Protein Information |
|
|---|---|
| Protein Name | Protein translocation protein SEC63 |
| Accession Code | P14906 |
| Gene | SEC63 |
| Organism | Saccharomyces cerevisiae S288C (Taxonomy: 559292) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 663) | |
|
MPTNYEYDEASETWPSFILTGLLMVVGPMTLLQIYQIFFGANAEDGNSGKSKEFNEEVFKNLNEEYTSDEIKQFRRKFDK NSNKKSKIWSRRNIIIIVGWILVAILLQRINSNDAIKDAATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKG LTPDEKSVMEETYVQITKAYESLTDELVRQNYLKYGHPDGPQSTSHGIALPRFLVDGSASPLLVVCYVALLGLILPYFVS RWWARTQSYTKKGIHNVTASNFVSNLVNYKPSEIVTTDLILHWLSFAHEFKQFFPDLQPTDFEKLLQDHINRRDSGKLNN AKFRIVAKCHSLLHGLLDIACGFRNLDIALGAINTFKCIVQAVPLTPNCQILQLPNVDKEHFITKTGDIHTLGKLFTLED AKIGEVLGIKDQAKLNETLRVASHIPNLKIIKADFLVPGENQVTPSSTPYISLKVLVRSAKQPLIPTSLIPEENLTEPQD FESQRDPFAMMSKQPLVPYSFAPFFPTKRRGSWCCLVSSQKDGKILQTPIIIEKLSYKNLNDDKDFFDKRIKMDLTKHEK FDINDWEIGTIKIPLGQPAPETVGDFFFRVIVKSTDYFTTDLDITMNMKVRDSPAVEQVEVYSEEDDEYSTDDDETESDD ESDASDYTDIDTDTEAEDDESPE |
|
Structure Viewer (PDB: 7KB5) |
|---|
Description |
||
|---|---|---|
| Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein. Nucleus inner membrane; Multi-pass membrane protein. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. |
| Nuclear Inner Membrane | SL-0179 | The inner membrane of the nucleus is the membrane which separates the nuclear matrix from the intermembrane space. In mammals, the inner nuclear membrane is associated with heterochromatin and the nuclear lamina. |
| Nuclear Membrane | SL-0182 | The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane. | Membrane Topology |
| Topology | Source | Annotation Type |
| Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms |
| Cellular Component | Endoplasmic Reticulum (GO:0005783) Mitochondrion (GO:0005739) Nuclear Inner Membrane (GO:0005637) Rough Endoplasmic Reticulum Membrane (GO:0030867) Sec62/Sec63 Complex (GO:0031207) Translocon Complex (GO:0071256) |
|
Description |
|
|---|---|
| Acts as component of the Sec62/63 complex which is involved in SRP-independent post-translational translocation across the endoplasmic reticulum (ER) and functions together with the Sec61 complex and KAR2 in a channel-forming translocon complex. A cycle of assembly and disassembly of Sec62/63 complex from SEC61 may govern the activity of the translocon. SEC63 may affect SEC1-polypeptide interactions by increasing the affinity of targeting pathways for SEC61 and/or by modifying SEC61 to allow more efficient polypeptide interaction. May also be involved in SRP-dependent cotranslational translocation. Is essential for cell growth and for germination. {Experimental EvidencePubMed:11226176}. | Assigned Ontology terms |
| Biological Process | Cytosol To Endoplasmic Reticulum Transport (GO:0046967) Post-Translational Protein Targeting To Endoplasmic Reticulum Membrane (GO:0006620) Post-Translational Protein Targeting To Membrane, Translocation (GO:0031204) SRP-Dependent Cotranslational Protein Targeting To Membrane (GO:0006614) |
| Molecular Function | Protein Transmembrane Transporter Activity (GO:0008320) |
Interactions with Nuclear Envelope proteins (3 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| P30822 | Exportin-1 | EBI-3665470 | 0.35 |
| Q02455 | Protein MLP1 | EBI-3769967 | 0.35 |
| P40457 | Protein MLP2 | EBI-3769975 | 0.35 | Interactions with other proteins (154 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P30605 | Myo-inositol transporter 1 | EBI-7743571 | 0.37 |
| P39742 | Translocation protein SEC72 (Sec62/63 complex 23 kDa subunit) (p23) | EBI-7750338 | 0.83 |
| P04817 | Arginine permease CAN1 (Canavanine resistance protein 1) | EBI-7750372 | 0.37 |
| P33754 | Translocation protein SEC66 (Protein HSS1) (Sec62/63 complex 31.5 kDa subunit) | EBI-7750388 | 0.83 |
| P40073 | High osmolarity signaling protein SHO1 (Osmosensor SHO1) (Suppressor of SUA8-1 mutation) (Synthetic high osmolarity-sensitive protein 1) | EBI-7757792 | 0.37 |
| P33767 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 (Oligosaccharyl transferase subunit WBP1) (Oligosaccharyl transferase subunit beta) | EBI-7757893 | 0.37 |
| P16151 | Protein ERD1 | EBI-7758032 | 0.37 |
| P25621 | Pantothenate transporter FEN2 (Fenpropimorph resistance protein 2) | EBI-7758150 | 0.37 |
| P38353 | Sec sixty-one protein homolog (Ssh1 complex subunit SSH1) (Ssh1 complex subunit alpha) | EBI-7758268 | 0.37 |
| P38298 | Alkaline ceramidase YPC1 (EC 3.5.1.-) (Acyl-CoA-independent ceramide synthase) | EBI-7758389 | 0.37 |
| P38079 | Protein YRO2 | EBI-7758511 | 0.37 |
| P16140 | V-type proton ATPase subunit B (V-ATPase subunit B) (V-ATPase 57 kDa subunit) (Vacuolar proton pump subunit B) | EBI-797191 | 0.35 |
| P10592 | Heat shock protein SSA2 | EBI-797191 | 0.35 |
| P21825 | Translocation protein SEC62 (Sec62/63 complex 30 kDa subunit) | EBI-797191 | 0.75 |
| P32629 | Mannan polymerase II complex ANP1 subunit (M-Pol II subunit ANP1) (Aminonitrophenyl propanediol resistance protein) | EBI-819187 | 0.27 |
| Q02159 | Ubiquitin-conjugating enzyme E2 7 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme 7) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme E2-18 kDa) (Ubiquitin-protein ligase) | EBI-860869 | 0.00 |
| P47026 | GPI-anchored wall transfer protein 1 (EC 2.3.-.-) | EBI-853504 | 0.35 |
| P40217 | Eukaryotic translation initiation factor 3 subunit I (eIF3i) (Eukaryotic translation initiation factor 3 39 kDa subunit) (eIF-3 39 kDa subunit) (eIF3 p39) | EBI-7678715 | 0.56 |
| P16474 | Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein homolog) (GRP-78) (Immunoglobulin heavy chain-binding protein homolog) (BiP) | EBI-966961 | 0.40 |
| P32447 | Histone chaperone ASF1 (Anti-silencing function protein 1) (yASF1) | EBI-3665462 | 0.35 |
| P14922 | General transcriptional corepressor CYC8 (Glucose repression mediator protein CYC8) | EBI-3665478 | 0.35 |
| P39704 | Protein ERP2 | EBI-3665486 | 0.35 |
| P21268 | Cyclin-dependent kinase inhibitor FAR1 (CKI FAR1) (Factor arrest protein) | EBI-3665494 | 0.35 |
| P00927 | Threonine dehydratase, mitochondrial (EC 4.3.1.19) (Threonine deaminase) | EBI-3665502 | 0.35 |
| P50946 | Putative tyrosine-protein phosphatase OCA1 (EC 3.1.3.48) (Oxidant-induced cell-cycle arrest protein 1) | EBI-3665510 | 0.35 |
| Q12524 | Peroxisomal coenzyme A diphosphatase 1, peroxisomal (EC 3.6.1.55) | EBI-3665518 | 0.35 |
| P54885 | Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (GSA dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) | EBI-3665526 | 0.35 |
| P06103 | Eukaryotic translation initiation factor 3 subunit B (eIF3b) (Cell cycle regulation and translation initiation protein) (Eukaryotic translation initiation factor 3 90 kDa subunit) (eIF3 p90) (Translation initiation factor eIF3 p90 subunit) | EBI-3665534 | 0.35 |
| P40016 | 26S proteasome regulatory subunit RPN3 | EBI-3665542 | 0.35 |
| Q12250 | 26S proteasome regulatory subunit RPN5 (Proteasome non-ATPase subunit 5) | EBI-3665550 | 0.35 |
| Q05543 | Regulator of Ty1 transposition protein 103 | EBI-3665558 | 0.35 |
| O94742 | 26S proteasome complex subunit SEM1 | EBI-3665566 | 0.35 |
| P31376 | SWR1-complex protein 3 | EBI-3665574 | 0.35 |
| P38326 | SWR1-complex protein 5 | EBI-3665582 | 0.35 |
| P38123 | COMPASS component SWD3 (Complex proteins associated with SET1 protein SWD3) (Set1C component SWD3) | EBI-3665590 | 0.35 |
| Q05471 | Helicase SWR1 (EC 3.6.4.12) (Swi2/Snf2-related 1) | EBI-3665598 | 0.35 |
| Q04067 | Eukaryotic translation initiation factor 3 subunit G (eIF3g) (Eukaryotic translation initiation factor 3 RNA-binding subunit) (eIF-3 RNA-binding subunit) (Translation initiation factor eIF3 p33 subunit) (eIF3 p33) | EBI-3665606 | 0.35 |
| Q05946 | U3 small nucleolar RNA-associated protein 13 (U3 snoRNA-associated protein 13) (U three protein 13) | EBI-3665614 | 0.35 |
| P34110 | Vacuolar protein sorting-associated protein 35 (Vacuolar protein-targeting protein 7) | EBI-3665622 | 0.35 |
| P16521 | Elongation factor 3A (EF-3) (EF-3A) (EC 3.6.4.-) (Eukaryotic elongation factor 3) (eEF3) (Translation elongation factor 3A) (Yeast elongation factor 3) | EBI-3665630 | 0.35 |
| P53719 | Uncharacterized protein YNR014W | EBI-3665638 | 0.35 |
| P53740 | Probable phospholipid translocase non-catalytic subunit CRF1 (CDC50/ROS3 family protein 1) (CRF1) | EBI-3665646 | 0.35 |
| P10591 | Heat shock protein SSA1 (Heat shock protein YG100) | EBI-3665654 | 0.35 |
| P38788 | Ribosome-associated complex subunit SSZ1 (DnaK-related protein SSZ1) (Heat shock protein 70 homolog SSZ1) (Pleiotropic drug resistance protein 13) | EBI-3665662 | 0.35 |
| P11484 | Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb) | EBI-3701587 | 0.35 |
| P32589 | Heat shock protein homolog SSE1 (Chaperone protein MSI3) | EBI-3733411 | 0.35 |
| P39079 | T-complex protein 1 subunit zeta (TCP-1-zeta) (CCT-zeta) | EBI-3740483 | 0.35 |
| P37898 | Alanine/arginine aminopeptidase (EC 3.4.11.-) | EBI-3769653 | 0.35 |
| Q12168 | Endo-1,3(4)-beta-glucanase 2 (Endo-1,3-beta-glucanase 2) (Endo-1,4-beta-glucanase 2) (EC 3.2.1.6) (Laminarinase-2) | EBI-3769661 | 0.35 |
| P60010 | Actin (EC 3.6.4.-) | EBI-3769669 | 0.35 |
| P22108 | Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase 2 (Ap4A phosphorylase 2) (EC 2.7.7.53) (ADP-sulfurylase) (EC 2.7.7.5) (ATP adenylyltransferase) | EBI-3769677 | 0.35 |
| P08566 | Pentafunctional AROM polypeptide [Includes: 3-dehydroquinate synthase (DHQS) (EC 4.2.3.4); 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS); Shikimate kinase (SK) (EC 2.7.1.71); 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10); Shikimate dehydrogenase (EC 1.1.1.25)] | EBI-3769687 | 0.35 |
| Q06834 | Alcohol-sensitive RING finger protein 1 | EBI-3769695 | 0.35 |
| Q08347 | Alkyl/aryl-sulfatase BDS1 (EC 3.1.6.-) (Bacterially-derived sulfatase 1) | EBI-3769703 | 0.35 |
| Q07457 | E3 ubiquitin-protein ligase BRE1 (EC 2.3.2.27) (Brefeldin A-sensitivity protein 1) (RING-type E3 ubiquitin transferase BRE1) | EBI-3769711 | 0.35 |
| P00549 | Pyruvate kinase 1 (PK 1) (EC 2.7.1.40) (cell division cycle protein 19) | EBI-3769719 | 0.35 |
| Q12018 | Cell division control protein 53 (Cullin-A) (E3 ubiquitin ligase complex SCF subunit CDC53) | EBI-3769727 | 0.35 |
| Q06697 | Cell division control protein 73 (RNA polymerase-associated protein CDC73) | EBI-3769735 | 0.35 |
| P53197 | APC/C activator protein CDH1 (CDC20 homolog 1) (Homolog of CDC twenty 1) | EBI-3769743 | 0.35 |
| P40094 | Conserved oligomeric Golgi complex subunit 3 (COG complex subunit 3) (Component of oligomeric Golgi complex 3) (Protein SEC34) | EBI-3769751 | 0.35 |
| Q01454 | DNA polymerase alpha-binding protein (Chromosome replication protein CHL15) (Chromosome transmission fidelity protein 4) (Protein POB1) | EBI-3769759 | 0.35 |
| P38865 | Copper transport protein CTR2 (Copper transporter 2) | EBI-3769767 | 0.35 |
| P31373 | Cystathionine gamma-lyase (gamma-CTLase) (EC 4.4.1.1) (Gamma-cystathionase) (Sulfur transfer protein 1) | EBI-3769775 | 0.35 |
| P32582 | Cystathionine beta-synthase (EC 4.2.1.22) (Beta-thionase) (Serine sulfhydrase) (Sulfur transfer protein 4) | EBI-3769783 | 0.35 |
| Q08496 | Protein DIA2 (Digs into agar protein 2) | EBI-3769791 | 0.35 |
| P53759 | tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] (EC 1.3.1.88) (mRNA-dihydrouridine synthase DUS1) (EC 1.3.1.-) (tRNA-dihydrouridine synthase 1) | EBI-3769799 | 0.35 |
| Q06053 | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] (EC 1.3.1.89) (mRNA-dihydrouridine synthase DUS3) (EC 1.3.1.-) (tRNA-dihydrouridine synthase 3) | EBI-3769807 | 0.35 |
| P38737 | Proteasome component ECM29 (Extracellular mutant protein 29) | EBI-3769815 | 0.35 |
| P36053 | Transcription elongation factor 1 | EBI-3769823 | 0.35 |
| P00924 | Enolase 1 (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase 1) (2-phosphoglycerate dehydratase 1) | EBI-3769831 | 0.35 |
| P00925 | Enolase 2 (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase 2) (2-phosphoglycerate dehydratase 2) | EBI-3769839 | 0.35 |
| P45976 | Pre-mRNA polyadenylation factor FIP1 | EBI-3769847 | 0.35 |
| P15442 | eIF-2-alpha kinase GCN2 (EC 2.7.11.1) (General control non-derepressible protein 2) (Serine/threonine-protein kinase GCN2) | EBI-3769855 | 0.35 |
| Q12680 | Glutamate synthase [NADH] (EC 1.4.1.14) (NADH-GOGAT) | EBI-3769863 | 0.35 |
| P32347 | Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) | EBI-3769871 | 0.35 |
| P28241 | Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial (EC 1.1.1.41) (Isocitric dehydrogenase) (NAD(+)-specific ICDH) | EBI-3769879 | 0.35 |
| P53982 | Isocitrate dehydrogenase [NADP] (IDH) (EC 1.1.1.42) (IDP) (NADP(+)-specific ICDH) (Oxalosuccinate decarboxylase) | EBI-3769887 | 0.35 |
| P47170 | Vacuolar membrane-associated protein IML1 (Increased minichromosome loss protein 1) (SEH-associated protein 1) | EBI-3769895 | 0.35 |
| P32361 | Serine/threonine-protein kinase/endoribonuclease IRE1 (Endoplasmic reticulum-to-nucleus signaling 1) [Includes: Serine/threonine-protein kinase (EC 2.7.11.1); Endoribonuclease (EC 3.1.26.-)] | EBI-3769903 | 0.35 |
| P48526 | Isoleucine--tRNA ligase, mitochondrial (EC 6.1.1.5) (Isoleucyl-tRNA synthetase) (IleRS) | EBI-3769911 | 0.35 |
| P38144 | ISWI chromatin-remodeling complex ATPase ISW1 (EC 3.6.4.-) | EBI-3769919 | 0.35 |
| Q12494 | Inositol hexakisphosphate kinase 1 (InsP6 kinase 1) (EC 2.7.4.21) (InsP6 kinase KCS1) (PKC1 suppressor protein 1) | EBI-3769927 | 0.35 |
| P38853 | Kelch repeat-containing protein 1 | EBI-3769935 | 0.35 |
| Q02574 | DNA damage checkpoint control protein MEC3 | EBI-3769943 | 0.35 |
| P00958 | Methionine--tRNA ligase, cytoplasmic (EC 6.1.1.10) (Methionyl-tRNA synthetase) (MetRS) | EBI-3769951 | 0.35 |
| Q07980 | DNA mismatch repair protein MLH2 (MutL protein homolog 2) | EBI-3769959 | 0.35 |
| P48563 | Protein MON2 | EBI-3769983 | 0.35 |
| P30775 | Peptide chain release factor 1, mitochondrial (MRF-1) (MtRF-1) | EBI-3769991 | 0.35 |
| P53166 | ATP-dependent RNA helicase MRH4, mitochondrial (EC 3.6.4.13) (Mitochondrial RNA helicase 4) | EBI-3769999 | 0.35 |
| Q02950 | 37S ribosomal protein MRP51, mitochondrial (Mitochondrial small ribosomal subunit protein bS1m) | EBI-3770007 | 0.35 |
| P47047 | ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4) | EBI-3770015 | 0.35 |
| P19524 | Myosin-2 (Cell division control protein 66) (Class V unconventional myosin MYO2) (Type V myosin heavy chain MYO2) (Myosin V MYO2) | EBI-3770023 | 0.35 |
| P33420 | Protein NIP100 (Protein NIP80) | EBI-3770031 | 0.35 |
| Q01560 | Serine/arginine (SR)-type shuttling mRNA binding protein NPL3 (Mitochondrial targeting suppressor 1 protein) (Nuclear polyadenylated RNA-binding protein 1) (Nuclear protein localization protein 3) (Polyadenylate-binding protein NPL3) | EBI-3770039 | 0.35 |
| P38271 | Protein OPY1 (Overproduction-induced pheromone-resistant yeast protein 1) | EBI-3770047 | 0.35 |
| Q12451 | Oxysterol-binding protein homolog 2 (Oxysterol-binding protein-related protein 2) (ORP 2) (OSBP-related protein 2) | EBI-3770055 | 0.35 |
| P40960 | WD repeat-containing protein PAC11 | EBI-3770063 | 0.35 |
| P17558 | 37S ribosomal protein PET123, mitochondrial (Mitochondrial small ribosomal subunit protein mS26) | EBI-3770071 | 0.35 |
| P40433 | 6-phosphofructo-2-kinase 1 (6PF-2-K 1) (EC 2.7.1.105) (Phosphofructokinase 2 I) | EBI-3770079 | 0.35 |
| P00560 | Phosphoglycerate kinase (EC 2.7.2.3) | EBI-3770087 | 0.35 |
| P36093 | Putative transcription factor PHD1 | EBI-3770095 | 0.35 |
| P07271 | ATP-dependent DNA helicase PIF1 (EC 3.6.4.12) (DNA repair and recombination helicase PIF1) (Petite integration frequency protein 1) (Telomere stability protein 1) | EBI-3770103 | 0.35 |
| P33334 | Pre-mRNA-splicing factor 8 | EBI-3770111 | 0.35 |
| P52489 | Pyruvate kinase 2 (PK 2) (EC 2.7.1.40) | EBI-3770119 | 0.35 |
| P38344 | Cytoplasmic 60S subunit biogenesis factor REI1 (Required for isotropic bud growth protein 1) (pre-60S factor REI1) | EBI-3770127 | 0.35 |
| P29539 | Telomere length regulator protein RIF1 (RAP1-interacting factor 1) | EBI-3770135 | 0.35 |
| P53552 | THO complex subunit 2 (Low dye-binding protein 5) (THO complex subunit RLR1) (Zinc-regulated gene 13 protein) | EBI-3770143 | 0.35 |
| P05748 | 60S ribosomal protein L15-A (L13) (Large ribosomal subunit protein eL15-A) (RP15R) (YL10) (YP18) | EBI-3770151 | 0.35 |
| P54780 | 60S ribosomal protein L15-B (L13) (Large ribosomal subunit protein eL15-B) (RP15R) (YL10) (YP18) | EBI-3770159 | 0.35 |
| P05749 | 60S ribosomal protein L22-A (L1c) (Large ribosomal subunit protein eL22-A) (RP4) (YL31) | EBI-3770167 | 0.35 |
| Q12149 | Exosome complex exonuclease RRP6 (EC 3.1.13.-) (Ribosomal RNA-processing protein 6) | EBI-3770175 | 0.35 |
| Q02206 | Chromatin structure-remodeling complex subunit RSC4 (RSC complex subunit RSC4) (Remodel the structure of chromatin complex subunit 4) | EBI-3770183 | 0.35 |
| P40482 | Protein transport protein SEC24 (Abnormal nuclear morphology 1) | EBI-3770191 | 0.35 |
| P11075 | Protein transport protein SEC7 | EBI-3770207 | 0.35 |
| P34223 | UBX domain-containing protein 1 (Suppressor of high-copy PP1 protein) | EBI-3770223 | 0.35 |
| Q06315 | Protein SKG3 (Suppressor of lethality of KEX2-GAS1 double null mutant protein 3) | EBI-3770231 | 0.35 |
| P39928 | Osmosensing histidine protein kinase SLN1 (EC 2.7.13.3) (Osmolarity two-component system protein SLN1) (Tyrosine phosphatase-dependent protein 2) | EBI-3770239 | 0.35 |
| P32908 | Structural maintenance of chromosomes protein 1 (DA-box protein SMC1) | EBI-3770247 | 0.35 |
| P25357 | Probable DNA-binding protein SNT1 (SANT domain-containing protein 1) | EBI-3770255 | 0.35 |
| P36126 | Phospholipase D1 (PLD 1) (EC 3.1.4.4) (Choline phosphatase 1) (Meiosis-specific sporulation-specific protein 14) (Phosphatidylcholine-hydrolyzing phospholipase D1) | EBI-3770263 | 0.35 |
| P25567 | RNA-binding protein SRO9 (Suppressor of RHO3 protein 9) | EBI-3770271 | 0.35 |
| P36085 | Protein STB6 | EBI-3770280 | 0.35 |
| P08153 | Transcriptional factor SWI5 | EBI-3770288 | 0.35 |
| Q06510 | Tafazzin (Taz) (EC 2.3.1.-) | EBI-3770296 | 0.35 |
| P00359 | Glyceraldehyde-3-phosphate dehydrogenase 3 (GAPDH 3) (EC 1.2.1.12) | EBI-3770304 | 0.35 |
| P02994 | Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A) | EBI-3770312 | 0.35 |
| P32367 | Transcription factor tau 95 kDa subunit (TFIIIC 95 kDa subunit) (Transcription factor C subunit 1) | EBI-3770320 | 0.35 |
| P35169 | Serine/threonine-protein kinase TOR1 (EC 2.7.11.1) (Dominant rapamycin resistance protein 1) (Phosphatidylinositol kinase homolog TOR1) (Target of rapamycin kinase 1) | EBI-3770336 | 0.35 |
| P40061 | Target of rapamycin complex 2 subunit TSC11 (TORC2 subunit TSC11) (Adheres voraciously to TOR2 protein 3) (Temperature-sensitive CSG2 suppressor protein 11) | EBI-3770344 | 0.35 |
| P53874 | Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) | EBI-3770352 | 0.35 |
| P07259 | Protein URA2 [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] | EBI-3770360 | 0.35 |
| P34241 | Nucleolar pre-ribosomal-associated protein 1 (Unhealthy ribosome biogenesis protein 1) | EBI-3770368 | 0.35 |
| Q12339 | rRNA-processing protein UTP23 (U three protein 23) (U3 small nucleolar RNA-associated protein 23) (U3 snoRNA-associated protein 23) | EBI-3770376 | 0.35 |
| Q06685 | Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase (EC 2.7.4.24) (InsP6 and PP-IP5 kinase) | EBI-3770384 | 0.35 |
| P22203 | V-type proton ATPase subunit E (V-ATPase subunit E) (V-ATPase 27 kDa subunit) (Vacuolar proton pump subunit E) | EBI-3770392 | 0.35 |
| O13584 | Putative uncharacterized protein VPS69 | EBI-3770400 | 0.35 |
| P33301 | DNA repair protein XRS2 | EBI-3770408 | 0.35 |
| P19880 | AP-1-like transcription factor YAP1 (Phenanthroline resistance protein PAR1) (Pleiotropic drug resistance protein PDR4) | EBI-3770416 | 0.35 |
| O13527 | Truncated transposon Ty1-A Gag-Pol polyprotein (TY1B) (Transposon Ty1 TYB polyprotein) [Cleaved into: Integrase (IN) (Pol-p71) (p84) (p90); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (Pol-p63) (p60)] | EBI-3770424 | 0.35 |
| P87264 | Putative uncharacterized protein YDR467C | EBI-3770435 | 0.35 |
| P39991 | Uncharacterized protein YEL025C | EBI-3770443 | 0.35 |
| P38854 | Topoisomerase I damage affected protein 11 | EBI-3770451 | 0.35 |
| P34246 | Maintenance of telomere capping protein 2 | EBI-3770459 | 0.35 |
| Q05948 | Uncharacterized SVF1-like protein YLR225C | EBI-3770467 | 0.35 |
| Q06567 | ABC1 family protein MCP2 (MDM10-complementing protein 2) (MIOREX complex component 13) (Mitochondrial organization of gene expression protein 13) | EBI-3770475 | 0.35 |
| Q03153 | ATPase synthesis protein 25, mitochondrial (OLI1 mRNA stabilization factor) | EBI-3770483 | 0.35 |
| Q12751 | RNA polymerase II assembly factor RTP1 (Required for nuclear transport of RNA pol II protein 1) (Transport and Golgi organization protein 6 homolog) | EBI-3770491 | 0.35 |
| P42842 | Essential for maintenance of the cell wall protein 1 | EBI-3770499 | 0.35 |
| Q12697 | Vacuolar cation-transporting ATPase YPK9 (EC 7.2.2.-) (PARK9 homolog) | EBI-3770513 | 0.35 |
| Q08748 | Uncharacterized protein YOR296W | EBI-3770521 | 0.35 |
| Q06813 | Uncharacterized protein YPR078C | EBI-3770529 | 0.35 |
| P36019 | GTP-binding protein YPT53 | EBI-3770537 | 0.35 |
| P31111 | Synaptonemal complex protein ZIP1 | EBI-3770545 | 0.35 |
| P32915 | Protein transport protein SEC61 (Sec61 complex subunit SEC61) (Sec61 complex subunit alpha) | EBI-9352295 | 0.79 |
Database | Links |
| UNIPROT | P14906 D6W2V5 Q08690 |
| PDB | 6N3Q 6ND1 7AFT 7KAH 7KAI 7KAJ 7KAO 7KAP 7KAQ 7KAR 7KAS 7KAT 7KAU 7KB5 |
| Pfam | PF00226 |
| PROSITE | PS00636 PS50076 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory