	EBI-7355187	0.40
P04604	Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein]	EBI-7355423	0.40
P21860	Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3)	EBI-7885161	0.44
P52800	Ephrin-B2 (ELF-2) (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L)	EBI-8107779	0.40
P12814	Alpha-actinin-1 (Alpha-actinin cytoskeletal isoform) (F-actin cross-linking protein) (Non-muscle alpha-actinin-1)	EBI-968854	0.52
Q90VU7	Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein]	EBI-7975353	0.40
Q13444	Disintegrin and metalloproteinase domain-containing protein 15 (ADAM 15) (EC 3.4.24.-) (Metalloprotease RGD disintegrin protein) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metargidin)	EBI-7976357	0.75
O15455	Toll-like receptor 3 (CD antigen CD283)	EBI-8580898	0.46
P09848	Lactase/phlorizin hydrolase (Lactase/glycosylceramidase) [Includes: Lactase (EC 3.2.1.108); Glycosylceramidase (EC 3.2.1.62) (Phlorizin hydrolase)]	EBI-7047891	0.44
P06241	Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn)	EBI-6967679	0.56
P42227	Signal transducer and activator of transcription 3 (Acute-phase response factor)	EBI-1163828	0.44
Q63767	Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (p130cas)	EBI-1176840	0.44
P22681	E3 ubiquitin-protein ligase CBL (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene) (Proto-oncogene c-Cbl) (RING finger protein 55) (RING-type E3 ubiquitin transferase CBL) (Signal transduction protein CBL)	EBI-7146896	0.84
P07550	Beta-2 adrenergic receptor (Beta-2 adrenoreceptor) (Beta-2 adrenoceptor)	EBI-7173594	0.61
P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	EBI-1200966	0.44
Q9H204	Mediator of RNA polymerase II transcription subunit 28 (Endothelial-derived protein 1) (Mediator complex subunit 28) (Merlin and Grb2-interacting cytoskeletal protein) (Magicin) (Tumor angiogenesis marker EG-1)	EBI-1206815	0.66
P55196	Afadin (ALL1-fused gene from chromosome 6 protein) (Protein AF-6) (Afadin adherens junction formation factor)	EBI-7407779	0.65
Q9C0H9	SRC kinase signaling inhibitor 1 (SNAP-25-interacting protein) (SNIP) (p130Cas-associated protein) (p140Cap)	EBI-2658373	0.40
P41240	Tyrosine-protein kinase CSK (EC 2.7.10.2) (C-Src kinase) (Protein-tyrosine kinase CYL)	EBI-2658427	0.40
Q9QWI6	SRC kinase signaling inhibitor 1 (SNAP-25-interacting protein) (SNIP) (p130Cas-associated protein) (p140Cap)	EBI-2658513	0.40
Q9ULH1	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein) (ADP-ribosylation factor-directed GTPase-activating protein 1) (ARF GTPase-activating protein 1) (Development and differentiation-enhancing factor 1) (DEF-1) (Differentiation-enhancing factor 1) (PIP2-dependent ARF1 GAP)	EBI-1960274	0.61
Q92988	Homeobox protein DLX-4 (Beta protein 1) (Homeobox protein DLX-7) (Homeobox protein DLX-8)	EBI-1960262	0.40
Q8IZD9	Dedicator of cytokinesis protein 3 (Modifier of cell adhesion) (Presenilin-binding protein) (PBP)	EBI-1960286	0.40
O15360	Fanconi anemia group A protein (Protein FACA)	EBI-1960310	0.40
P43699	Homeobox protein Nkx-2.1 (Homeobox protein NK-2 homolog A) (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) (Thyroid-specific enhancer-binding protein) (T/EBP)	EBI-1960322	0.40
O75167	Phosphatase and actin regulator 2	EBI-1960334	0.40
Q9P1A6	Disks large-associated protein 2 (DAP-2) (PSD-95/SAP90-binding protein 2) (SAP90/PSD-95-associated protein 2) (SAPAP2)	EBI-1960358	0.40
Q15036	Sorting nexin-17	EBI-1960382	0.40
Q9Y2H0	Disks large-associated protein 4 (DAP-4) (PSD-95/SAP90-binding protein 4) (SAP90/PSD-95-associated protein 4) (SAPAP-4)	EBI-1960370	0.40
O43918	Autoimmune regulator (Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein) (APECED protein)	EBI-1960394	0.40
O95886	Disks large-associated protein 3 (DAP-3) (PSD-95/SAP90-binding protein 3) (SAP90/PSD-95-associated protein 3) (SAPAP3)	EBI-1960406	0.40
Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	EBI-1960418	0.40
O43150	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (Development and differentiation-enhancing factor 2) (Paxillin-associated protein with ARF GAP activity 3) (PAG3) (Pyk2 C-terminus-associated protein) (PAP)	EBI-1960430	0.40
Q9NQ76	Matrix extracellular phosphoglycoprotein (Osteoblast/osteocyte factor 45) (OF45) (Osteoregulin)	EBI-1960442	0.40
Q9Y2J2	Band 4.1-like protein 3 (4.1B) (Differentially expressed in adenocarcinoma of the lung protein 1) (DAL-1) (Erythrocyte membrane protein band 4.1-like 3) [Cleaved into: Band 4.1-like protein 3, N-terminally processed]	EBI-1960454	0.40
P20810	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	EBI-1960466	0.40
Q9NZM4	BRD4-interacting chromatin-remodeling complex-associated protein (Glioma tumor suppressor candidate region gene 1 protein)	EBI-1960478	0.40
Q9H1R2	Dual specificity protein phosphatase 15 (EC 3.1.3.16) (EC 3.1.3.48) (VH1-related member Y) (Vaccinia virus VH1-related dual-specific protein phosphatase Y)	EBI-1960490	0.40
P15586	N-acetylglucosamine-6-sulfatase (EC 3.1.6.14) (Glucosamine-6-sulfatase) (G6S)	EBI-1960502	0.40
P31995	Low affinity immunoglobulin gamma Fc region receptor II-c (IgG Fc receptor II-c) (CDw32) (Fc-gamma RII-c) (Fc-gamma-RIIc) (FcRII-c) (CD antigen CD32)	EBI-1960538	0.40
P31994	Low affinity immunoglobulin gamma Fc region receptor II-b (IgG Fc receptor II-b) (CDw32) (Fc-gamma RII-b) (Fc-gamma-RIIb) (FcRII-b) (CD antigen CD32)	EBI-1960526	0.40
P31273	Homeobox protein Hox-C8 (Homeobox protein Hox-3A)	EBI-1960514	0.40
O43909	Exostosin-like 3 (EC 2.4.1.223) (EXT-related protein 1) (Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase) (Hereditary multiple exostoses gene isolog) (Multiple exostosis-like protein 3) (Putative tumor suppressor protein EXTL3)	EBI-1960562	0.40
P23759	Paired box protein Pax-7 (HuP1)	EBI-1960550	0.40
P26373	60S ribosomal protein L13 (Breast basic conserved protein 1) (Large ribosomal subunit protein eL13)	EBI-1960574	0.40
Q9NRJ4	Tubby-related protein 4 (Tubby superfamily protein) (Tubby-like protein 4)	EBI-1960586	0.40
O14490	Disks large-associated protein 1 (DAP-1) (Guanylate kinase-associated protein) (hGKAP) (PSD-95/SAP90-binding protein 1) (SAP90/PSD-95-associated protein 1) (SAPAP1)	EBI-1960598	0.40
Q96Q35	Flagellum-associated coiled-coil domain-containing protein 1 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein)	EBI-1960610	0.40
O95157	Neurexophilin-3	EBI-1960622	0.40
Q13905	Rap guanine nucleotide exchange factor 1 (CRK SH3-binding GNRP) (Guanine nucleotide-releasing factor 2) (Protein C3G)	EBI-1960634	0.40
Q9UPX8	SH3 and multiple ankyrin repeat domains protein 2 (Shank2) (Cortactin-binding protein 1) (CortBP1) (Proline-rich synapse-associated protein 1)	EBI-1960646	0.40
Q13796	Protein Shroom2 (Apical-like protein) (Protein APXL)	EBI-1960658	0.40
P49916	DNA ligase 3 (EC 6.5.1.1) (DNA ligase III) (Polydeoxyribonucleotide synthase [ATP] 3)	EBI-1960670	0.40
O15371	Eukaryotic translation initiation factor 3 subunit D (eIF3d) (Eukaryotic translation initiation factor 3 subunit 7) (eIF-3-zeta) (eIF3 p66)	EBI-1960682	0.40
Q8TB24	Ras and Rab interactor 3 (Ras interaction/interference protein 3)	EBI-1960694	0.40
O43281	Embryonal Fyn-associated substrate (hEFS) (Cas scaffolding protein family member 3)	EBI-1960706	0.40
P42684	Tyrosine-protein kinase ABL2 (EC 2.7.10.2) (Abelson murine leukemia viral oncogene homolog 2) (Abelson tyrosine-protein kinase 2) (Abelson-related gene protein) (Tyrosine-protein kinase ARG)	EBI-1960730	0.40
Q9UL51	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 (Brain cyclic nucleotide-gated channel 2) (BCNG-2)	EBI-1960718	0.40
Q9NZV5	Selenoprotein N (SelN)	EBI-1960742	0.40
Q9BYB0	SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2)	EBI-1960754	0.40
Q9H9L3	Interferon-stimulated 20 kDa exonuclease-like 2 (EC 3.1.-.-)	EBI-1960766	0.40
Q9BWW9	Apolipoprotein L5 (Apolipoprotein L-V) (ApoL-V)	EBI-1960778	0.40
Q14008	Cytoskeleton-associated protein 5 (Colonic and hepatic tumor overexpressed gene protein) (Ch-TOG)	EBI-1960802	0.40
Q07890	Son of sevenless homolog 2 (SOS-2)	EBI-1960790	0.40
Q92918	Mitogen-activated protein kinase kinase kinase kinase 1 (EC 2.7.11.1) (Hematopoietic progenitor kinase) (MAPK/ERK kinase kinase kinase 1) (MEK kinase kinase 1) (MEKKK 1)	EBI-1960814	0.40
O00254	Proteinase-activated receptor 3 (PAR-3) (Coagulation factor II receptor-like 2) (Thrombin receptor-like 2)	EBI-1960826	0.40
Q13087	Protein disulfide-isomerase A2 (EC 5.3.4.1) (Pancreas-specific protein disulfide isomerase) (PDIp)	EBI-1960838	0.40
P78345	Ribonuclease P protein subunit p38 (RNaseP protein p38)	EBI-1960850	0.40
Q8IWT3	Cullin-9 (CUL-9) (UbcH7-associated protein 1) (p53-associated parkin-like cytoplasmic protein)	EBI-1960862	0.40
P08047	Transcription factor Sp1	EBI-1960874	0.40
Q14185	Dedicator of cytokinesis protein 1 (180 kDa protein downstream of CRK) (DOCK180)	EBI-1960886	0.40
Q86X10	Ral GTPase-activating protein subunit beta (p170)	EBI-1960898	0.40
Q9HCU4	Cadherin EGF LAG seven-pass G-type receptor 2 (Cadherin family member 10) (Epidermal growth factor-like protein 2) (EGF-like protein 2) (Flamingo homolog 3) (Multiple epidermal growth factor-like domains protein 3) (Multiple EGF-like domains protein 3)	EBI-1960922	0.40
P23760	Paired box protein Pax-3 (HuP2)	EBI-1960958	0.40
Q07889	Son of sevenless homolog 1 (SOS-1)	EBI-1960934	0.40
Q05996	Zona pellucida sperm-binding protein 2 (Zona pellucida glycoprotein 2) (Zp-2) (Zona pellucida protein A) [Cleaved into: Processed zona pellucida sperm-binding protein 2]	EBI-1960970	0.40
P28340	DNA polymerase delta catalytic subunit (EC 2.7.7.7) (3'-5' exodeoxyribonuclease) (EC 3.1.11.-) (DNA polymerase subunit delta p125)	EBI-1960982	0.40
Q14118	Dystroglycan 1 (Dystroglycan) (Dystrophin-associated glycoprotein 1) [Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)]	EBI-1960994	0.40
O60493	Sorting nexin-3 (Protein SDP3)	EBI-1961006	0.40
Q96NS5	Ankyrin repeat and SOCS box protein 16 (ASB-16)	EBI-1961030	0.40
P20774	Mimecan (Osteoglycin) (Osteoinductive factor) (OIF)	EBI-1961018	0.40
P46013	Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67)	EBI-1961042	0.40
P48960	Adhesion G protein-coupled receptor E5 (Leukocyte antigen CD97) (CD antigen CD97) [Cleaved into: Adhesion G protein-coupled receptor E5 subunit alpha; Adhesion G protein-coupled receptor E5 subunit beta]	EBI-1961054	0.40
P78329	Cytochrome P450 4F2 (EC 1.14.14.1) (20-hydroxyeicosatetraenoic acid synthase) (20-HETE synthase) (Arachidonic acid omega-hydroxylase) (CYPIVF2) (Cytochrome P450-LTB-omega) (Docosahexaenoic acid omega-hydroxylase) (EC 1.14.14.79) (Leukotriene-B(4) 20-monooxygenase 1) (Leukotriene-B(4) omega-hydroxylase 1) (EC 1.14.14.94) (Phylloquinone omega-hydroxylase CYP4F2) (EC 1.14.14.78)	EBI-1961078	0.40
Q15027	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 (Centaurin-beta-1) (Cnt-b1)	EBI-1961090	0.40
P47928	DNA-binding protein inhibitor ID-4 (Class B basic helix-loop-helix protein 27) (bHLHb27) (Inhibitor of DNA binding 4) (Inhibitor of differentiation 4)	EBI-1961114	0.40
O43900	Prickle planar cell polarity protein 3 (LIM domain only protein 6) (LMO-6) (Prickle-like protein 3) (Pk3) (Triple LIM domain protein 6)	EBI-1961102	0.40
P10301	Ras-related protein R-Ras (EC 3.6.5.-) (p23)	EBI-1961138	0.40
Q9Y2D5	A-kinase anchor protein 2 (AKAP-2) (AKAP-KL) (Protein kinase A-anchoring protein 2) (PRKA2)	EBI-1961126	0.40
P49023	Paxillin	EBI-7066367	0.35
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-7248693	0.85
P25445	Tumor necrosis factor receptor superfamily member 6 (Apo-1 antigen) (Apoptosis-mediating surface antigen FAS) (FASLG receptor) (CD antigen CD95)	EBI-1648094	0.40
Q8TBB1	E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb-protein X 1) (Numb-binding protein 1) (PDZ domain-containing RING finger protein 2) (RING-type E3 ubiquitin transferase LNX)	EBI-7649813	0.56
P0CG48	Polyubiquitin-C [Cleaved into: Ubiquitin]	EBI-7650187	0.40
O70263	E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb protein X 1) (Ligand of Numb-binding protein 1) (Numb-binding protein 1) (RING-type E3 ubiquitin transferase LNX)	EBI-7650384	0.40
P16284	Platelet endothelial cell adhesion molecule (PECAM-1) (EndoCAM) (GPIIA') (PECA1) (CD antigen CD31)	EBI-1766207	0.59
P18031	Tyrosine-protein phosphatase non-receptor type 1 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1B) (PTP-1B)	EBI-8688791	0.94
Q62884	Protein-tyrosine-phosphatase (EC 3.1.3.48)	EBI-7505047	0.60
P61978	Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (Transformation up-regulated nuclear protein) (TUNP)	EBI-7185667	0.59
Q13191	E3 ubiquitin-protein ligase CBL-B (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene b) (RING finger protein 56) (RING-type E3 ubiquitin transferase CBL-B) (SH3-binding protein CBL-B) (Signal transduction protein CBL-B)	EBI-7081394	0.40
P56945	Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas)	EBI-7040544	0.69
P27635	60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM)	EBI-8537576	0.59
P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	EBI-7796404	0.44
P04370	Myelin basic protein (MBP) (Myelin A1 protein)	EBI-7728029	0.40
P27986	Phosphatidylinositol 3-kinase regulatory subunit alpha (PI3-kinase regulatory subunit alpha) (PI3K regulatory subunit alpha) (PtdIns-3-kinase regulatory subunit alpha) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha) (PI3-kinase subunit p85-alpha) (PtdIns-3-kinase regulatory subunit p85-alpha)	EBI-7585571	0.78
P60709	Actin, cytoplasmic 1 (EC 3.6.4.-) (Beta-actin) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed]	EBI-7585640	0.27
Q80YS6	Actin filament-associated protein 1 (110 kDa actin filament-associated protein) (AFAP-110)	EBI-7295737	0.40
P13645	Keratin, type I cytoskeletal 10 (Cytokeratin-10) (CK-10) (Keratin-10) (K10)	EBI-7609832	0.40
Q4V348	Zinc finger protein 658B	EBI-7609909	0.40
P35326	Small proline-rich protein 2A (SPR-2A) (2-1)	EBI-7743289	0.60
P48023	Tumor necrosis factor ligand superfamily member 6 (Apoptosis antigen ligand) (APTL) (CD95 ligand) (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD antigen CD178) [Cleaved into: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble form (Receptor-binding FasL ectodomain) (Soluble Fas ligand) (sFasL); ADAM10-processed FasL form (APL); FasL intracellular domain (FasL ICD) (SPPL2A-processed FasL form) (SPA)]	EBI-2481635	0.40
Q13094	Lymphocyte cytosolic protein 2 (SH2 domain-containing leukocyte protein of 76 kDa) (SLP-76 tyrosine phosphoprotein) (SLP76)	EBI-7643766	0.40
P18052	Receptor-type tyrosine-protein phosphatase alpha (Protein-tyrosine phosphatase alpha) (R-PTP-alpha) (EC 3.1.3.48) (LCA-related phosphatase) (PTPTY-28)	EBI-7811172	0.40
Q68CZ2	Tensin-3 (Tensin-like SH2 domain-containing protein 1) (Tumor endothelial marker 6)	EBI-2607034	0.59
Q8IZP0	Abl interactor 1 (Abelson interactor 1) (Abi-1) (Abl-binding protein 4) (AblBP4) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (Nap1-binding protein) (Nap1BP) (Spectrin SH3 domain-binding protein 1) (e3B1)	EBI-8050301	0.44
P97288	5-hydroxytryptamine receptor 4 (5-HT-4) (5-HT4) (Serotonin receptor 4)	EBI-7149469	0.54
P35968	Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase insert domain receptor) (KDR) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309)	EBI-2899201	0.77
P08581	Hepatocyte growth factor receptor (HGF receptor) (EC 2.7.10.1) (HGF/SF receptor) (Proto-oncogene c-Met) (Scatter factor receptor) (SF receptor) (Tyrosine-protein kinase Met)	EBI-2927759	0.70
P18433	Receptor-type tyrosine-protein phosphatase alpha (Protein-tyrosine phosphatase alpha) (R-PTP-alpha) (EC 3.1.3.48)	EBI-7205168	0.66
P23743	Diacylglycerol kinase alpha (DAG kinase alpha) (EC 2.7.1.107) (80 kDa diacylglycerol kinase) (Diglyceride kinase alpha) (DGK-alpha)	EBI-7559520	0.46
P35918	Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase NYK) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309)	EBI-8425905	0.35
P09619	Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2.7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) (CD140 antigen-like family member B) (Platelet-derived growth factor receptor 1) (PDGFR-1) (CD antigen CD140b)	EBI-8606171	0.35
P33151	Cadherin-5 (7B4 antigen) (Vascular endothelial cadherin) (VE-cadherin) (CD antigen CD144)	EBI-8609007	0.35
Q9NWQ8	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (Csk-binding protein) (Transmembrane adapter protein PAG) (Transmembrane phosphoprotein Cbp)	EBI-11358847	0.35
P40763	Signal transducer and activator of transcription 3 (Acute-phase response factor)	EBI-11359552	0.53
O60674	Tyrosine-protein kinase JAK2 (EC 2.7.10.2) (Janus kinase 2) (JAK-2)	EBI-3133061	0.35
P68400	Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1)	EBI-3133113	0.56
P21333	Filamin-A (FLN-A) (Actin-binding protein 280) (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin)	EBI-3451163	0.00
Q8WX93	Palladin (SIH002) (Sarcoma antigen NY-SAR-77)	EBI-7432098	0.40
Q9WNA9	K15 (Latent membrane protein) (Latent signal transducing membrane protein)	EBI-7555504	0.44
Q7Z7K6	Centromere protein V (CENP-V) (Nuclear protein p30) (Proline-rich protein 6)	EBI-7613065	0.40
P05023	Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1)	EBI-4303332	0.35
Q16825	Tyrosine-protein phosphatase non-receptor type 21 (EC 3.1.3.48) (Protein-tyrosine phosphatase D1)	EBI-7186498	0.40
O08715	A-kinase anchor protein 1, mitochondrial (Dual specificity A-kinase-anchoring protein 1) (D-AKAP-1) (Protein kinase A-anchoring protein 1) (PRKA1) (Spermatid A-kinase anchor protein) (S-AKAP)	EBI-7186509	0.40
Q14194	Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin response mediator protein 1) (CRMP-1) (Inactive dihydropyrimidinase) (Unc-33-like phosphoprotein 3) (ULIP-3)	EBI-7392387	0.37
Q06124	Tyrosine-protein phosphatase non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1D) (PTP-1D) (Protein-tyrosine phosphatase 2C) (PTP-2C) (SH-PTP2) (SHP-2) (Shp2) (SH-PTP3)	EBI-7870944	0.44
P08962	CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)	EBI-7784524	0.40
Q03348	Receptor-type tyrosine-protein phosphatase alpha (Protein-tyrosine phosphatase alpha) (R-PTP-alpha) (EC 3.1.3.48)	EBI-7784512	0.40
Q9H3S7	Tyrosine-protein phosphatase non-receptor type 23 (EC 3.1.3.48) (His domain-containing protein tyrosine phosphatase) (HD-PTP) (Protein tyrosine phosphatase TD14) (PTP-TD14)	EBI-8423677	0.50
P12830	Cadherin-1 (CAM 120/80) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-5922639	0.50
Q75N03	E3 ubiquitin-protein ligase Hakai (EC 2.3.2.27) (Casitas B-lineage lymphoma-transforming sequence-like protein 1) (c-Cbl-like protein 1) (RING finger protein 188) (RING-type E3 ubiquitin transferase Hakai)	EBI-5922652	0.35
Q01973	Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Neurotrophic tyrosine kinase, receptor-related 1)	EBI-6082870	0.68
Q00993	Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (Adhesion-related kinase)	EBI-7694934	0.40
P30530	Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene)	EBI-7695010	0.40
P21145	Myelin and lymphocyte protein (T-lymphocyte maturation-associated protein)	EBI-6253688	0.43
O00459	Phosphatidylinositol 3-kinase regulatory subunit beta (PI3-kinase regulatory subunit beta) (PI3K regulatory subunit beta) (PtdIns-3-kinase regulatory subunit beta) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta) (PI3-kinase subunit p85-beta) (PtdIns-3-kinase regulatory subunit p85-beta)	EBI-6256917	0.35
Q92569	Phosphatidylinositol 3-kinase regulatory subunit gamma (PI3-kinase regulatory subunit gamma) (PI3K regulatory subunit gamma) (PtdIns-3-kinase regulatory subunit gamma) (Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma) (PI3-kinase subunit p55-gamma) (PtdIns-3-kinase regulatory subunit p55-gamma) (p55PIK)	EBI-6256917	0.62
Q8NF50	Dedicator of cytokinesis protein 8	EBI-6390168	0.40
P31749	RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha)	EBI-6590127	0.27
P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	EBI-6600082	0.27
Q8NFZ0	F-box DNA helicase 1 (hFBH1) (EC 3.6.4.12) (F-box only protein 18)	EBI-6914350	0.40
P05062	Fructose-bisphosphate aldolase B (EC 4.1.2.13) (Liver-type aldolase)	EBI-9001545	0.37
Q14032	Bile acid-CoA:amino acid N-acyltransferase (BACAT) (BAT) (EC 2.3.1.65) (Bile acid-CoA thioesterase) (Choloyl-CoA hydrolase) (EC 3.1.2.27) (Glycine N-choloyltransferase) (Long-chain fatty-acyl-CoA hydrolase) (EC 3.1.2.2)	EBI-9001558	0.37
Q9BU70	tRNA (adenine(37)-N6)-methyltransferase (EC 2.1.1.-) (tRNA methyltransferase O)	EBI-9001571	0.37
O60911	Cathepsin L2 (EC 3.4.22.43) (Cathepsin U) (Cathepsin V)	EBI-9001584	0.37
Q00597	Fanconi anemia group C protein (Protein FACC)	EBI-9001597	0.37
O00757	Fructose-1,6-bisphosphatase isozyme 2 (FBPase 2) (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 2) (Muscle FBPase)	EBI-9001610	0.37
Q8IXK2	Polypeptide N-acetylgalactosaminyltransferase 12 (EC 2.4.1.41) (Polypeptide GalNAc transferase 12) (GalNAc-T12) (pp-GaNTase 12) (Protein-UDP acetylgalactosaminyltransferase 12) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12)	EBI-9001623	0.37
Q9BXL5	Hemogen (Erythroid differentiation-associated gene protein) (EDAG-1) (Hemopoietic gene protein) (Negative differentiation regulator protein)	EBI-9001636	0.37
Q9P1Z9	Coiled-coil domain-containing protein 180	EBI-9001649	0.37
Q02750	Dual specificity mitogen-activated protein kinase kinase 1 (MAP kinase kinase 1) (MAPKK 1) (MKK1) (EC 2.7.12.2) (ERK activator kinase 1) (MAPK/ERK kinase 1) (MEK 1)	EBI-9001662	0.37
Q16644	MAP kinase-activated protein kinase 3 (MAPK-activated protein kinase 3) (MAPKAP kinase 3) (MAPKAP-K3) (MAPKAPK-3) (MK-3) (EC 2.7.11.1) (Chromosome 3p kinase) (3pK)	EBI-9001675	0.37
Q9NR45	Sialic acid synthase (N-acetylneuraminate synthase) (EC 2.5.1.56) (N-acetylneuraminate-9-phosphate synthase) (EC 2.5.1.57) (N-acetylneuraminic acid phosphate synthase) (N-acetylneuraminic acid synthase)	EBI-9001688	0.37
P62714	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PP2A-beta) (EC 3.1.3.16)	EBI-9001701	0.37
P56962	Syntaxin-17	EBI-9001714	0.37
P23025	DNA repair protein complementing XP-A cells (Xeroderma pigmentosum group A-complementing protein)	EBI-9001727	0.37
O75820	Zinc finger protein 189	EBI-9001740	0.37
P10275	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	EBI-9451123	0.44
Q13480	GRB2-associated-binding protein 1 (GRB2-associated binder 1) (Growth factor receptor bound protein 2-associated protein 1)	EBI-9456279	0.44
P10721	Mast/stem cell growth factor receptor Kit (SCFR) (EC 2.7.10.1) (Piebald trait protein) (PBT) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (p145 c-kit) (v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog) (CD antigen CD117)	EBI-9464893	0.44
P14921	Protein C-ets-1 (p54)	EBI-9698851	0.44
Q9H3M7	Thioredoxin-interacting protein (Thioredoxin-binding protein 2) (Vitamin D3 up-regulated protein 1)	EBI-11686298	0.44
P06401	Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)	EBI-12590606	0.44
P19367	Hexokinase-1 (EC 2.7.1.1) (Brain form hexokinase) (Hexokinase type I) (HK I) (Hexokinase-A)	EBI-14988411	0.52
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-16398399	0.35
Q96QD9	UAP56-interacting factor (Forty-two-three domain-containing protein 1) (Protein 40-2-3)	EBI-21501187	0.35
Q13503	Mediator of RNA polymerase II transcription subunit 21 (Mediator complex subunit 21) (RNA polymerase II holoenzyme component SRB7) (RNAPII complex component SRB7) (hSrb7)	EBI-21501670	0.35
P21453	Sphingosine 1-phosphate receptor 1 (S1P receptor 1) (S1P1) (Endothelial differentiation G-protein coupled receptor 1) (Sphingosine 1-phosphate receptor Edg-1) (S1P receptor Edg-1) (CD antigen CD363)	EBI-21539478	0.35
P42677	40S ribosomal protein S27 (Metallopan-stimulin 1) (MPS-1) (Small ribosomal subunit protein eS27)	EBI-21539860	0.35
P09067	Homeobox protein Hox-B5 (Homeobox protein HHO.C10) (Homeobox protein Hox-2A) (Homeobox protein Hu-1)	EBI-21543288	0.35
O95136	Sphingosine 1-phosphate receptor 2 (S1P receptor 2) (S1P2) (Endothelial differentiation G-protein coupled receptor 5) (Sphingosine 1-phosphate receptor Edg-5) (S1P receptor Edg-5)	EBI-21551126	0.35
Q8N5S1	Mitochondrial carrier protein SCaMC-3L (Mitochondrial ATP-Mg/Pi carrier protein SLC25A41) (Small calcium-binding mitochondrial carrier protein 3-like) (SCaMC-3-like) (SCaMC-3L) (Solute carrier family 25 member 41)	EBI-21587332	0.35
O75626	PR domain zinc finger protein 1 (EC 2.1.1.-) (BLIMP-1) (Beta-interferon gene positive regulatory domain I-binding factor) (PR domain-containing protein 1) (Positive regulatory domain I-binding factor 1) (PRDI-BF1) (PRDI-binding factor 1)	EBI-21603026	0.35
P21580	Tumor necrosis factor alpha-induced protein 3 (TNF alpha-induced protein 3) (EC 2.3.2.-) (EC 3.4.19.12) (OTU domain-containing protein 7C) (Putative DNA-binding protein A20) (Zinc finger protein A20) [Cleaved into: A20p50; A20p37]	EBI-21620094	0.35
Q96SQ9	Cytochrome P450 2S1 (EC 1.14.14.-) (CYPIIS1) (Hydroperoxy icosatetraenoate dehydratase) (EC 4.2.1.152) (Thromboxane-A synthase) (EC 5.3.99.5)	EBI-21623270	0.35
P25963	NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3)	EBI-21664926	0.35
Q6QAJ8	Transmembrane protein 220	EBI-21691086	0.35
Q9BTV5	Fibronectin type III and SPRY domain-containing protein 1 (MID1-related protein 1) (Microtubule-associated protein GLFND)	EBI-21692187	0.35
Q92845	Kinesin-associated protein 3 (KAP-3) (KAP3) (Smg GDS-associated protein)	EBI-21702814	0.35
Q96S94	Cyclin-L2 (Paneth cell-enhanced expression protein)	EBI-21750627	0.35
Q8NFB2	Transmembrane protein 185A (Protein FAM11A)	EBI-21757603	0.35
P49326	Flavin-containing monooxygenase 5 (FMO 5) (Baeyer-Villiger monooxygenase 1) (hBVMO1) (EC 1.14.13.-) (Dimethylaniline monooxygenase [N-oxide-forming] 5) (EC 1.14.13.8) (Dimethylaniline oxidase 5) (NADPH oxidase) (EC 1.6.3.1)	EBI-21774649	0.35
Q86Z23	Complement C1q-like protein 4 (C1q and tumor necrosis factor-related protein 11) (C1q/TNF-related protein 11)	EBI-21814288	0.35
Q9Y277	Voltage-dependent anion-selective channel protein 3 (VDAC-3) (hVDAC3) (Outer mitochondrial membrane protein porin 3)	EBI-21825091	0.35
Q9UN70	Protocadherin gamma-C3 (PCDH-gamma-C3) (Protocadherin-2) (Protocadherin-43) (PC-43)	EBI-21824946	0.35
Q6P158	Putative ATP-dependent RNA helicase DHX57 (EC 3.6.4.13) (DEAH box protein 57)	EBI-21831097	0.35
Q8N6N7	Acyl-CoA-binding domain-containing protein 7	EBI-21832308	0.35
Q8WUY3	Protein prune homolog 2 (BNIP2 motif-containing molecule at the C-terminal region 1)	EBI-21832277	0.35
Q8N165	Serine/threonine-protein kinase PDIK1L (EC 2.7.11.1) (PDLIM1-interacting kinase 1-like)	EBI-21836274	0.35
Q92542	Nicastrin	EBI-21836991	0.35
Q3KPI0	Carcinoembryonic antigen-related cell adhesion molecule 21	EBI-21837817	0.35
Q9UBH0	Interleukin-36 receptor antagonist protein (IL-36Ra) (FIL1 delta) (IL-1-related protein 3) (IL-1RP3) (Interleukin-1 HY1) (IL-1HY1) (Interleukin-1 delta) (IL-1 delta) (Interleukin-1 family member 5) (IL-1F5) (Interleukin-1 receptor antagonist homolog 1) (IL-1ra homolog 1) (Interleukin-1-like protein 1) (IL-1L1)	EBI-21842113	0.35
Q9BYJ1	Hydroperoxide isomerase ALOXE3 (Epidermis-type lipoxygenase 3) (Epidermal LOX-3) (e-LOX-3) (eLOX-3) (Hydroperoxy dehydratase ALOXE3) (Hydroperoxy icosatetraenoate dehydratase) (EC 4.2.1.152) (Hydroperoxy icosatetraenoate isomerase) (EC 5.4.4.7)	EBI-21843741	0.35
P15260	Interferon gamma receptor 1 (IFN-gamma receptor 1) (IFN-gamma-R1) (CDw119) (Interferon gamma receptor alpha-chain) (IFN-gamma-R-alpha) (CD antigen CD119)	EBI-21848322	0.35
O76003	Glutaredoxin-3 (PKC-interacting cousin of thioredoxin) (PICOT) (PKC-theta-interacting protein) (PKCq-interacting protein) (Thioredoxin-like protein 2)	EBI-21849210	0.35
Q99808	Equilibrative nucleoside transporter 1 (Equilibrative nitrobenzylmercaptopurine riboside-sensitive nucleoside transporter) (Equilibrative NBMPR-sensitive nucleoside transporter) (Nucleoside transporter, es-type) (Solute carrier family 29 member 1)	EBI-21849345	0.35
Q96AZ6	Interferon-stimulated gene 20 kDa protein (EC 3.1.13.1) (Estrogen-regulated transcript 45 protein) (Promyelocytic leukemia nuclear body-associated protein ISG20)	EBI-21849278	0.35
P14854	Cytochrome c oxidase subunit 6B1 (Cytochrome c oxidase subunit VIb isoform 1) (COX VIb-1)	EBI-21849241	0.35
P49407	Beta-arrestin-1 (Arrestin beta-1) (Non-visual arrestin-2)	EBI-15565377	0.62
P35408	Prostaglandin E2 receptor EP4 subtype (PGE receptor EP4 subtype) (PGE2 receptor EP4 subtype) (Prostanoid EP4 receptor)	EBI-15565467	0.40
P78536	Disintegrin and metalloproteinase domain-containing protein 17 (ADAM 17) (EC 3.4.24.86) (Snake venom-like protease) (TNF-alpha convertase) (TNF-alpha-converting enzyme) (CD antigen CD156b)	EBI-15581054	0.40
P07900	Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38)	EBI-15591551	0.67
Q96AQ6	Pre-B-cell leukemia transcription factor-interacting protein 1 (Hematopoietic PBX-interacting protein)	EBI-15606312	0.35
Q60598	Src substrate cortactin	EBI-15645629	0.44
O00560	Syntenin-1 (Melanoma differentiation-associated protein 9) (MDA-9) (Pro-TGF-alpha cytoplasmic domain-interacting protein 18) (TACIP18) (Scaffold protein Pbp1) (Syndecan-binding protein 1)	EBI-15731494	0.40
P32121	Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3)	EBI-15749890	0.56
P25101	Endothelin-1 receptor (Endothelin receptor type A) (ET-A) (ETA-R) (hET-AR)	EBI-15756430	0.40
P29066	Beta-arrestin-1 (Arrestin beta-1)	EBI-15756483	0.40
P35222	Catenin beta-1 (Beta-catenin)	EBI-15951997	0.54
P29353	SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1)	EBI-16183922	0.44
Q01968	Inositol polyphosphate 5-phosphatase OCRL (EC 3.1.3.36) (EC 3.1.3.56) (Inositol polyphosphate 5-phosphatase OCRL-1) (OCRL-1) (Lowe oculocerebrorenal syndrome protein) (Phosphatidylinositol 3,4,5-triphosphate 5-phosphatase) (EC 3.1.3.86)	EBI-16412116	0.35
Q08345	Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protein-tyrosine kinase 3A) (Protein-tyrosine kinase RTK-6) (TRK E) (Tyrosine kinase DDR) (Tyrosine-protein kinase CAK) (CD antigen CD167a)	EBI-22053903	0.35
Q6NYC1	Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 (EC 1.14.11.-) (Histone arginine demethylase JMJD6) (JmjC domain-containing protein 6) (Jumonji domain-containing protein 6) (Lysyl-hydroxylase JMJD6) (Peptide-lysine 5-dioxygenase JMJD6) (Phosphatidylserine receptor) (Protein PTDSR)	EBI-16745030	0.35
Q9BR61	Acyl-CoA-binding domain-containing protein 6	EBI-21225038	0.56
O60551	Glycylpeptide N-tetradecanoyltransferase 2 (EC 2.3.1.97) (Myristoyl-CoA:protein N-myristoyltransferase 2) (NMT 2) (Peptide N-myristoyltransferase 2) (Protein-lysine myristoyltransferase NMT2) (EC 2.3.1.-) (Type II N-myristoyltransferase)	EBI-21226608	0.44
Q01974	Tyrosine-protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor-related 2)	EBI-20982927	0.37
O14672	Disintegrin and metalloproteinase domain-containing protein 10 (ADAM 10) (EC 3.4.24.81) (CDw156) (Kuzbanian protein homolog) (Mammalian disintegrin-metalloprotease) (CD antigen CD156c)	EBI-21223655	0.54
P78325	Disintegrin and metalloproteinase domain-containing protein 8 (ADAM 8) (EC 3.4.24.-) (Cell surface antigen MS2) (CD antigen CD156a)	EBI-21225676	0.44
O43184	Disintegrin and metalloproteinase domain-containing protein 12 (ADAM 12) (EC 3.4.24.-) (Meltrin-alpha)	EBI-21225905	0.56
Q9H013	Disintegrin and metalloproteinase domain-containing protein 19 (ADAM 19) (EC 3.4.24.-) (Meltrin-beta) (Metalloprotease and disintegrin dendritic antigen marker) (MADDAM)	EBI-21226684	0.44
Q62985	SH2B adapter protein 1 (FceRI gamma-chain-interacting protein SH2-B) (SH2 domain-containing protein 1B) (SH2-B PH domain-containing signaling mediator 1)	EBI-22249049	0.35
Q9Z2F5	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3)	EBI-22249049	0.35
Q68FX8	Mitochondrial-processing peptidase subunit alpha (Alpha-MPP) (Inactive zinc metalloprotease alpha)	EBI-22249049	0.35
Q9QZC5	Growth factor receptor-bound protein 7 (Epidermal growth factor receptor GRB-7) (GRB7 adapter protein)	EBI-22249049	0.35
P10634	Cytochrome P450 2D26 (EC 1.14.14.1) (CYPIID26) (Cytochrome P450-CMF2) (Cytochrome P450-DB2) (Debrisoquine 4-hydroxylase)	EBI-22249049	0.35
A0A0G2K064	Tyrosine-protein phosphatase non-receptor type (EC 3.1.3.48)	EBI-22249049	0.35
B2GV53	Slc25a32 protein (Solute carrier family 25 member 32) (Solute carrier family 25, member 32 (Predicted))	EBI-22249049	0.35
Q6AYR1	RCG52996, isoform CRA_a (Trk-fused protein)	EBI-22249049	0.35
Q5XI60	Receptor expression-enhancing protein 6 (Polyposis locus protein 1-like 1)	EBI-22249049	0.35
P62744	AP-2 complex subunit sigma (Adaptor protein complex AP-2 subunit sigma) (Adaptor-related protein complex 2 subunit sigma) (Clathrin assembly protein 2 sigma small chain) (Clathrin coat assembly protein AP17) (Clathrin coat-associated protein AP17) (Plasma membrane adaptor AP-2 17 kDa protein) (Sigma-adaptin 3b) (Sigma2-adaptin)	EBI-22261657	0.35
Q68FS2	COP9 signalosome complex subunit 4 (SGN4) (Signalosome subunit 4) (JAB1-containing signalosome subunit 4)	EBI-22261657	0.35
P61621	Protein transport protein Sec61 subunit alpha isoform 1 (Sec61 alpha-1)	EBI-22261657	0.35
F1M062	La ribonucleoprotein 1, translational regulator	EBI-22261657	0.35
F1M5N4	Malic enzyme	EBI-22261657	0.35
D3ZIL6	Enoyl CoA hydratase domain-containing 2 (Enoyl Coenzyme A hydratase domain containing 2 (Predicted), isoform CRA_a)	EBI-22261657	0.35
Q10758	Keratin, type II cytoskeletal 8 (Cytokeratin endo A) (Cytokeratin-8) (CK-8) (Keratin-8) (K8) (Type-II keratin Kb8)	EBI-22261657	0.35
A0A0G2K261	Isoleucine--tRNA ligase (EC 6.1.1.5) (Isoleucyl-tRNA synthetase)	EBI-22261657	0.35
Q5BK57	HAUS augmin-like complex subunit 8 (HEC1/NDC80-interacting centrosome-associated protein 1) (Sarcoma antigen NY-SAR-48 homolog)	EBI-22261657	0.35
P54001	Prolyl 4-hydroxylase subunit alpha-1 (4-PH alpha-1) (EC 1.14.11.2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-1)	EBI-22261657	0.35
P21816	Cysteine dioxygenase type 1 (EC 1.13.11.20) (Cysteine dioxygenase type I) (CDO) (CDO-I)	EBI-22261657	0.35
Q5M8C3	Serine (Or cysteine) proteinase inhibitor, clade A (Alpha-1 antiproteinase, antitrypsin), member 4 (Serine (Or cysteine) proteinase inhibitor, clade A (Alpha-1 antiproteinase, antitrypsin), member 4, isoform CRA_a) (Serpin family A member 4)	EBI-22261657	0.35
P11466	Peroxisomal carnitine O-octanoyltransferase (COT) (EC 2.3.1.137)	EBI-22261657	0.35
Q6AYC9	Ankyrin repeat and SOCS box-containing 6	EBI-22261657	0.35
A0A8I6AI13	Hemoglobin alpha, adult chain 1	EBI-22261657	0.35
P62902	60S ribosomal protein L31	EBI-22261657	0.35
D3ZLE6	RT1 class I, CE7	EBI-22261657	0.35
D4A3Q2	Stromal antigen 1 (Stromal antigen 1 (Predicted), isoform CRA_a)	EBI-22261657	0.35
F1LQH2	Nuclear factor NF-kappa-B p105 subunit (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1)	EBI-22261657	0.35
F1LM66	116 kDa U5 small nuclear ribonucleoprotein component (U5 snRNP-specific protein, 116 kDa)	EBI-22261657	0.35
A0A096MJZ8	[Histone H3]-trimethyl-L-lysine(4) demethylase (EC 1.14.11.67)	EBI-22261657	0.35
D3ZKR8	Protein kish	EBI-22261657	0.35
Q63279	Keratin, type I cytoskeletal 19 (Cytokeratin-19) (CK-19) (Keratin-19) (K19) (Type I keratin Ka19)	EBI-22261657	0.35
B5DEH4	UDP-N-acetylglucosamine pyrophosphorylase 1-like 1 (Uap1l1 protein)	EBI-22261657	0.35
F1M951	Tyrosine-protein phosphatase non-receptor type 23	EBI-22261657	0.35
F1LM93	Tyrosine-protein kinase Yes (EC 2.7.10.2) (p61-Yes)	EBI-22261657	0.35
D3ZYG0	Vav guanine nucleotide exchange factor 2	EBI-22261657	0.35
Q06884	Cytochrome P450 3A (EC 1.14.14.-)	EBI-22261657	0.35
B2GUV7	Eukaryotic translation initiation factor 5B (eIF-5B) (EC 3.6.5.3) (Annexin V-binding protein ABP-7) (Translation initiation factor IF-2)	EBI-22261657	0.35
Q8K4V4	Sorting nexin-27 (MAP-responsive gene protein) (Methamphetamine-responsive transcript 1 protein) (PDZ-protein Mrt1)	EBI-22261657	0.35
P25030	Keratin, type I cytoskeletal 20 (Cytokeratin-20) (CK-20) (Cytokeratin-21) (CK-21) (Keratin-20) (K20)	EBI-22261657	0.35
Q5RKG9	Eukaryotic translation initiation factor 4B	EBI-22261657	0.35
D3ZQ63	tRNA N(3)-methylcytidine methyltransferase (EC 2.1.1.-)	EBI-22261657	0.35
F1M0R1	Ring finger protein 213	EBI-22261657	0.35
B2RYD7	Dolichyl-diphosphooligosaccharide--protein glycotransferase (EC 2.4.99.18)	EBI-22261657	0.35
D3ZDP2	Mitochondrial ribosomal protein L58	EBI-22261657	0.35
F1LNL3	ATP-binding cassette subfamily A member 1	EBI-22261657	0.35
Q66HR0	Solute carrier family 12 member 9 (Cation-chloride cotransporter 6)	EBI-22261657	0.35
P00176	Cytochrome P450 2B1 (EC 1.14.14.1) (CYPIIB1) (Cytochrome P450-B) (Cytochrome P450b) (Cytochrome P450-LM2) (Cytochrome P450-PB1) (Cytochrome P450-PB2)	EBI-22261657	0.35
Q63186	Translation initiation factor eIF-2B subunit delta (eIF-2B GDP-GTP exchange factor subunit delta)	EBI-22261657	0.35
Q499Q3	Interferon-induced GTP-binding protein Mx2 (Myxovirus (Influenza virus) resistance 2) (RCG53028)	EBI-22261657	0.35
Q5PQL2	CCR4-NOT transcription complex subunit 9 (Cell differentiation protein RQCD1 homolog) (Rcd-1)	EBI-22261657	0.35
A0A0A0MY43	Activating signal cointegrator 1 complex subunit 3	EBI-22261657	0.35
Q4QQT3	CUGBP Elav-like family member 1 (CELF-1) (Bruno-like protein 2) (CUG triplet repeat RNA-binding protein 1) (CUG-BP1) (CUG-BP- and ETR-3-like factor 1) (RNA-binding protein BRUNOL-2)	EBI-22261657	0.35
G3V781	Double-strand break repair protein	EBI-22261657	0.35
Q5RKH0	Cytokine-like nuclear factor N-PAC (NPAC) (Glyoxylate reductase 1 homolog) (Nuclear protein NP60) (Putative oxidoreductase GLYR1)	EBI-22261657	0.35
M0R671	Tensin 2	EBI-22261657	0.35
D3ZMS1	Splicing factor 3b, subunit 2 (Splicing factor 3b, subunit 2 (Predicted), isoform CRA_a)	EBI-22261657	0.35
O08662	Phosphatidylinositol 4-kinase alpha (PI4-kinase alpha) (PI4K-alpha) (PtdIns-4-kinase alpha) (EC 2.7.1.67)	EBI-22261657	0.35
D3ZJ01	RAB11-binding and LisH domain, coiled-coil and HEAT repeat-containing (Similar to RIKEN cDNA 2310035C23 (Predicted))	EBI-22261657	0.35
Q16543	Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed]	EBI-22297428	0.62
O60783	28S ribosomal protein S14, mitochondrial (MRP-S14) (S14mt) (Mitochondrial small ribosomal subunit protein uS14m)	EBI-25384369	0.35
P07437	Tubulin beta chain (Tubulin beta-5 chain)	EBI-25384369	0.35
P08238	Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84)	EBI-25384369	0.53
P11021	Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein)	EBI-25384369	0.35
P11940	Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1)	EBI-25384369	0.35
Q9H361	Polyadenylate-binding protein 3 (PABP-3) (Poly(A)-binding protein 3) (Testis-specific poly(A)-binding protein)	EBI-25384369	0.35
P40939	Trifunctional enzyme subunit alpha, mitochondrial (78 kDa gastrin-binding protein) (Monolysocardiolipin acyltransferase) (EC 2.3.1.-) (TP-alpha) [Includes: Long-chain enoyl-CoA hydratase (EC 4.2.1.17); Long chain 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.211)]	EBI-25384369	0.35
P67936	Tropomyosin alpha-4 chain (TM30p1) (Tropomyosin-4)	EBI-25384369	0.35
P06753	Tropomyosin alpha-3 chain (Gamma-tropomyosin) (Tropomyosin-3) (Tropomyosin-5) (hTM5)	EBI-25384369	0.35
P82650	28S ribosomal protein S22, mitochondrial (MRP-S22) (S22mt) (Mitochondrial small ribosomal subunit protein mS22)	EBI-25384369	0.35
P82914	28S ribosomal protein S15, mitochondrial (MRP-S15) (S15mt) (Mitochondrial small ribosomal subunit protein uS15m)	EBI-25384369	0.35
Q00325	Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3)	EBI-25384369	0.35
Q00341	Vigilin (High density lipoprotein-binding protein) (HDL-binding protein)	EBI-25384369	0.35
Q13310	Polyadenylate-binding protein 4 (PABP-4) (Poly(A)-binding protein 4) (Activated-platelet protein 1) (APP-1) (Inducible poly(A)-binding protein) (iPABP)	EBI-25384369	0.35
Q15366	Poly(rC)-binding protein 2 (Alpha-CP2) (Heterogeneous nuclear ribonucleoprotein E2) (hnRNP E2)	EBI-25384369	0.35
P57721	Poly(rC)-binding protein 3 (Alpha-CP3) (PCBP3-overlapping transcript) (PCBP3-overlapping transcript 1)	EBI-25384369	0.35
Q71RC2	La-related protein 4 (La ribonucleoprotein domain family member 4)	EBI-25384369	0.35
Q99700	Ataxin-2 (Spinocerebellar ataxia type 2 protein) (Trinucleotide repeat-containing gene 13 protein)	EBI-25384369	0.35
Q9Y291	28S ribosomal protein S33, mitochondrial (MRP-S33) (S33mt) (Mitochondrial small ribosomal subunit protein mS33)	EBI-25384369	0.35
Q9Y2R9	28S ribosomal protein S7, mitochondrial (MRP-S7) (S7mt) (Mitochondrial small ribosomal subunit protein uS7m) (bMRP-27a) (bMRP27a)	EBI-25384369	0.35
O60306	RNA helicase aquarius (EC 3.6.4.13) (Intron-binding protein of 160 kDa) (IBP160)	EBI-25384369	0.35
P07910	Heterogeneous nuclear ribonucleoproteins C1/C2 (hnRNP C1/C2)	EBI-25384369	0.35
P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed]	EBI-25384369	0.35
Q32P51	Heterogeneous nuclear ribonucleoprotein A1-like 2 (hnRNP A1-like 2) (hnRNP core protein A1-like 2)	EBI-25384369	0.35
P11142	Heat shock cognate 71 kDa protein (EC 3.6.4.10) (Heat shock 70 kDa protein 8) (Lipopolysaccharide-associated protein 1) (LAP-1) (LPS-associated protein 1)	EBI-25384369	0.35
P12236	ADP/ATP translocase 3 (ADP,ATP carrier protein 3) (ADP,ATP carrier protein, isoform T2) (ANT 2) (Adenine nucleotide translocator 3) (ANT 3) (Solute carrier family 25 member 6) [Cleaved into: ADP/ATP translocase 3, N-terminally processed]	EBI-25384369	0.35
P27708	CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)]	EBI-25384369	0.35
P33993	DNA replication licensing factor MCM7 (EC 3.6.4.12) (CDC47 homolog) (P1.1-MCM3)	EBI-25384369	0.35
P34932	Heat shock 70 kDa protein 4 (HSP70RY) (Heat shock 70-related protein APG-2)	EBI-25384369	0.35
P38646	Stress-70 protein, mitochondrial (75 kDa glucose-regulated protein) (GRP-75) (Heat shock 70 kDa protein 9) (Mortalin) (MOT) (Peptide-binding protein 74) (PBP74)	EBI-25384369	0.35
P63313	Thymosin beta-10	EBI-25384369	0.35
P68363	Tubulin alpha-1B chain (EC 3.6.5.-) (Alpha-tubulin ubiquitous) (Tubulin K-alpha-1) (Tubulin alpha-ubiquitous chain) [Cleaved into: Detyrosinated tubulin alpha-1B chain]	EBI-25384369	0.35
P68366	Tubulin alpha-4A chain (EC 3.6.5.-) (Alpha-tubulin 1) (Testis-specific alpha-tubulin) (Tubulin H2-alpha) (Tubulin alpha-1 chain)	EBI-25384369	0.35
Q8NEV1	Casein kinase II subunit alpha 3 (CK II alpha 3) (EC 2.7.11.1) (Casein kinase II alpha 1 polypeptide pseudogene)	EBI-25384369	0.35
Q01081	Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit)	EBI-25384369	0.35
Q02952	A-kinase anchor protein 12 (AKAP-12) (A-kinase anchor protein 250 kDa) (AKAP 250) (Gravin) (Myasthenia gravis autoantigen)	EBI-25384369	0.35
Q13151	Heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0)	EBI-25384369	0.35
Q13263	Transcription intermediary factor 1-beta (TIF1-beta) (E3 SUMO-protein ligase TRIM28) (EC 2.3.2.27) (KRAB-associated protein 1) (KAP-1) (KRAB-interacting protein 1) (KRIP-1) (Nuclear corepressor KAP-1) (RING finger protein 96) (RING-type E3 ubiquitin transferase TIF1-beta) (Tripartite motif-containing protein 28)	EBI-25384369	0.35
Q14839	Chromodomain-helicase-DNA-binding protein 4 (CHD-4) (EC 3.6.4.12) (ATP-dependent helicase CHD4) (Mi-2 autoantigen 218 kDa protein) (Mi2-beta)	EBI-25384369	0.35
Q15370	Elongin-B (EloB) (Elongin 18 kDa subunit) (RNA polymerase II transcription factor SIII subunit B) (SIII p18) (Transcription elongation factor B polypeptide 2)	EBI-25384369	0.35
Q8N163	Cell cycle and apoptosis regulator protein 2 (Cell division cycle and apoptosis regulator protein 2) (DBIRD complex subunit KIAA1967) (Deleted in breast cancer gene 1 protein) (DBC-1) (DBC.1) (NET35) (p30 DBC)	EBI-25384369	0.35
Q92598	Heat shock protein 105 kDa (Antigen NY-CO-25) (Heat shock 110 kDa protein)	EBI-25384369	0.35
Q93009	Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7)	EBI-25384369	0.35
P05387	60S acidic ribosomal protein P2 (Large ribosomal subunit protein P2) (Renal carcinoma antigen NY-REN-44)	EBI-25394988	0.35
Q12904	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (Multisynthase complex auxiliary component p43) [Cleaved into: Endothelial monocyte-activating polypeptide 2 (EMAP-2) (Endothelial monocyte-activating polypeptide II) (EMAP-II) (Small inducible cytokine subfamily E member 1)]	EBI-25394988	0.35
Q15046	Lysine--tRNA ligase (EC 2.7.7.-) (EC 6.1.1.6) (Lysyl-tRNA synthetase) (LysRS)	EBI-25394988	0.35
O60264	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5) (EC 3.6.4.-) (Sucrose nonfermenting protein 2 homolog) (hSNF2H)	EBI-25394988	0.35
P28370	Probable global transcription activator SNF2L1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA1) (Nucleosome-remodeling factor subunit SNF2L) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 1)	EBI-25394988	0.35
Q6XD76	Achaete-scute homolog 4 (ASH-4) (hASH4) (Achaete-scute-like protein 4) (Class A basic helix-loop-helix protein 44) (bHLHa44)	EBI-25892220	0.56
O14796	SH2 domain-containing protein 1B (EWS/FLI1-activated transcript 2) (EAT-2)	EBI-25892212	0.56
Q9UIH9	Krueppel-like factor 15 (Kidney-enriched krueppel-like factor)	EBI-25892204	0.56
Q15907	Ras-related protein Rab-11B (EC 3.6.5.2) (GTP-binding protein YPT3)	EBI-25892188	0.56
Q14457	Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]	EBI-25892180	0.56
Q9UNY5	Zinc finger protein 232 (Zinc finger and SCAN domain-containing protein 11)	EBI-25892172	0.56
Q13829	BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2 (hBACURD2) (BTB/POZ domain-containing protein TNFAIP1) (Protein B12) (Tumor necrosis factor, alpha-induced protein 1, endothelial)	EBI-25892164	0.56
O60880	SH2 domain-containing protein 1A (Duncan disease SH2-protein) (Signaling lymphocytic activation molecule-associated protein) (SLAM-associated protein) (T-cell signal transduction molecule SAP)	EBI-25892148	0.56
Q13322	Growth factor receptor-bound protein 10 (GRB10 adapter protein) (Insulin receptor-binding protein Grb-IR)	EBI-25892138	0.56
P01116	GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]	EBI-27041844	0.27
P01111	GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)	EBI-27042293	0.27
F1PAA9	Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-27079701	0.27
P63252	Inward rectifier potassium channel 2 (Cardiac inward rectifier potassium channel) (Inward rectifier K(+) channel Kir2.1) (IRK-1) (hIRK1) (Potassium channel, inwardly rectifying subfamily J member 2)	EBI-28956128	0.27
P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	EBI-27084109	0.35
Q99592	Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171)	EBI-27093179	0.35
P07947	Tyrosine-protein kinase Yes (EC 2.7.10.2) (Proto-oncogene c-Yes) (p61-Yes)	EBI-28931668	0.35
P08631	Tyrosine-protein kinase HCK (EC 2.7.10.2) (Hematopoietic cell kinase) (Hemopoietic cell kinase) (p59-HCK/p60-HCK) (p59Hck) (p61Hck)	EBI-28931703	0.35
Q05513	Protein kinase C zeta type (EC 2.7.11.13) (nPKC-zeta)	EBI-28931938	0.35
P09769	Tyrosine-protein kinase Fgr (EC 2.7.10.2) (Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog) (Proto-oncogene c-Fgr) (p55-Fgr) (p58-Fgr) (p58c-Fgr)	EBI-28931938	0.35
P06239	Tyrosine-protein kinase Lck (EC 2.7.10.2) (Leukocyte C-terminal Src kinase) (LSK) (Lymphocyte cell-specific protein-tyrosine kinase) (Protein YT16) (Proto-oncogene Lck) (T cell-specific protein-tyrosine kinase) (p56-LCK)	EBI-28931938	0.35
P05090	Apolipoprotein D (Apo-D) (ApoD)	EBI-28931938	0.35
O00170	AH receptor-interacting protein (AIP) (Aryl-hydrocarbon receptor-interacting protein) (HBV X-associated protein 2) (XAP-2) (Immunophilin homolog ARA9)	EBI-28931938	0.35
Q86V86	Serine/threonine-protein kinase pim-3 (EC 2.7.11.1)	EBI-28942203	0.35
Q8TEA7	TBC domain-containing protein kinase-like protein	EBI-28943849	0.35
P42566	Epidermal growth factor receptor substrate 15 (Protein Eps15) (Protein AF-1p)	EBI-30822769	0.44

Cross-References

Database	Links
UNIPROT	P12931 E1P5V4 Q76P87 Q86VB9 Q9H5A8
PDB	1A07 1A08 1A09 1A1A 1A1B 1A1C 1A1E 1FMK 1HCS 1HCT 1KSW 1O41 1O42 1O43 1O44 1O45 1O46 1O47 1O48 1O49 1O4A 1O4B 1O4C 1O4D 1O4E 1O4F 1O4G 1O4H 1O4I 1O4J 1O4K 1O4L 1O4M 1O4N 1O4O 1O4P 1O4Q 1O4R 1SHD 1Y57 1YI6 1YOJ 1YOL 1YOM 2BDF 2BDJ 2H8H 2SRC 3VRO 3ZMP 3ZMQ 4F59 4F5A 4F5B 4HXJ 4K11 4MXO 4MXX 4MXY 4MXZ 6ATE 6C4S 6E6E 6EHJ 7NG7
Pfam	PF07714 PF00017 PF00018
PROSITE	PS00107 PS50011 PS00109 PS50001 PS50002
OMIM	190090 616937
DisGeNET	6714

Proto-oncogene tyrosine-protein kinase Src (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 1A1C)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (21 interactors)

Interactions with other proteins (380 interactors)

Cross-References

Database

Links

Description

Description