Protein Information |
|
---|---|
Protein Name | Mitochondrial protein import protein MAS5 |
Accession Code | P25491 |
Gene | YDJ1 |
Organism | Saccharomyces cerevisiae S288C (Taxonomy: 559292) |
Part of Reference Proteome? | Yes |
Sequence (Length: 409) | |
MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGA GGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCT SCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAP DVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPK YGGYGNLIIKFTIKFPENHFTSEENLKKLEEILPPRIVPAIPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEEEQG GEGVQCASQ |
Structure Viewer (PDB: 1NLT) |
---|
Description |
||
---|---|---|
Cytoplasm. Cytoplasm, perinuclear region. Note=Concentrated in a perinuclear ring as well as in the cytoplasm. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
Topology | Source | Annotation Type |
Lipid-Anchored | UniProt | Experimental Evidence {ECO:0000269|PubMed:1527016} | Assigned Ontology terms |
Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Transcription Repressor Complex (GO:0017053) TRC Complex (GO:0072380) |
Interactions with Nuclear Envelope proteins (20 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
P06105 | Protein SCP160 | EBI-3664276 | 0.35 |
P06782 | Carbon catabolite-derepressing protein kinase | EBI-3766560 | 0.35 |
P25491 | Self | EBI-6319619 | 0.00 |
P30822 | Exportin-1 | EBI-3663255 | 0.35 |
P39705 | Nucleoporin NUP60 | EBI-3663903 | 0.35 |
Q04175 | Importin beta SMX1 | EBI-3664452 | 0.35 |
Q02455 | Protein MLP1 | EBI-3765167 | 0.35 |
P40457 | Protein MLP2 | EBI-3765175 | 0.35 |
P53159 | Monopolar spindle protein 2 | EBI-3765215 | 0.35 |
P40064 | Nucleoporin NUP157 | EBI-3765456 | 0.35 |
P38181 | Nucleoporin NUP170 | EBI-3765464 | 0.35 |
P46674 | Nuclear mRNA export protein SAC3 | EBI-3766328 | 0.35 |
Q03707 | Inner nuclear membrane protein SRC1 | EBI-3766672 | 0.35 |
P40075 | Vesicle-associated membrane protein-associated protein SCS2 | EBI-9975925 | 0.35 |
P53541 | Putative meiotic phospholipase SPO1 | EBI-16283760 | 0.35 |
P53983 | Probable ERAD-associated E3 ubiquitin-protein ligase ASI1 | EBI-3763707 | 0.35 |
Q06151 | m7GpppX diphosphatase | EBI-3764256 | 0.35 |
P38217 | Importin subunit beta-2 | EBI-3663671 | 0.35 |
P32767 | Importin beta-like protein KAP122 | EBI-3764975 | 0.35 |
Q04431 | Spindle pole body component KRE28 | EBI-3664804 | 0.35 | Interactions with other proteins (881 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
P38085 | Valine/tyrosine/tryptophan amino-acid permease 1 (Tyrosine and tryptophan amino acid transporter 1) | EBI-785720 | 0.35 |
P21147 | Acyl-CoA desaturase 1 (EC 1.14.19.1) (Delta 9 fatty acid desaturase) (Fatty acid desaturase 1) (Stearoyl-CoA desaturase 1) | EBI-786767 | 0.35 |
P06839 | General transcription and DNA repair factor IIH helicase subunit XPD (TFIIH subunit XPD) (EC 3.6.4.12) (DNA repair helicase RAD3) (RNA polymerase II transcription factor B subunit RAD3) (TFB subunit RAD3) | EBI-791932 | 0.64 |
P00830 | ATP synthase subunit beta, mitochondrial (EC 7.1.2.2) | EBI-813344 | 0.27 |
P38737 | Proteasome component ECM29 (Extracellular mutant protein 29) | EBI-814203 | 0.51 |
P33892 | eIF-2-alpha kinase activator GCN1 (General control non-derepressible protein 1) (Translational activator GCN1) | EBI-819274 | 0.51 |
P18239 | ADP,ATP carrier protein 2 (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) (Petite colonies protein 9) | EBI-820078 | 0.27 |
P36046 | Mitochondrial intermembrane space import and assembly protein 40 (Mitochondrial import inner membrane translocase TIM40) | EBI-853933 | 0.53 |
P0CG63 | Polyubiquitin [Cleaved into: Ubiquitin] | EBI-7479876 | 0.44 |
P02829 | ATP-dependent molecular chaperone HSP82 (82 kDa heat shock protein) (Heat shock protein Hsp90 heat-inducible isoform) | EBI-863329 | 0.62 |
P12866 | Alpha-factor-transporting ATPase (EC 7.4.2.7) (Mating factor A secretion protein STE6) (Multiple drug resistance protein homolog) (P-glycoprotein) | EBI-1637343 | 0.35 |
Q12118 | Small glutamine-rich tetratricopeptide repeat-containing protein 2 (SGT/UBP) (Viral protein U-binding protein) | EBI-1782119 | 0.64 |
Q12285 | Ubiquitin-like protein MDY2 (Golgi to ER traffic protein 5) (Mating-deficient protein 2) (Translation machinery-associated protein 24) | EBI-1782144 | 0.52 |
Q7LKB1 | Eukaryotic peptide chain release factor GTP-binding subunit (ERF-3) (ERF2) (Polypeptide release factor 3) (Translation release factor 3) | EBI-8411464 | 0.54 |
P39743 | Reduced viability upon starvation protein 167 | EBI-7317561 | 0.31 |
Q08273 | RING-box protein HRT1 (RING-box protein 1) (E3 ubiquitin-protein ligase complex SCF subunit HRT1) (High level expression reduces Ty3 transposition protein 1) (Regulator of cullins protein 1) | EBI-2794894 | 0.53 |
P25567 | RNA-binding protein SRO9 (Suppressor of RHO3 protein 9) | EBI-2904800 | 0.35 |
P0CS82 | Heme-responsive zinc finger transcription factor HAP1 (CYP1 activatory protein) (Heme activator protein 1) | EBI-2904800 | 0.35 |
P39101 | Protein CAJ1 | EBI-3654696 | 0.35 |
P46997 | J protein JJJ2 | EBI-3658264 | 0.35 |
P25294 | Protein SIS1 | EBI-3663071 | 0.35 |
P38009 | Bifunctional purine biosynthesis protein ADE17 [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (ATIC) (IMP synthase) (Inosinicase)] | EBI-3663079 | 0.35 |
P07244 | Bifunctional purine biosynthetic protein ADE5,7 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (Glycinamide ribonucleotide synthetase) (GAR synthetase) (GARS) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIR synthetase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase)] | EBI-3663087 | 0.35 |
P38972 | Phosphoribosylformylglycinamidine synthase (FGAM synthase) (FGAMS) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase) (FGAR amidotransferase) (FGAR-AT) (Formylglycinamide ribotide amidotransferase) | EBI-3663095 | 0.35 |
P25376 | General amino acid permease AGP1 (Asparagine/glutamine permease) | EBI-3663103 | 0.35 |
P47019 | Ribosome biogenesis protein ALB1 | EBI-3663111 | 0.35 |
P47771 | Aldehyde dehydrogenase [NAD(P)+] 1 (EC 1.2.1.3) | EBI-3663119 | 0.35 |
P54115 | Magnesium-activated aldehyde dehydrogenase, cytosolic (EC 1.2.1.-) (EC 1.2.1.4) (Mg(2+)-activated acetaldehyde dehydrogenase) (Mg(2+)-ACDH) | EBI-3663127 | 0.35 |
P46682 | AP-3 complex subunit beta (Adaptor-related protein complex 3 subunit beta) (Beta-3-adaptin) (Clathrin assembly protein complex 3 beta large chain) (Clathrin assembly protein large beta chain) | EBI-3663135 | 0.35 |
P38328 | Actin-related protein 2/3 complex subunit 1 (Arp2/3 complex 41 kDa subunit) (p41-ARC) | EBI-3663143 | 0.35 |
Q12500 | Late secretory pathway protein AVL9 (APL2 VPS1 synthetic lethal protein 9) | EBI-3663151 | 0.35 |
Q05029 | Protein BCH1 (BUD7 and CHS6 homolog 1) | EBI-3663159 | 0.35 |
P34730 | Protein BMH2 | EBI-3663167 | 0.35 |
P47039 | Probable kynurenine--oxoglutarate transaminase BNA3 (EC 2.6.1.7) (Biosynthesis of nicotinic acid protein 3) (Kynurenine aminotransferase) | EBI-3663175 | 0.35 |
Q07457 | E3 ubiquitin-protein ligase BRE1 (EC 2.3.2.27) (Brefeldin A-sensitivity protein 1) (RING-type E3 ubiquitin transferase BRE1) | EBI-3663183 | 0.35 |
P32639 | Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246) | EBI-3663191 | 0.35 |
P40096 | Negative cofactor 2 complex subunit alpha (NC2 complex subunit alpha) (Transcription repressor BUR6) | EBI-3663199 | 0.35 |
P00812 | Arginase (EC 3.5.3.1) | EBI-3663207 | 0.35 |
P33322 | H/ACA ribonucleoprotein complex subunit CBF5 (EC 5.4.99.-) (Centromere-binding factor 5) (Centromere/microtubule-binding protein CBF5) (H/ACA snoRNP protein CBF5) (Small nucleolar RNP protein CBF5) (p64') | EBI-3663215 | 0.35 |
P31384 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 (EC 3.1.13.4) (Carbon catabolite repressor protein 4) (Cytoplasmic deadenylase) (Glucose-repressible alcohol dehydrogenase transcriptional effector) | EBI-3663223 | 0.53 |
Q03705 | EKC/KEOPS complex subunit CGI121 (CGI-121 homolog) | EBI-3663231 | 0.35 |
P19454 | Casein kinase II subunit alpha' (CK II) (EC 2.7.11.1) | EBI-3663239 | 0.35 |
P53195 | Conserved oligomeric Golgi complex subunit 7 (COG complex subunit 7) (Complexed with DOR1 protein 5) (Component of oligomeric Golgi complex 7) | EBI-3663247 | 0.35 |
Q06440 | Coronin-like protein | EBI-3663263 | 0.35 |
P14922 | General transcriptional corepressor CYC8 (Glucose repression mediator protein CYC8) | EBI-3663271 | 0.35 |
P36009 | Probable ATP-dependent RNA helicase DHR2 (EC 3.6.4.13) (DEAH box RNA helicase DHR2) (Helicase JA2) | EBI-3663279 | 0.53 |
Q04216 | Defect at low temperature protein 1 | EBI-3663287 | 0.35 |
P54858 | Protein DOS2 | EBI-3663295 | 0.35 |
P32461 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 (Diphthamide biosynthesis protein 2) (Diphtheria toxin resistance protein 2) (S-adenosyl-L-methionine:L-histidine 3-amino-3-carboxypropyltransferase 2) | EBI-3663303 | 0.35 |
P53911 | Chromatin modification-related protein EAF7 (ESA1-associated factor 7) | EBI-3663311 | 0.35 |
P47169 | Sulfite reductase [NADPH] subunit beta (EC 1.8.1.2) (Extracellular mutant protein 17) | EBI-3663319 | 0.35 |
P38241 | Pre-mRNA-splicing factor SLT11 (Extracellular mutant protein 2) (Synthetic lethality with U2 protein 11) | EBI-3663327 | 0.35 |
P32324 | Elongation factor 2 (EF-2) (Eukaryotic elongation factor 2) (eEF2) (Ribosomal translocase) (Translation elongation factor 2) | EBI-3663335 | 0.35 |
Q04409 | Putative glucokinase-2 (EC 2.7.1.2) (Early meiotic induction protein 2) (Glucose kinase 2) (GLK-2) | EBI-3663343 | 0.35 |
P00924 | Enolase 1 (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase 1) (2-phosphoglycerate dehydratase 1) | EBI-3663351 | 0.35 |
P38333 | Essential nuclear protein 1 | EBI-3663359 | 0.35 |
P43572 | Enhancer of polycomb-like protein 1 | EBI-3663367 | 0.35 |
P32353 | Delta(7)-sterol 5(6)-desaturase ERG3 (EC 1.14.19.20) (C-5 sterol desaturase ERG3) (Ergosterol Delta(5,6) desaturase ERG3) (Ergosterol biosynthetic protein 3) (Sterol-C5-desaturase) | EBI-3663375 | 0.35 |
P39704 | Protein ERP2 | EBI-3663383 | 0.35 |
P38819 | Protein ERP5 | EBI-3663391 | 0.35 |
Q08649 | Histone acetyltransferase ESA1 (EC 2.3.1.48) (Protein 2-hydroxyisobutyryltransferase ESA1) (EC 2.3.1.-) (Protein acetyltransferase ESA1) (EC 2.3.1.-) (Protein crotonyltransferase ESA1) (EC 2.3.1.-) | EBI-3663399 | 0.35 |
P53743 | Pre-rRNA-processing protein ESF2 (18S rRNA factor 2) | EBI-3663407 | 0.35 |
Q12178 | Cytosine deaminase (yCD) (EC 3.5.4.1) (Cytosine aminohydrolase) (Fluorocytosine resistance protein 1) | EBI-3663415 | 0.35 |
P39730 | Eukaryotic translation initiation factor 5B (eIF-5B) (EC 3.6.5.3) (Translation initiation factor IF-2) | EBI-3663423 | 0.35 |
Q08193 | 1,3-beta-glucanosyltransferase GAS5 (EC 2.4.1.-) (Glycolipid-anchored surface protein 5) | EBI-3663431 | 0.35 |
P41814 | tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6) | EBI-3663439 | 0.35 |
P12754 | Translation initiation factor eIF-2B subunit delta (GCD complex subunit GCD2) (Guanine nucleotide exchange factor subunit GCD2) (eIF-2B GDP-GTP exchange factor subunit delta) | EBI-3663447 | 0.35 |
P43535 | Protein GCN20 (General control non-derepressible protein 20) | EBI-3663455 | 0.35 |
Q05584 | Hydroxyacylglutathione hydrolase, cytoplasmic isozyme (EC 3.1.2.6) (Glyoxalase II) (Glx II) | EBI-3663463 | 0.35 |
Q08220 | Glutathione synthetase GSH2 (GSH synthetase) (GSH-S) (EC 6.3.2.3) (Glutathione synthase) | EBI-3663471 | 0.35 |
P27472 | Glycogen [starch] synthase isoform 2 (EC 2.4.1.11) | EBI-3663479 | 0.35 |
P32190 | Glycerol kinase (GK) (Glycerokinase) (EC 2.7.1.30) (ATP:glycerol 3-phosphotransferase) | EBI-3663487 | 0.35 |
Q12180 | Halotolerance protein 9 | EBI-3663495 | 0.35 |
Q12341 | Histone acetyltransferase type B catalytic subunit (EC 2.3.1.48) | EBI-3663503 | 0.35 |
P20448 | ATP-dependent RNA helicase HCA4 (EC 3.6.4.13) (DEAD box protein 4) (Helicase CA4) (Helicase UF1) | EBI-3663511 | 0.35 |
P11353 | Oxygen-dependent coproporphyrinogen-III oxidase (COX) (Coprogen oxidase) (Coproporphyrinogenase) (EC 1.3.3.3) | EBI-3663519 | 0.35 |
Q04458 | Fatty aldehyde dehydrogenase HFD1 (EC 1.2.1.3) (EC 1.2.1.64) (Hexadecenal dehydrogenase) | EBI-3663527 | 0.35 |
P61830 | Histone H3 | EBI-3663535 | 0.35 |
P47171 | Histone transcription regulator 3 | EBI-3663543 | 0.35 |
Q03973 | High mobility group protein 1 (High spontaneous mutagenesis protein 2) | EBI-3663551 | 0.35 |
P32478 | Cell wall mannoprotein HSP150 (150 kDa heat shock glycoprotein) (Covalently-linked cell wall protein 7) (Protein with internal repeats 2) | EBI-3663559 | 0.35 |
P04912 | Histone H2A.2 | EBI-3663567 | 0.35 |
P07263 | Histidine--tRNA ligase, mitochondrial (EC 6.1.1.21) (Histidyl-tRNA synthetase) (HisRS) | EBI-3663575 | 0.35 |
Q12692 | Histone H2A.Z | EBI-3663583 | 0.35 |
P04807 | Hexokinase-2 (EC 2.7.1.1) (Hexokinase PII) (Hexokinase-B) | EBI-3663591 | 0.35 |
P43579 | Ino eighty subunit 1 | EBI-3663599 | 0.35 |
P38286 | Very-long-chain 3-oxoacyl-CoA reductase (EC 1.1.1.330) (3-ketoacyl-CoA reductase) (3-ketoreductase) (KAR) (Microsomal beta-keto-reductase) | EBI-3663607 | 0.35 |
P09436 | Isoleucine--tRNA ligase, cytoplasmic (EC 6.1.1.5) (Isoleucyl-tRNA synthetase) (IleRS) | EBI-3663615 | 0.35 |
P00927 | Threonine dehydratase, mitochondrial (EC 4.3.1.19) (Threonine deaminase) | EBI-3663623 | 0.35 |
P50095 | Inosine-5'-monophosphate dehydrogenase 3 (IMP dehydrogenase 3) (IMPD 3) (IMPDH 3) (EC 1.1.1.205) | EBI-3663631 | 0.35 |
P53115 | Chromatin-remodeling ATPase INO80 (EC 3.6.4.-) (Inositol-requiring protein 80) | EBI-3663639 | 0.35 |
P40006 | Increased recombination centers protein 22 | EBI-3663647 | 0.35 |
Q07821 | Iron-sulfur assembly protein 1 | EBI-3663655 | 0.35 |
P36132 | tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (Kinase-associated endopeptidase 1) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein KAE1) (tRNA threonylcarbamoyladenosine biosynthesis protein KAE1) | EBI-3663663 | 0.35 |
Q08979 | Kelch repeat-containing protein 3 | EBI-3663679 | 0.35 |
P22209 | Serine/threonine-protein kinase KIN3 (EC 2.7.11.1) | EBI-3663687 | 0.35 |
P40540 | ER membrane protein complex subunit 5 (Killer toxin-resistance protein 27) | EBI-3663695 | 0.35 |
Q3E840 | Diphthamide biosynthesis protein 3 (Kluyveromyces lactis toxin-insensitive protein 11) | EBI-3663703 | 0.35 |
P12695 | Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (EC 2.3.1.12) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) (Pyruvate dehydrogenase complex component E2) (PDC-E2) (PDCE2) | EBI-3663711 | 0.35 |
P57743 | U6 snRNA-associated Sm-like protein LSm3 (SmX4 protein) | EBI-3663719 | 0.35 |
P53905 | U6 snRNA-associated Sm-like protein LSm7 | EBI-3663727 | 0.35 |
P48570 | Homocitrate synthase, cytosolic isozyme (HCS) (EC 2.3.3.14) | EBI-3663735 | 0.35 |
P49367 | Homoaconitase, mitochondrial (EC 4.2.1.36) (Homoaconitate hydratase) | EBI-3663743 | 0.35 |
P11914 | Mitochondrial-processing peptidase subunit alpha (Alpha-MPP) (Inactive zinc metalloprotease alpha) (Matrix processing peptidase) (MPP) (Mitochondrial assembly protein 2) (Mitochondrial import function protein 2) | EBI-3663751 | 0.35 |
P39677 | Ribosome-releasing factor 2, mitochondrial (RRF2mt) (Elongation factor G 2, mitochondrial) (EF-G2mt) (mEF-G 2) | EBI-3663759 | 0.35 |
P24719 | Meiosis-specific serine/threonine-protein kinase MEK1 (EC 2.7.11.1) | EBI-3663767 | 0.35 |
P00958 | Methionine--tRNA ligase, cytoplasmic (EC 6.1.1.10) (Methionyl-tRNA synthetase) (MetRS) | EBI-3663775 | 0.35 |
P53128 | Methylenetetrahydrofolate reductase 2 (EC 1.5.1.20) (YmL45) | EBI-3663783 | 0.35 |
P33441 | THO complex subunit MFT1 (Mitochondrial fusion target protein 1) | EBI-3663791 | 0.35 |
P09440 | C-1-tetrahydrofolate synthase, mitochondrial (C1-THF synthase) [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9); Formyltetrahydrofolate synthetase (EC 6.3.4.3)] | EBI-3663799 | 0.35 |
P53141 | Myosin light chain 1 (Calmodulin-like myosin light chain MLC1) (Myosin-2 light chain) | EBI-3663807 | 0.35 |
P25847 | DNA mismatch repair protein MSH2 (MutS protein homolog 2) | EBI-3663815 | 0.35 |
P32335 | Protein MSS51, mitochondrial (Mitochondrial splicing suppressor protein 51) | EBI-3663823 | 0.35 |
P47047 | ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4) | EBI-3663831 | 0.35 |
P19524 | Myosin-2 (Cell division control protein 66) (Class V unconventional myosin MYO2) (Type V myosin heavy chain MYO2) (Myosin V MYO2) | EBI-3663839 | 0.35 |
P38205 | Multisite-specific tRNA:(cytosine-C(5))-methyltransferase (EC 2.1.1.202) (Multisite-specific tRNA:m5C-methyltransferase) (tRNA (cytosine-5-)-methyltransferase NCL1) (tRNA methyltransferase 4) | EBI-3663847 | 0.35 |
Q08972 | [NU+] prion formation protein 1 | EBI-3663855 | 0.35 |
P53081 | NGG1-interacting factor 3 | EBI-3663863 | 0.35 |
P06102 | General negative regulator of transcription subunit 3 | EBI-3663871 | 0.35 |
P53164 | NAD-capped RNA hydrolase NPY1 (DeNADding enzyme NPY1) (EC 3.6.1.-) (NADH pyrophosphatase) (EC 3.6.1.22) | EBI-3663879 | 0.35 |
P31378 | Endonuclease III homolog 1 (EC 3.2.2.-) (EC 4.2.99.18) (Bifunctional DNA N-glycosylase/DNA-(apurinic or apyrimidinic site) lyase 1) (DNA glycosylase/AP lyase 1) (Endonuclease III-like glycosylase 1) (Redoxyendonuclease 1) | EBI-3663887 | 0.35 |
P35172 | Probable trehalase (EC 3.2.1.28) (Alpha,alpha-trehalase) (Alpha,alpha-trehalose glucohydrolase) | EBI-3663895 | 0.35 |
P54784 | Origin recognition complex subunit 1 (Origin recognition complex 120 kDa subunit) | EBI-3663911 | 0.35 |
P50874 | Origin recognition complex subunit 5 (Origin recognition complex 53 kDa subunit) | EBI-3663919 | 0.35 |
P38826 | Origin recognition complex subunit 6 (ACS-associated protein 1) (Origin recognition complex 50 kDa subunit) | EBI-3663927 | 0.35 |
Q12451 | Oxysterol-binding protein homolog 2 (Oxysterol-binding protein-related protein 2) (ORP 2) (OSBP-related protein 2) | EBI-3663935 | 0.35 |
Q12447 | Polyamine N-acetyltransferase 1 (EC 2.3.1.-) (Arylalkylamine N-acetyltransferase homolog) (scAANAT) | EBI-3663943 | 0.35 |
P38254 | Probable tubulin--tyrosine ligase PBY1 (EC 6.3.2.25) (P-body-associated protein 1) | EBI-3663951 | 0.35 |
Q04264 | Sister chromatid cohesion protein PDS5 (Precocious dissociation of sisters protein 5) | EBI-3663959 | 0.35 |
P42841 | Polyadenylation factor subunit 2 | EBI-3663967 | 0.53 |
P47110 | DNA polymerase delta subunit 3 | EBI-3663975 | 0.35 |
P39985 | rDNA transcriptional regulator POL5 (EC 2.7.7.7) (DNA polymerase V) (POL V) (DNA polymerase phi) | EBI-3663983 | 0.35 |
P23595 | Serine/threonine-protein phosphatase PP2A-2 catalytic subunit (EC 3.1.3.16) | EBI-3663991 | 0.53 |
P32345 | Serine/threonine-protein phosphatase 4 catalytic subunit (PP4C) (EC 3.1.3.16) (Phosphatase PP2A-like catalytic subunit PPH3) | EBI-3663999 | 0.35 |
P53131 | Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 (EC 3.6.4.13) (Helicase JA1) | EBI-3664007 | 0.35 |
P28708 | Serine/threonine-protein kinase PRR1 (EC 2.7.11.1) (Pheromone response regulator 1) | EBI-3664015 | 0.35 |
Q12265 | Ribose-phosphate pyrophosphokinase 5 (EC 2.7.6.1) (Phosphoribosyl pyrophosphate synthase 5) | EBI-3664023 | 0.35 |
P41940 | Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1-phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP-hexose pyrophosphorylase) | EBI-3664031 | 0.35 |
Q12335 | Protoplast secreted protein 2 | EBI-3664039 | 0.35 |
Q12318 | Platinum sensitivity protein 3 | EBI-3664047 | 0.35 |
P09368 | Proline dehydrogenase, mitochondrial (EC 1.5.5.2) (Proline oxidase) | EBI-3664055 | 0.35 |
P06777 | DNA repair protein RAD1 | EBI-3664063 | 0.35 |
P32628 | UV excision repair protein RAD23 | EBI-3664071 | 0.35 |
P32641 | Checkpoint protein RAD24 | EBI-3664079 | 0.53 |
Q04231 | DNA repair protein RAD33 | EBI-3664095 | 0.35 |
P25454 | DNA repair protein RAD51 | EBI-3664103 | 0.35 |
P21538 | DNA-binding protein REB1 (QBP) | EBI-3664111 | 0.35 |
P22336 | Replication factor A protein 1 (RF-A protein 1) (DNA-binding protein BUF2) (Replication protein A 69 kDa DNA-binding subunit) (Single-stranded DNA-binding protein) | EBI-3664119 | 0.35 |
P39083 | Rho-type GTPase-activating protein 1 | EBI-3664127 | 0.35 |
Q00453 | Probable transcription repressor protein RGM1 | EBI-3664135 | 0.35 |
P16664 | Guanine nucleotide exchange factor subunit RGP1 (Reduced growth phenotype protein 1) (Rgp1p) | EBI-3664143 | 0.35 |
P48565 | pH-response regulator protein palH/RIM21 (Regulator of IME2 protein 21) | EBI-3664156 | 0.35 |
Q07844 | Ribosome biogenesis ATPase RIX7 | EBI-3664164 | 0.35 |
P21524 | Ribonucleoside-diphosphate reductase large chain 1 (EC 1.17.4.1) (Ribonucleotide reductase R1 subunit 1) (Ribonucleotide reductase large subunit 1) | EBI-3664172 | 0.35 |
P32561 | Histone deacetylase RPD3 (EC 3.5.1.98) (Transcriptional regulatory protein RPD3) | EBI-3664180 | 0.35 |
P17079 | 60S ribosomal protein L12-A (L15) (Large ribosomal subunit protein uL11-A) (YL23) | EBI-3664188 | 0.35 |
P53030 | 60S ribosomal protein L1-A (L10a) (Large ribosomal subunit protein uL1-A) | EBI-3664196 | 0.35 |
P32565 | 26S proteasome regulatory subunit RPN2 | EBI-3664204 | 0.35 |
P40016 | 26S proteasome regulatory subunit RPN3 | EBI-3664212 | 0.35 |
P40327 | 26S proteasome regulatory subunit 4 homolog (Tat-binding homolog 5) | EBI-3664220 | 0.35 |
Q12754 | Ribosomal RNA-processing protein 12 | EBI-3664228 | 0.35 |
P53236 | Chromatin structure-remodeling complex subunit RSC1 (RSC complex subunit RSC1) (Remodel the structure of chromatin complex subunit 1) | EBI-3664236 | 0.35 |
Q05543 | Regulator of Ty1 transposition protein 103 | EBI-3664244 | 0.35 |
Q03940 | RuvB-like protein 1 (RUVBL1) (EC 3.6.4.12) (TIP49-homology protein 1) (TIP49a homolog) | EBI-3664252 | 0.35 |
P32368 | Phosphatidylinositol-3-phosphatase SAC1 (EC 3.1.3.64) (Phosphatidylinositol-4-phosphate phosphatase) (Recessive suppressor of secretory defect) | EBI-3664260 | 0.35 |
Q08873 | Transgelin (Calponin homolog 1) | EBI-3664268 | 0.35 |
P40509 | Coatomer subunit epsilon (Epsilon-coat protein) (Epsilon-COP) | EBI-3664284 | 0.35 |
P38968 | Protein transport protein SEC31 (Protein WEB1) | EBI-3664292 | 0.35 |
O94742 | 26S proteasome complex subunit SEM1 | EBI-3664300 | 0.35 |
P46995 | Histone-lysine N-methyltransferase, H3 lysine-36 specific (EC 2.1.1.359) (Lysine N-methyltransferase 3) (SET domain-containing protein 2) | EBI-3664308 | 0.35 |
P53953 | SED5-binding protein 2 (SEC24-related protein 2) | EBI-3664316 | 0.35 |
P23293 | Serine/threonine-protein kinase BUR1 (EC 2.7.11.22) (EC 2.7.11.23) (Bypass UAS requirement protein 1) (Suppressor of GPA1-Vall50 mutation protein 1) | EBI-3664324 | 0.35 |
P51534 | SWI5-dependent HO expression protein 4 | EBI-3664332 | 0.35 |
P11978 | Regulatory protein SIR4 (Silent information regulator 4) | EBI-3664340 | 0.35 |
Q04195 | E3 SUMO-protein ligase SIZ1 (EC 2.3.2.-) (E3 SUMO-protein transferase SIZ2) (SAP and Miz-finger domain-containing protein 1) (Ubiquitin-like protein ligase 1) | EBI-3664348 | 0.35 |
P53327 | RQC trigger complex helicase SLH1 (EC 3.6.4.13) (Antiviral helicase SLH1) (SKI2-like helicase 1) | EBI-3664356 | 0.35 |
P38989 | Structural maintenance of chromosomes protein 2 (DA-box protein SMC2) | EBI-3664364 | 0.35 |
P47037 | Structural maintenance of chromosomes protein 3 (DA-box protein SMC3) | EBI-3664372 | 0.35 |
P36048 | Pre-mRNA-splicing factor SNU114 (114 kDa U5 small nuclear ribonucleoprotein component) (Growth inhibitory protein 10) | EBI-3664380 | 0.35 |
Q04053 | Sorting nexin-41 | EBI-3664388 | 0.35 |
P38633 | Mediator of RNA polymerase II transcription subunit 31 (Hpr1 suppressor protein 1) (Mediator complex subunit 31) | EBI-3664396 | 0.35 |
P38863 | Spindle pole body component SPC97 | EBI-3664404 | 0.35 |
P23561 | Serine/threonine-protein kinase STE11 (EC 2.7.11.25) | EBI-3664412 | 0.35 |
P05453 | Eukaryotic peptide chain release factor GTP-binding subunit (ERF-3) (ERF3) (ERF2) (G1 to S phase transition protein 1) (Omnipotent suppressor protein 2) (PSI no more protein 2) (Polypeptide release factor 3) (Translation release factor 3) | EBI-3664420 | 0.35 |
P53201 | SWR1-complex protein 4 (ESA1-associated factor 2) | EBI-3664428 | 0.35 |
P09959 | Regulatory protein SWI6 (Cell-cycle box factor subunit SWI6) (MBF subunit P90) (Trans-acting activator of HO endonuclease gene) | EBI-3664436 | 0.35 |
Q05471 | Helicase SWR1 (EC 3.6.4.12) (Swi2/Snf2-related 1) | EBI-3664444 | 0.35 |
Q12297 | Transcription initiation factor TFIID subunit 3 (TAFII-47) (TAFII47) (TBP-associated factor 3) (TBP-associated factor 47 kDa) | EBI-3664460 | 0.35 |
P33339 | Transcription factor tau 131 kDa subunit (TFIIIC 131 kDa subunit) (Transcription factor C subunit 4) | EBI-3664468 | 0.35 |
Q06339 | Transcription factor tau 91 kDa subunit (TFIIIC 91 kDa subunit) (Transcription factor C subunit 6) | EBI-3664476 | 0.35 |
P17423 | Homoserine kinase (HK) (HSK) (EC 2.7.1.39) | EBI-3664484 | 0.35 |
P23254 | Transketolase 1 (TK 1) (EC 2.2.1.1) | EBI-3664492 | 0.35 |
P40462 | Protein TMA108 (EC 3.4.11.-) (108 kDa translation machinery-associated protein) | EBI-3664500 | 0.35 |
P53840 | Topoisomerase 1-associated factor 1 | EBI-3664508 | 0.35 |
Q03280 | E3 ubiquitin-protein ligase TOM1 (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase TOM1) (Suppressor of snRNA protein 2) (Temperature-dependent organization in mitotic nucleus protein 1) | EBI-3664516 | 0.35 |
P06786 | DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II) | EBI-3664524 | 0.35 |
P43637 | Serine/threonine-protein kinase TOS3 (EC 2.7.11.1) (Target of SBF protein 3) | EBI-3664532 | 0.35 |
P06244 | cAMP-dependent protein kinase type 1 (PKA 1) (EC 2.7.11.11) (CDC25-suppressing protein kinase) (PK-25) | EBI-3664540 | 0.35 |
Q00764 | Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit (EC 2.4.1.15) (General glucose sensor subunit 1) (Glycogen metabolism control protein GLC6) (Trehalose synthase complex catalytic subunit TPS1) (Trehalose-6-phosphate synthase) (UDP-glucose-glucosephosphate glucosyltransferase) | EBI-3664548 | 0.35 |
P38426 | Trehalose synthase complex regulatory subunit TPS3 (Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 115 kDa subunit) | EBI-3664556 | 0.35 |
P38811 | Transcription-associated protein 1 (p400 kDa component of SAGA) | EBI-3664564 | 0.35 |
Q07527 | tRNA (guanosine(18)-2'-O)-methyltransferase (EC 2.1.1.34) (tRNA [Gm18] ribose methylase) (tRNA methyltransferase 3) | EBI-3664572 | 0.35 |
P00937 | Multifunctional tryptophan biosynthesis protein [Includes: Anthranilate synthase component 2 (AS) (EC 4.1.3.27) (Anthranilate synthase, glutamine amidotransferase component); Indole-3-glycerol phosphate synthase (EC 4.1.1.48) (PRAI)] | EBI-3664580 | 0.35 |
P38427 | Trehalose synthase complex regulatory subunit TSL1 (Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 123 kDa subunit) | EBI-3664588 | 0.35 |
Q07381 | Ribosome biogenesis protein TSR1 (20S rRNA accumulation protein 1) | EBI-3664596 | 0.35 |
P53378 | Tubulin gamma chain (Gamma-tubulin) | EBI-3664604 | 0.35 |
P36164 | Golgi apparatus membrane protein TVP38 (TLG2-vesicle protein of 38 kDa) | EBI-3664612 | 0.35 |
Q08960 | S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase (EC 4.1.3.44) (tRNA wybutosine-synthesizing protein 1) | EBI-3664620 | 0.35 |
Q01476 | Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.4.19.12) (Deubiquitinating enzyme 2) (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) | EBI-3664628 | 0.35 |
P43593 | Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.4.19.12) (Deubiquitinating enzyme 6) (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) | EBI-3664636 | 0.35 |
P54860 | E4 ubiquitin-protein ligase UFD2 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase UFD2) (Ubiquitin conjugation factor E4) (Ubiquitin fusion degradation protein 2) (UB fusion protein 2) | EBI-3664644 | 0.35 |
P33202 | Ubiquitin fusion degradation protein 4 (UB fusion protein 4) (EC 2.3.2.-) (HECT-type E3 ubiquitin transferase UFD4) (EC 2.3.2.26) | EBI-3664652 | 0.35 |
P38067 | Succinate-semialdehyde dehydrogenase [NADP(+)] (SSDH) (EC 1.2.1.16) | EBI-3664660 | 0.35 |
P28274 | CTP synthase 1 (EC 6.3.4.2) (CTP synthetase 1) (UTP--ammonia ligase 1) | EBI-3664668 | 0.35 |
P42945 | U3 small nucleolar RNA-associated protein 10 (U3 snoRNA-associated protein 10) (U three protein 10) (U3 protein 10 required for transcription) (t-UTP10) | EBI-3664676 | 0.35 |
Q05946 | U3 small nucleolar RNA-associated protein 13 (U3 snoRNA-associated protein 13) (U three protein 13) | EBI-3664684 | 0.35 |
Q06078 | U3 small nucleolar RNA-associated protein 21 (U3 snoRNA-associated protein 21) (U three protein 21) | EBI-3664692 | 0.35 |
P53276 | U3 small nucleolar RNA-associated protein 8 (U3 snoRNA-associated protein 8) (U three protein 8) (U3 protein 8 required for transcription) (t-UTP8) | EBI-3664700 | 0.35 |
P32623 | Probable glycosidase CRH2 (EC 3.2.-.-) (Congo red hypersensitive protein 2) (Unknown transcript 2 protein) | EBI-3664708 | 0.35 |
P53076 | Vacuolar import and degradation protein 30 (Glucose-induced degradation protein 1) | EBI-3664716 | 0.35 |
Q12045 | Spindle pole body-associated protein VIK1 (Vegetative interaction with KAR3 protein 1) | EBI-3664724 | 0.35 |
Q06685 | Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase (EC 2.7.4.24) (InsP6 and PP-IP5 kinase) | EBI-3664732 | 0.35 |
P34110 | Vacuolar protein sorting-associated protein 35 (Vacuolar protein-targeting protein 7) | EBI-3664740 | 0.35 |
Q12109 | Tryptophan--tRNA ligase, cytoplasmic (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) | EBI-3664748 | 0.35 |
P39735 | Single-strand annealing weakened protein 1 | EBI-3664756 | 0.35 |
P46683 | Ankyrin repeat-containing protein YAR1 | EBI-3664764 | 0.35 |
P38222 | Ribosomal lysine N-methyltransferase 3 (EC 2.1.1.-) | EBI-3664772 | 0.35 |
P38317 | Uncharacterized protein YBR219C | EBI-3664780 | 0.35 |
P25361 | Uncharacterized protein YCR043C | EBI-3664788 | 0.35 |
Q04093 | Putative lipase YDR444W (EC 3.1.-.-) | EBI-3664796 | 0.35 |
P16521 | Elongation factor 3A (EF-3) (EF-3A) (EC 3.6.4.-) (Eukaryotic elongation factor 3) (eEF3) (Translation elongation factor 3A) (Yeast elongation factor 3) | EBI-3664812 | 0.35 |
P43594 | MICOS complex subunit MIC19 (Altered inheritance of mitochondria protein 13, mitochondrial) (Mitochondrial contact site complex 19 kDa subunit) | EBI-3664820 | 0.35 |
P53262 | V0 assembly protein 1 | EBI-3664828 | 0.35 |
P38829 | MIP18 family protein YHR122W | EBI-3664836 | 0.35 |
P38833 | Uncharacterized protein YHR127W | EBI-3664844 | 0.35 |
P40533 | Protein TED1 (Trafficking of EMP24/ERV25-dependent cargo disrupted protein 1) | EBI-3664852 | 0.35 |
P36114 | IML2-like protein YKR018C | EBI-3664860 | 0.35 |
Q05778 | Proteasome chaperone 1 (Proteasome biogenesis-associated protein 1) | EBI-3664868 | 0.35 |
Q06188 | PWWP domain-containing protein YLR455W | EBI-3664876 | 0.35 |
Q04847 | Non-SCF-type F-box protein ROY1 (Repressor of YPT52) | EBI-3664884 | 0.35 |
P53970 | Protein-lysine N-methyltransferase EFM6 (EC 2.1.1.-) (Elongation factor methyltransferase 6) | EBI-3664892 | 0.35 |
P42842 | Essential for maintenance of the cell wall protein 1 | EBI-3664900 | 0.35 |
Q08206 | Uncharacterized protein YOL036W | EBI-3664908 | 0.35 |
Q08548 | Lysophospholipid acyltransferase (LPLAT) (EC 2.3.1.23) (EC 2.3.1.51) (EC 2.3.1.n6) (EC 2.3.1.n7) (1-acyl-sn-glycerol-3-phosphate acyltransferase) (AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) (Lysophosphatidylcholine acyltransferase) (LPCAT) (Lysophosphatidylethanolamine acyltransferase) (LPEAT) (Lysophosphatidylserine acyltransferase) (LPSAT) (Sphingolipid compensation protein 4) | EBI-3664916 | 0.35 |
Q08822 | Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial (ETF-QO) (ETF-ubiquinone oxidoreductase) (EC 1.5.5.1) (Changed intracellular redox state protein 2) (Electron-transferring-flavoprotein dehydrogenase) (ETF dehydrogenase) | EBI-3664924 | 0.35 |
P12688 | Serine/threonine-protein kinase YPK1 (EC 2.7.11.1) (Sphingosine-like immunosuppressant resistant protein 2) (Yeast protein kinase 1) | EBI-3664932 | 0.35 |
Q08924 | Regulator of Ty1 transposition protein 10 (Endosomal recycling protein 2) (tRNA (guanosine(34)-2'-O)-methyltransferase non-catalytic subunit TRM734) | EBI-3664940 | 0.35 |
O13585 | Dilute domain-containing protein YPR089W | EBI-3664948 | 0.35 |
Q06109 | Required for respiratory growth protein 8, mitochondrial | EBI-3664956 | 0.35 |
Q08245 | Protein ZEO1 (Zeocin resistance protein 1) | EBI-3664964 | 0.35 |
P53303 | Zinc finger protein ZPR1 | EBI-3664972 | 0.35 |
P11412 | Glucose-6-phosphate 1-dehydrogenase (G6PD) (EC 1.1.1.49) | EBI-3664980 | 0.35 |
P15108 | ATP-dependent molecular chaperone HSC82 (82 kDa heat shock cognate protein) (Heat shock protein Hsp90 constitutive isoform) | EBI-3664988 | 0.35 |
P47138 | Diphthamide biosynthesis protein 4 (J protein type 3) | EBI-3664996 | 0.35 |
P10591 | Heat shock protein SSA1 (Heat shock protein YG100) | EBI-3682766 | 0.53 |
P09435 | Heat shock protein SSA3 | EBI-3683827 | 0.35 |
P39987 | Heat shock protein SSC3, mitochondrial (Extracellular mutant protein 10) | EBI-3703899 | 0.35 |
P10592 | Heat shock protein SSA2 | EBI-3719486 | 0.35 |
P33416 | Heat shock protein 78, mitochondrial | EBI-3748847 | 0.35 |
P31539 | Heat shock protein 104 (Protein aggregation-remodeling factor HSP104) | EBI-3749791 | 0.35 |
Q12329 | Heat shock protein 42 (42 kDa heat shock protein) | EBI-3751647 | 0.35 |
P32048 | Lysine--tRNA ligase, mitochondrial (EC 6.1.1.6) (Lysyl-tRNA synthetase) (LysRS) | EBI-3752007 | 0.35 |
P06103 | Eukaryotic translation initiation factor 3 subunit B (eIF3b) (Cell cycle regulation and translation initiation protein) (Eukaryotic translation initiation factor 3 90 kDa subunit) (eIF3 p90) (Translation initiation factor eIF3 p90 subunit) | EBI-3752015 | 0.35 |
P04786 | DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) (Maintenance of killer protein 1) | EBI-3752023 | 0.35 |
P53852 | Cysteine--tRNA ligase (EC 6.1.1.16) (Cysteinyl-tRNA synthetase) (CysRS) | EBI-3752031 | 0.35 |
P15992 | Heat shock protein 26 (26 kDa heat shock protein) | EBI-3752039 | 0.35 |
P11484 | Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb) | EBI-3752047 | 0.35 |
P32589 | Heat shock protein homolog SSE1 (Chaperone protein MSI3) | EBI-3752055 | 0.35 |
P42884 | Putative aryl-alcohol dehydrogenase AAD14 (EC 1.1.1.-) | EBI-3763499 | 0.35 |
P37898 | Alanine/arginine aminopeptidase (EC 3.4.11.-) | EBI-3763507 | 0.35 |
Q03266 | Aminodeoxychorismate lyase (EC 4.1.3.38) (4-amino-4-deoxychorismate lyase) (ADC lyase) (ADCL) | EBI-3763515 | 0.35 |
Q00955 | Acetyl-CoA carboxylase (ACC) (EC 6.4.1.2) (Fatty acid synthetase 3) (mRNA transport-defective protein 7) [Includes: Biotin carboxylase (EC 6.3.4.14)] | EBI-3763523 | 0.35 |
P21192 | Metallothionein expression activator | EBI-3763531 | 0.35 |
Q07622 | Activator of C kinase protein 1 | EBI-3763539 | 0.35 |
P60010 | Actin (EC 3.6.4.-) | EBI-3763547 | 0.35 |
Q07732 | Accumulates dyads protein 3 | EBI-3763555 | 0.35 |
P22136 | ATPase expression protein 2, mitochondrial | EBI-3763563 | 0.35 |
Q12449 | Hsp90 co-chaperone AHA1 (Activator of Hsp90 ATPase protein 1) | EBI-3763571 | 0.35 |
P03875 | Putative COX1/OXI3 intron 1 protein | EBI-3763579 | 0.35 |
Q9ZZX1 | Intron-encoded DNA endonuclease aI5 alpha (DNA endonuclease I-SceIV) [Cleaved into: Truncated non-functional cytochrome oxidase 1; DNA endonuclease aI5 alpha (EC 3.1.-.-) (Intron-encoded endonuclease I-SceIV)] | EBI-3763587 | 0.35 |
Q12013 | Probable palmitoyltransferase AKR2 (EC 2.3.1.225) (Ankyrin repeat-containing protein AKR2) | EBI-3763595 | 0.35 |
P47029 | Arrestin-related trafficking adapter 3 (Arrestin-like protein 2) | EBI-3763603 | 0.35 |
P22108 | Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase 2 (Ap4A phosphorylase 2) (EC 2.7.7.53) (ADP-sulfurylase) (EC 2.7.7.5) (ATP adenylyltransferase) | EBI-3763611 | 0.35 |
Q04601 | Anaphase-promoting complex subunit 4 | EBI-3763619 | 0.35 |
P38281 | Actin patches distal protein 1 | EBI-3763627 | 0.35 |
P27351 | AP-2 complex subunit beta (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Clathrin assembly protein large beta chain) | EBI-3763635 | 0.35 |
P38065 | AP-2 complex subunit alpha (Alpha-adaptin) (Clathrin assembly protein complex 2 alpha large chain) (Clathrin assembly protein large alpha chain) | EBI-3763643 | 0.35 |
Q08951 | AP-3 complex subunit delta (Adaptor-related protein complex 3 subunit delta) (Delta-adaptin 3) (Delta-adaptin) | EBI-3763651 | 0.35 |
P11076 | ADP-ribosylation factor 1 (EC 3.6.5.2) | EBI-3763659 | 0.35 |
P04076 | Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase) | EBI-3763667 | 0.35 |
P38116 | ADP-ribosylation factor-like protein 1 (Arf-like GTPase 1) | EBI-3763675 | 0.35 |
P08566 | Pentafunctional AROM polypeptide [Includes: 3-dehydroquinate synthase (DHQS) (EC 4.2.3.4); 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS); Shikimate kinase (SK) (EC 2.7.1.71); 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10); Shikimate dehydrogenase (EC 1.1.1.25)] | EBI-3763683 | 0.35 |
Q04052 | Transcriptional activator ARO80 | EBI-3763691 | 0.35 |
P34233 | Transcriptional regulatory protein ASH1 (Daughter cells HO repressor protein) | EBI-3763699 | 0.35 |
P39945 | Protein AST2 (ATPAse stabilizing protein 1) | EBI-3763715 | 0.35 |
Q12527 | Autophagy-related protein 11 (Cytoplasm to vacuole targeting protein 9) | EBI-3763723 | 0.35 |
P53855 | Autophagy-related protein 2 (Sporulation-specific protein 72) | EBI-3763731 | 0.35 |
Q12142 | Autophagy-related protein 9 (Cytoplasm to vacuole targeting protein 7) | EBI-3763739 | 0.35 |
P32453 | Protein ATP11, mitochondrial | EBI-3763747 | 0.35 |
Q08236 | Target of rapamycin complex 2 subunit AVO1 (TORC2 subunit AVO1) (Adheres voraciously to TOR2 protein 1) | EBI-3763755 | 0.35 |
P47068 | Myosin tail region-interacting protein MTI1 (Protein BBC1) | EBI-3763763 | 0.35 |
Q01389 | Serine/threonine-protein kinase BCK1/SLK1/SSP31 (EC 2.7.11.1) | EBI-3763771 | 0.35 |
P46678 | Transcription factor TFIIIB component B'' (TFIIIB90) | EBI-3763779 | 0.35 |
Q08347 | Alkyl/aryl-sulfatase BDS1 (EC 3.1.6.-) (Bacterially-derived sulfatase 1) | EBI-3763787 | 0.35 |
P39960 | GTPase-activating protein BEM2/IPL2 (Bud emergence protein 2) | EBI-3763800 | 0.35 |
P43583 | Proteasome activator BLM10 (Bleomycin resistance protein BLM10) | EBI-3763808 | 0.35 |
Q08965 | Ribosome biogenesis protein BMS1 | EBI-3763816 | 0.35 |
P47125 | Indoleamine 2,3-dioxygenase (IDO) (EC 1.13.11.52) (Biosynthesis of nicotinic acid protein 2) | EBI-3763824 | 0.35 |
P41832 | Protein BNI1 (Pointed projection formation protein 3) (Sensitive to high expression protein 5) (Synthetic lethal 39) | EBI-3763832 | 0.35 |
P40450 | BNI1-related protein 1 | EBI-3763840 | 0.35 |
P38041 | Protein BOB1 (BEM1-binding protein) (Growth inhibitory protein 7) | EBI-3763848 | 0.35 |
P39969 | Protein BOI2 (Protein BEB1) | EBI-3763856 | 0.35 |
P25385 | Protein transport protein BOS1 (Bet one suppressor 1) | EBI-3763864 | 0.35 |
P25356 | Beige protein homolog 1 | EBI-3763872 | 0.35 |
P33314 | Inhibitory regulator protein BUD2/CLA2 (Bud site selection protein 2) | EBI-3763880 | 0.35 |
P41697 | Bud site selection protein 6 (Actin-interacting protein 3) | EBI-3763888 | 0.35 |
P48524 | Ubiquitin ligase-binding protein BUL1 (Respiration deficiency suppressor 1) | EBI-3763896 | 0.35 |
P53280 | Protein CAF130 (130 kDa CCR4-associated factor) | EBI-3763904 | 0.35 |
P29547 | Elongation factor 1-gamma 1 (EF-1-gamma 1) (Calcium and membrane-binding protein 1) (Calcium phospholipid-binding protein) (CPBP) (Eukaryotic elongation factor 1Bgamma 1) (eEF1Bgamma 1) (Translation elongation factor 1B gamma 1) | EBI-3763912 | 0.35 |
P28495 | F-actin-capping protein subunit alpha | EBI-3763920 | 0.35 |
P53894 | Serine/threonine-protein kinase CBK1 (EC 2.7.11.1) (Cell wall biosynthesis kinase) | EBI-3763928 | 0.35 |
P38626 | NADH-cytochrome b5 reductase 1 (EC 1.6.2.2) (Microsomal cytochrome b reductase) (P35) | EBI-3763936 | 0.35 |
Q03702 | Cruciform cutting endonuclease 1, mitochondrial (EC 3.1.21.10) | EBI-3763944 | 0.35 |
P00549 | Pyruvate kinase 1 (PK 1) (EC 2.7.1.40) (cell division cycle protein 19) | EBI-3763952 | 0.35 |
P26309 | APC/C activator protein CDC20 (Cell division control protein 20) | EBI-3763960 | 0.53 |
P06785 | Thymidylate synthase (TS) (TSase) (EC 2.1.1.45) (Cell division cycle protein 21) (Constitutive RNR3 transcription protein 9) | EBI-3763968 | 0.35 |
P25655 | General negative regulator of transcription subunit 1 (Cell division cycle protein 39) | EBI-3763976 | 0.35 |
P07834 | Cell division control protein 4 (E3 ubiquitin ligase complex SCF subunit CDC4) (F-box protein CDC4) | EBI-3763984 | 0.35 |
Q08032 | Cell division control protein 45 | EBI-3763992 | 0.35 |
P25694 | Cell division control protein 48 (EC 3.6.4.6) (Cell division cycle protein 48) (Transitional endoplasmic reticulum ATPase homolog) | EBI-3764000 | 0.35 |
P30665 | DNA replication licensing factor MCM4 (EC 3.6.4.12) (Cell division control protein 54) | EBI-3764008 | 0.35 |
P39525 | 3-oxoacyl-[acyl-carrier-protein] synthase homolog (EC 2.3.1.41) (Beta-ketoacyl-ACP synthase homolog) | EBI-3764016 | 0.35 |
O13297 | mRNA-capping enzyme subunit beta (EC 3.6.1.74) (mRNA 5'-phosphatase) (mRNA 5'-triphosphate monophosphatase) | EBI-3764024 | 0.35 |
Q12453 | Cytoplasmic export protein 1 | EBI-3764032 | 0.35 |
Q06632 | Protein CFT1 (Cleavage factor two protein 1) | EBI-3764040 | 0.35 |
P32657 | Chromo domain-containing protein 1 (EC 3.6.4.-) (ATP-dependent helicase CHD1) | EBI-3764048 | 0.35 |
P22516 | ATP-dependent DNA helicase CHL1 (EC 3.6.4.12) (Chromosome loss protein 1) (Chromosome transmission fidelity protein 1) | EBI-3764056 | 0.35 |
P29465 | Chitin synthase 3 (EC 2.4.1.16) (Chitin-UDP acetyl-glucosaminyl transferase 3) (Class-IV chitin synthase 3) | EBI-3764064 | 0.35 |
P38779 | Proteasome-interacting protein CIC1 (Core interacting component 1) | EBI-3764072 | 0.35 |
P40987 | Chromosome instability protein 1 | EBI-3764080 | 0.35 |
P27895 | Kinesin-like protein CIN8 (Chromosome instability protein 8) | EBI-3764088 | 0.35 |
P20485 | Choline kinase (EC 2.7.1.32) (ATP:choline phosphotransferase) | EBI-3764096 | 0.35 |
P48562 | Serine/threonine-protein kinase CLA4 (EC 2.7.11.1) | EBI-3764104 | 0.35 |
Q08685 | mRNA cleavage and polyadenylation factor CLP1 | EBI-3764112 | 0.35 |
Q03690 | Clustered mitochondria protein 1 (Translation initiation factor 31) (eIF3-associated protein p135) | EBI-3764120 | 0.35 |
P06787 | Calmodulin (CaM) | EBI-3764128 | 0.35 |
P23287 | Serine/threonine-protein phosphatase 2B catalytic subunit A1 (EC 3.1.3.16) (Calcineurin A1) (Calmodulin-binding protein 1) | EBI-3764136 | 0.53 |
Q04632 | Conserved oligomeric Golgi complex subunit 8 (COG complex subunit 8) (Component of oligomeric Golgi complex 8) | EBI-3764144 | 0.35 |
P53622 | Coatomer subunit alpha (Alpha-coat protein) (Alpha-COP) (Retrieval from endoplasmic reticulum protein 1) (Secretory protein 22) (Suppressor of osmo-sensitivity 1) | EBI-3764152 | 0.35 |
P49017 | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (2-hexaprenyl-6-methoxy-1,4-benzoquinol methyltransferase) (Ubiquinone biosynthesis methyltransferase COQ5) | EBI-3764160 | 0.35 |
Q04935 | Cytochrome c oxidase assembly protein COX20, mitochondrial | EBI-3764168 | 0.35 |
P23285 | Peptidyl-prolyl cis-trans isomerase B (PPIase B) (EC 5.2.1.8) (Cyclophilin B) (Cyclophilin-related protein) (Rotamase B) | EBI-3764176 | 0.35 |
P33307 | Importin alpha re-exporter (Chromosome segregation protein CSE1) | EBI-3764184 | 0.35 |
Q12734 | Transcription factor CSR2 (CHS5 SPA2 rescue protein 2) | EBI-3764192 | 0.35 |
Q01454 | DNA polymerase alpha-binding protein (Chromosome replication protein CHL15) (Chromosome transmission fidelity protein 4) (Protein POB1) | EBI-3764200 | 0.35 |
P89105 | RNA polymerase-associated protein CTR9 (Centromere-binding factor 1-dependent protein 1) (Cln three-requiring protein 9) | EBI-3764208 | 0.56 |
P53008 | Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106) (Processing A-glucosidase I) (Glucosidase I) | EBI-3764216 | 0.35 |
P32898 | Mitochondrial presequence protease (EC 3.4.24.-) (Cytosolic metalloprotease 1) (Metalloprotease of 112 kDa) | EBI-3764224 | 0.35 |
P08678 | Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase) | EBI-3764232 | 0.35 |
P32582 | Cystathionine beta-synthase (EC 4.2.1.22) (Beta-thionase) (Serine sulfhydrase) (Sulfur transfer protein 4) | EBI-3764240 | 0.35 |
Q12389 | ATP-dependent RNA helicase DBP10 (EC 3.6.4.13) (DEAD box protein 10) | EBI-3764248 | 0.35 |
P06634 | ATP-dependent RNA helicase DED1 (EC 3.6.4.13) (DEAD box protein 1) (Defines essential domain protein 1) | EBI-3764264 | 0.35 |
Q08496 | Protein DIA2 (Digs into agar protein 2) | EBI-3764272 | 0.53 |
P25453 | Meiotic recombination protein DMC1 | EBI-3764280 | 0.53 |
P38859 | DNA replication ATP-dependent helicase/nuclease DNA2 [Includes: DNA replication nuclease DNA2 (EC 3.1.-.-); DNA replication ATP-dependent helicase DNA2 (EC 3.6.4.12)] | EBI-3764288 | 0.35 |
Q12675 | Phospholipid-transporting ATPase DNF2 (EC 7.6.2.1) (Flippase DNF2) | EBI-3764296 | 0.35 |
Q12674 | Probable phospholipid-transporting ATPase DNF3 (EC 7.6.2.1) (Aminophospholipid translocase) (APT) (Phospholipid translocase) (PLT) | EBI-3764304 | 0.35 |
Q08387 | DNA ligase 4 (EC 6.5.1.1) (DNA ligase II) (DNA ligase IV) (Polydeoxyribonucleotide synthase [ATP] 4) | EBI-3764312 | 0.35 |
P54861 | Dynamin-related protein DNM1 (EC 3.6.5.5) | EBI-3764320 | 0.35 |
Q05610 | Donuts protein 1 | EBI-3764328 | 0.35 |
Q03921 | Protein dopey | EBI-3764336 | 0.35 |
P24482 | DNA polymerase epsilon subunit B (DNA polymerase II subunit 2) | EBI-3764344 | 0.35 |
P53847 | Protein transport protein DSL1 (Dependent on SLY1-20 protein 1) | EBI-3764352 | 0.35 |
P38149 | Probable di- and tripeptidase DUG2 (EC 3.4.-.-) (Deficient in utilization of glutathione protein 2) (GSH degradosomal complex subunit DUG2) | EBI-3764360 | 0.35 |
Q12432 | Chromatin modification-related protein EAF3 (ESA1-associated factor 3) | EBI-3764368 | 0.35 |
Q04110 | Protein ECM11 (Extracellular mutant protein 11) | EBI-3764376 | 0.35 |
Q04217 | Probable ATP-dependent RNA helicase DHR1 (EC 3.6.4.13) (DEAH box RNA helicase DHR1) (Extracellular mutant protein 16) | EBI-3764384 | 0.35 |
Q05958 | Sterol regulatory element-binding protein ECM22 (Extracellular mutant protein 22) | EBI-3764392 | 0.35 |
P32525 | Protein ECM25 (Extracellular matrix protein 25) | EBI-3764400 | 0.35 |
Q06673 | Protein ECM30 (Extracellular mutant protein 30) | EBI-3764416 | 0.35 |
Q03214 | Protein ECM5 (Extracellular matrix protein 5) | EBI-3764424 | 0.35 |
P40557 | ER-retained PMA1-suppressing protein 1 (EC 5.3.4.1) | EBI-3764440 | 0.35 |
P10614 | Lanosterol 14-alpha demethylase CYP51 (EC 1.14.14.154) (Cytochrome P450 51) (Cytochrome P450-14DM) (Cytochrome P450-LIA1) (CYPLI) (Ergosterol biosynthetic protein 11) (Sterol 14-alpha demethylase) | EBI-3764448 | 0.35 |
Q03018 | Separin (EC 3.4.22.49) (Separase) | EBI-3764456 | 0.35 |
Q06163 | Telomerase reverse transcriptase (EC 2.7.7.49) (Telomerase catalytic subunit) | EBI-3764469 | 0.35 |
P34756 | 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 (Phosphatidylinositol 3-phosphate 5-kinase) (EC 2.7.1.150) (Formation of aploid and binucleate cells protein 1) (Styryl dye vacuolar localization protein 7) (Type III PIP kinase) (PIPkin-III) | EBI-3764477 | 0.35 |
P53971 | FKBP12-associated protein 1 | EBI-3764485 | 0.35 |
P46671 | Factor arrest protein 3 | EBI-3764493 | 0.35 |
P19097 | Fatty acid synthase subunit alpha (EC 2.3.1.86) [Includes: Acyl carrier; 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) (Beta-ketoacyl reductase); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41) (Beta-ketoacyl synthase)] | EBI-3764501 | 0.35 |
P14540 | Fructose-bisphosphate aldolase (FBP aldolase) (FBPA) (EC 4.1.2.13) (Fructose-1,6-bisphosphate aldolase) | EBI-3764509 | 0.35 |
P39521 | Pre-rRNA-processing protein FHL1 | EBI-3764517 | 0.35 |
P32785 | Methionyl-tRNA formyltransferase, mitochondrial (MtFMT) (EC 2.1.2.9) | EBI-3764525 | 0.35 |
P53848 | Folic acid synthesis protein FOL1 [Includes: Dihydroneopterin aldolase (DHNA) (EC 4.1.2.25) (7,8-dihydroneopterin aldolase) (FASA) (FASB); 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase (HPPK) (EC 2.7.6.3) (2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) (PPPK) (FASC); Dihydropteroate synthase (DHPS) (EC 2.5.1.15) (Dihydropteroate pyrophosphorylase) (FASD)] | EBI-3764533 | 0.35 |
P38911 | Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) (FK506-binding nuclear protein) (FKBP-70) (Nucleolar proline isomerase) (Proline rotamase) | EBI-3764541 | 0.35 |
Q12333 | Ferric/cupric reductase transmembrane component 7 (EC 1.16.1.9) (Ferric-chelate reductase 7) | EBI-3764549 | 0.35 |
P31380 | ATP-dependent helicase FUN30 (EC 3.6.4.12) | EBI-3764557 | 0.35 |
P46949 | Protein FYV8 (Function required for yeast viability protein 8) | EBI-3764565 | 0.35 |
P38297 | Mitofusin FZO1 (EC 3.6.5.-) (Transmembrane GTPase FZO1) | EBI-3764573 | 0.35 |
P09032 | Translation initiation factor eIF-2B subunit gamma (GCD complex subunit GCD1) (Guanine nucleotide exchange factor subunit GCD1) (eIF-2B GDP-GTP exchange factor subunit gamma) | EBI-3764581 | 0.35 |
P32481 | Eukaryotic translation initiation factor 2 subunit gamma (eIF-2-gamma) (EC 3.6.5.3) | EBI-3764589 | 0.35 |
P32501 | Translation initiation factor eIF-2B subunit epsilon (GCD complex subunit GCD6) (Guanine nucleotide exchange factor subunit GCD6) (eIF-2B GDP-GTP exchange factor subunit epsilon) | EBI-3764597 | 0.35 |
Q03330 | Histone acetyltransferase GCN5 (EC 2.3.1.48) (Histone crotonyltransferase GCN5) (EC 2.3.1.-) | EBI-3764613 | 0.35 |
Q06625 | Glycogen debranching enzyme (Glycogen debrancher) [Includes: 4-alpha-glucanotransferase (EC 2.4.1.25) (Oligo-1,4-1,4-glucantransferase); Amylo-alpha-1,6-glucosidase (Amylo-1,6-glucosidase) (EC 3.2.1.33) (Dextrin 6-alpha-D-glucosidase)] | EBI-3764621 | 0.35 |
P47102 | ARF guanine-nucleotide exchange factor 1 | EBI-3764629 | 0.35 |
P53192 | Golgi to ER traffic protein 1 (Guided entry of tail-anchored proteins 1) (Mitochondrial distribution and morphology protein 39) | EBI-3764637 | 0.35 |
Q03016 | GLC7-interacting protein 3 | EBI-3764645 | 0.35 |
Q12680 | Glutamate synthase [NADH] (EC 1.4.1.14) (NADH-GOGAT) | EBI-3764653 | 0.35 |
P08539 | Guanine nucleotide-binding protein alpha-1 subunit (GP1-alpha) | EBI-3764661 | 0.35 |
P41911 | Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial (EC 1.1.1.8) | EBI-3764669 | 0.35 |
P00950 | Phosphoglycerate mutase 1 (PGAM 1) (EC 5.4.2.11) (BPG-dependent PGAM 1) (MPGM 1) (Phosphoglyceromutase 1) | EBI-3764677 | 0.35 |
P25373 | Glutaredoxin-1 (EC 1.11.1.9) (EC 2.5.1.18) (Glutathione-dependent oxidoreductase 1) | EBI-3764685 | 0.35 |
P32477 | Glutamate--cysteine ligase (EC 6.3.2.2) (Gamma-ECS) (GCS) (Gamma-glutamylcysteine synthetase) | EBI-3764693 | 0.35 |
P48239 | Glutathione S-transferase omega-like 1 (EC 2.5.1.18) (Glutathione-dependent dehydroascorbate reductase) (EC 1.8.5.1) | EBI-3764701 | 0.35 |
Q08929 | Membrane-bound O-acyltransferase GUP2 (Glycerol uptake protein 2) | EBI-3764714 | 0.35 |
Q05775 | Eukaryotic translation initiation factor 3 subunit J (eIF3j) (Eukaryotic translation initiation factor 3 30 kDa subunit) (eIF-3 30 kDa) (High-copy suppressor of Rpg1 protein 1) | EBI-3764722 | 0.35 |
P40012 | Protoporphyrinogen oxidase (PPO) (EC 1.3.3.4) | EBI-3764730 | 0.35 |
P32874 | Acetyl-CoA carboxylase, mitochondrial (ACC) (EC 6.4.1.2) [Includes: Biotin carboxylase (EC 6.3.4.14)] | EBI-3764738 | 0.35 |
P48362 | Protein HGH1 (HMG1/2 protein homolog) | EBI-3764746 | 0.35 |
P02309 | Histone H4 | EBI-3764754 | 0.35 |
P33734 | Imidazole glycerol phosphate synthase hisHF (IGP synthase) (IGPS) (ImGP synthase) (EC 4.3.2.10) [Includes: Glutaminase (EC 3.5.1.2); Cyclase] | EBI-3764762 | 0.35 |
Q08702 | Aprataxin-like protein (EC 3.6.1.71) (EC 3.6.1.72) (Hit family protein 3) | EBI-3764770 | 0.35 |
Q05080 | Cytokinesis protein 2 (Homolog of CDC15 protein 1) | EBI-3764778 | 0.35 |
P40480 | Protein HOS4 | EBI-3764786 | 0.35 |
Q05787 | ERAD-associated E3 ubiquitin-protein ligase component HRD3 (HMG-CoA reductase degradation protein 3) | EBI-3764794 | 0.35 |
Q05549 | ATP-dependent helicase HRQ1 (EC 3.6.4.12) (Homologous to recQ protein 1) | EBI-3764802 | 0.35 |
Q12385 | 1-acylglycerol-3-phosphate O-acyltransferase ICT1 (EC 2.3.1.51) (Increased copper tolerance protein 1) (Lysophosphatidic acid acyltransferase ICT1) (LPAAT) | EBI-3764810 | 0.35 |
P53982 | Isocitrate dehydrogenase [NADP] (IDH) (EC 1.1.1.42) (IDP) (NADP(+)-specific ICDH) (Oxalosuccinate decarboxylase) | EBI-3764818 | 0.35 |
P25038 | Translation initiation factor IF-2, mitochondrial (IF-2(Mt)) (IF-2Mt) (IF2(mt)) | EBI-3764826 | 0.35 |
P53897 | mRNA stability protein IGO1 (Initiation of G zero protein 1) | EBI-3764834 | 0.35 |
Q06706 | Elongator complex protein 1 (Gamma-toxin target 1) (Protein IKI3) | EBI-3764842 | 0.35 |
P25605 | Acetolactate synthase small subunit, mitochondrial (Acetohydroxy-acid synthase small subunit) (AHAS) (ALS) | EBI-3764850 | 0.35 |
P25642 | 54S ribosomal protein IMG2, mitochondrial (Integrity of mitochondrial genome protein 2) (Mitochondrial large ribosomal subunit protein mL49) | EBI-3764858 | 0.35 |
Q06704 | Golgin IMH1 (Integrins and myosins homology protein 1) | EBI-3764866 | 0.35 |
P47170 | Vacuolar membrane-associated protein IML1 (Increased minichromosome loss protein 1) (SEH-associated protein 1) | EBI-3764874 | 0.35 |
P50942 | Polyphosphatidylinositol phosphatase INP52 (Synaptojanin-like protein 2) [Includes: SAC1-like phosphoinositide phosphatase (EC 3.1.3.-); Phosphatidylinositol 4,5-bisphosphate 5-phosphatase (EC 3.1.3.36)] | EBI-3764882 | 0.35 |
Q12271 | Polyphosphatidylinositol phosphatase INP53 (Suppressor of PMA1 protein 2) (Synaptojanin-like protein 3) [Includes: SAC1-like phosphoinositide phosphatase (EC 3.1.3.-); Phosphatidylinositol 4,5-bisphosphate 5-phosphatase (EC 3.1.3.36)] | EBI-3764890 | 0.35 |
Q08227 | Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP54 (EC 3.1.3.36) | EBI-3764898 | 0.35 |
P47056 | Outer spore wall protein 6 (Increased recombination centers protein 18) | EBI-3764911 | 0.35 |
Q07843 | Increased recombination centers protein 19 (Respiratory growth protein 4) | EBI-3764919 | 0.35 |
Q06554 | Uncharacterized ATP-dependent helicase IRC20 (EC 3.6.1.-) (Increased recombination centers protein 20) | EBI-3764927 | 0.35 |
P40541 | Cohesin subunit SCC3 (Irregular cell behavior protein 1) | EBI-3764935 | 0.35 |
P38250 | Increased sodium tolerance protein 2 | EBI-3764943 | 0.35 |
P38144 | ISWI chromatin-remodeling complex ATPase ISW1 (EC 3.6.4.-) | EBI-3764951 | 0.35 |
P53125 | Imitation switch two complex protein 1 | EBI-3764959 | 0.35 |
Q12358 | Alpha-ketoglutarate-dependent sulfonate dioxygenase (EC 1.14.11.-) | EBI-3764967 | 0.35 |
P38853 | Kelch repeat-containing protein 1 | EBI-3764983 | 0.35 |
P28742 | Kinesin-like protein KIP1 (Chromosome instability protein 9) | EBI-3764991 | 0.35 |
P32350 | Dual specificity protein kinase KNS1 (EC 2.7.12.1) | EBI-3764999 | 0.35 |
P38873 | Target of rapamycin complex 1 subunit KOG1 (TORC1 subunit KOG1) (Kontroller of growth protein 1) (Local anesthetic-sensitive protein 24) (Regulatory-associated protein of TOR) (Raptor) | EBI-3765007 | 0.35 |
P27810 | Alpha-1,2 mannosyltransferase KTR1 (EC 2.4.1.-) | EBI-3765015 | 0.35 |
P38130 | Probable mannosyltransferase KTR3 (EC 2.4.1.-) | EBI-3765023 | 0.35 |
Q08963 | U2 small nuclear ribonucleoprotein A' (U2 snRNP A') (Looks exceptionally like U2A protein 1) | EBI-3765031 | 0.35 |
P53598 | Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial (EC 6.2.1.5) (Succinyl-CoA synthetase subunit alpha) (SCS-alpha) | EBI-3765039 | 0.35 |
P53312 | Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial (EC 6.2.1.5) (Succinyl-CoA synthetase beta chain) (SCS-beta) | EBI-3765047 | 0.35 |
P07866 | Guanine nucleotide exchange factor LTE1 (Low temperature essential protein 1) | EBI-3765055 | 0.35 |
P40495 | Homoisocitrate dehydrogenase, mitochondrial (HIcDH) (EC 1.1.1.87) | EBI-3765063 | 0.35 |
P40957 | Spindle assembly checkpoint component MAD1 (Mitotic arrest deficient protein 1) | EBI-3765071 | 0.35 |
P29469 | DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2) | EBI-3765079 | 0.35 |
P24279 | DNA replication licensing factor MCM3 (EC 3.6.4.12) (Minichromosome maintenance protein 3) | EBI-3765087 | 0.35 |
Q01846 | Structural protein MDM1 (Mitochondrial distribution and morphology protein 1) | EBI-3765095 | 0.35 |
P38111 | Serine/threonine-protein kinase MEC1 (EC 2.7.11.1) (ATR homolog) (DNA-damage checkpoint kinase MEC1) (Mitosis entry checkpoint protein 1) | EBI-3765103 | 0.35 |
P05694 | 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (EC 2.1.1.14) (Cobalamin-independent methionine synthase) (Delta-P8 protein) (Methionine synthase, vitamin-B12 independent isozyme) | EBI-3765111 | 0.35 |
P43638 | MAP-homologous protein 1 | EBI-3765119 | 0.35 |
P38760 | RNA-binding protein MIP6 (MEX67-interacting protein 6) | EBI-3765135 | 0.35 |
P40850 | Post-transcriptional regulator MKT1 (Inactive endonuclease MKT1) | EBI-3765143 | 0.35 |
Q07980 | DNA mismatch repair protein MLH2 (MutL protein homolog 2) | EBI-3765151 | 0.35 |
Q12083 | DNA mismatch repair protein MLH3 (MutL protein homolog 3) | EBI-3765159 | 0.35 |
P36044 | Protein MNN4 | EBI-3765183 | 0.35 |
P07884 | tRNA dimethylallyltransferase (DMATase) (EC 2.5.1.75) (Isopentenyl-diphosphate: tRNA isopentenyltransferase) (IPP transferase) (IPPT) (tRNA isopentenyltransferase) (IPTase) | EBI-3765191 | 0.35 |
P32333 | TATA-binding protein-associated factor MOT1 (TBP-associated factor MOT1) (EC 3.6.4.-) (Modifier of transcription 1) | EBI-3765199 | 0.35 |
Q12404 | Protein disulfide-isomerase MPD1 (EC 5.3.4.1) | EBI-3765207 | 0.35 |
P32829 | Double-strand break repair protein MRE11 | EBI-3765223 | 0.35 |
Q06815 | Mannose 6-phosphate receptor-like protein 1 | EBI-3765231 | 0.35 |
P38175 | 37S ribosomal protein MRP21, mitochondrial (Mitochondrial small ribosomal subunit protein bS21m) | EBI-3765239 | 0.35 |
P36525 | 54S ribosomal protein L24, mitochondrial (Mitochondrial large ribosomal subunit protein bL28m) (YmL14/YmL24) | EBI-3765247 | 0.35 |
P36534 | 54S ribosomal protein L40, mitochondrial (Mitochondrial large ribosomal subunit protein uL24m) (YmL40) | EBI-3765255 | 0.35 |
P21771 | 37S ribosomal protein S28, mitochondrial (Mitochondrial small ribosomal subunit protein uS15m) | EBI-3765263 | 0.35 |
P48525 | Glutamate--tRNA ligase, mitochondrial (EC 6.1.1.17) (Glutamyl-tRNA synthetase) (GluRS) | EBI-3765271 | 0.35 |
P25846 | DNA mismatch repair protein MSH1, mitochondrial (MutS protein homolog 1) | EBI-3765279 | 0.53 |
Q03834 | DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3) | EBI-3765287 | 0.35 |
P22438 | Methionine--tRNA ligase, mitochondrial (EC 6.1.1.10) (Methionyl-tRNA synthetase) (MetRS) | EBI-3765303 | 0.35 |
P52918 | Protein MSN5 | EBI-3765312 | 0.35 |
P38714 | Arginine--tRNA ligase, mitochondrial (EC 6.1.1.19) (Arginyl-tRNA synthetase) (ArgRS) | EBI-3765320 | 0.35 |
P38994 | Phosphatidylinositol 4-phosphate 5-kinase MSS4 (EC 2.7.1.68) (1-phosphatidylinositol 4-phosphate kinase) (Diphosphoinositide kinase) (PIP5K) | EBI-3765328 | 0.35 |
Q03151 | Mitochondrial GTPase 1 | EBI-3765336 | 0.35 |
Q03920 | eRF1 methyltransferase catalytic subunit MTQ2 (eRF1 MTase catalytic subunit MTQ2) (EC 2.1.1.297) (N(5)-glutamine methyltransferase MTQ2) | EBI-3765344 | 0.35 |
P40959 | Sorting nexin MVP1 | EBI-3765352 | 0.35 |
P08964 | Myosin-1 (Type II myosin) | EBI-3765360 | 0.35 |
P36006 | Myosin-3 (Actin-dependent myosin-I MYO3) (Class I unconventional myosin MYO3) (Type I myosin MYO3) | EBI-3765368 | 0.35 |
P27929 | 37S ribosomal protein NAM9, mitochondrial (Mitochondrial small ribosomal subunit protein uS4m) (Nuclear accommodation of mitochondria protein 9) | EBI-3765376 | 0.35 |
P25293 | Nucleosome assembly protein | EBI-3765384 | 0.35 |
Q07500 | External NADH-ubiquinone oxidoreductase 2, mitochondrial (EC 1.6.5.9) (External NADH dehydrogenase 2) | EBI-3765392 | 0.35 |
P40527 | Probable phospholipid-transporting ATPase NEO1 (EC 7.6.2.1) | EBI-3765400 | 0.35 |
P32497 | Eukaryotic translation initiation factor 3 subunit C (eIF3c) (Eukaryotic translation initiation factor 3 93 kDa subunit) (eIF3 p93) (Nuclear transport protein NIP1) (Translation initiation factor eIF3, p93 subunit) | EBI-3765408 | 0.35 |
P33420 | Protein NIP100 (Protein NIP80) | EBI-3765416 | 0.35 |
P38798 | Nonsense-mediated mRNA decay protein 2 (Up-frameshift suppressor 2) | EBI-3765424 | 0.35 |
Q99207 | Nucleolar complex protein 14 (U three protein 2) (U3 small nucleolar RNA-associated protein 2) (U3 snoRNA-associated protein 2) | EBI-3765432 | 0.35 |
P39683 | Nicotinate phosphoribosyltransferase (NAPRTase) (EC 6.3.4.21) | EBI-3765440 | 0.35 |
P43124 | Non-structural maintenance of chromosome element 4 (Non-SMC element 4) (Protein QRI2) | EBI-3765448 | 0.35 |
Q00684 | Tyrosine-protein phosphatase CDC14 (EC 3.1.3.48) | EBI-3765472 | 0.35 |
P50946 | Putative tyrosine-protein phosphatase OCA1 (EC 3.1.3.48) (Oxidant-induced cell-cycle arrest protein 1) | EBI-3765480 | 0.35 |
P53397 | N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (AP lyase) (EC 4.2.99.18)] | EBI-3765488 | 0.35 |
P16547 | Mitochondrial outer membrane protein OM45 (Outer membrane protein of 45 kDa) | EBI-3765496 | 0.35 |
P21375 | Fumarate reductase 2 (FRDS2) (EC 1.3.1.6) (NADH-dependent fumarate reductase) (Osmotic sensitivity protein 1) (Soluble fumarate reductase, mitochondrial isozyme) | EBI-3765504 | 0.35 |
P40512 | Cop9 signalosome complex subunit 11 (Proteasome-COP9 signalosome-eIF3 domain protein 8) | EBI-3765512 | 0.35 |
P40186 | PHO85 cyclin-7 (PHO85-associated protein 1) | EBI-3765520 | 0.35 |
Q12477 | PHO85 cyclin-9 | EBI-3765528 | 0.35 |
P06169 | Pyruvate decarboxylase isozyme 1 (EC 4.1.1.-) (EC 4.1.1.43) (EC 4.1.1.72) (EC 4.1.1.74) (Thiamine pyrophosphate-dependent 2-oxo-acid decarboxylase) (2ODC) | EBI-3765536 | 0.35 |
P27801 | Vacuolar membrane protein PEP3 (Carboxypeptidase Y-deficient protein 3) (Vacuolar morphogenesis protein 8) (Vacuolar protein sorting-associated protein 18) (Vacuolar protein-targeting protein 18) | EBI-3765544 | 0.35 |
P12868 | E3 ubiquitin-protein ligase PEP5 (EC 2.3.2.27) (Carboxypeptidase Y-deficient protein 5) (Histone E3 ligase PEP5) (RING-type E3 ubiquitin transferase PEP5) (Vacuolar biogenesis protein END1) (Vacuolar morphogenesis protein 1) (Vacuolar protein sorting-associated protein 11) (Vacuolar protein-targeting protein 11) | EBI-3765552 | 0.35 |
P08468 | Protein PET111, mitochondrial | EBI-3765560 | 0.35 |
P32606 | Putative mitochondrial translation system component PET127 | EBI-3765568 | 0.35 |
P53112 | Peroxisomal membrane protein PEX14 (Peroxin-14) | EBI-3765576 | 0.35 |
P35056 | Peroxisomal targeting signal receptor (PTS1 receptor) (PTS1R) (Peroxin-5) (Peroxisomal protein PAS10) | EBI-3765584 | 0.35 |
P53248 | Peroxisomal biogenesis factor 8 (Peroxin-8) (Peroxisomal protein PAS6) | EBI-3765592 | 0.35 |
P40433 | 6-phosphofructo-2-kinase 1 (6PF-2-K 1) (EC 2.7.1.105) (Phosphofructokinase 2 I) | EBI-3765600 | 0.35 |
P36093 | Putative transcription factor PHD1 | EBI-3765608 | 0.35 |
Q12252 | Phosphate metabolism protein 7 | EBI-3765616 | 0.35 |
P19881 | 4-nitrophenylphosphatase (PNPPase) (EC 3.1.3.41) | EBI-3765624 | 0.35 |
P20052 | PHO85 cyclin PHO80 (Aminoglycoside antibiotic sensitivity protein 3) (Phosphate system cyclin PHO80) | EBI-3765632 | 0.35 |
P38264 | SRP-independent targeting protein 3 (Inorganic phosphate transport protein PHO88) (Phosphate metabolism protein PHO88) | EBI-3765640 | 0.35 |
P07271 | ATP-dependent DNA helicase PIF1 (EC 3.6.4.12) (DNA repair and recombination helicase PIF1) (Petite integration frequency protein 1) (Telomere stability protein 1) | EBI-3765648 | 0.35 |
P24583 | Protein kinase C-like 1 (PKC 1) (EC 2.7.11.13) | EBI-3765656 | 0.35 |
Q03306 | Serine/threonine-protein kinase PKH3 (EC 2.7.11.1) (Pkb-activating kinase homolog 3) | EBI-3765664 | 0.35 |
P32634 | Negative regulator of sporulation PMD1 | EBI-3765672 | 0.35 |
P33775 | Dolichyl-phosphate-mannose--protein mannosyltransferase 1 (EC 2.4.1.109) | EBI-3765680 | 0.35 |
P21951 | DNA polymerase epsilon catalytic subunit A (EC 2.7.7.7) (3'-5' exodeoxyribonuclease) (EC 3.1.11.-) (DNA polymerase II subunit A) | EBI-3765688 | 0.35 |
P39008 | Poly(A) ribonuclease POP2 (EC 3.1.13.4) (CCR4-associated factor 1) | EBI-3765696 | 0.35 |
P40478 | Mitochondrial outer membrane protein porin 2 (Voltage-dependent anion-selective channel protein 2) (VDAC-2) | EBI-3765709 | 0.35 |
P27796 | 3-ketoacyl-CoA thiolase, peroxisomal (EC 2.3.1.16) (Acetyl-CoA acyltransferase) (Beta-ketothiolase) (Peroxisomal 3-oxoacyl-CoA thiolase) | EBI-3765717 | 0.35 |
P07272 | Pyrimidine pathway regulatory protein 1 | EBI-3765726 | 0.35 |
P09232 | Cerevisin (EC 3.4.21.48) (Proteinase YSCB) (Vacuolar protease B) (PrB) | EBI-3765734 | 0.35 |
P21242 | Probable proteasome subunit alpha type-7 (Macropain subunit C1) (Multicatalytic endopeptidase complex subunit C1) (Proteasome component C1) (Proteinase YSCE subunit 1) | EBI-3765742 | 0.35 |
P23638 | Proteasome subunit alpha type-3 (Macropain subunit Y13) (Multicatalytic endopeptidase complex subunit Y13) (Proteasome component Y13) (Proteinase YSCE subunit 13) | EBI-3765750 | 0.35 |
P54885 | Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (GSA dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase) | EBI-3765758 | 0.35 |
P24384 | Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 (EC 3.6.4.13) | EBI-3765766 | 0.35 |
P33334 | Pre-mRNA-splicing factor 8 | EBI-3765774 | 0.35 |
P31374 | Serine/threonine-protein kinase PSK1 (EC 2.7.11.1) (PAS kinase 1) | EBI-3765790 | 0.35 |
Q08217 | Serine/threonine-protein kinase PSK2 (EC 2.7.11.1) (PAS kinase 2) | EBI-3765798 | 0.35 |
P36082 | Putative platinum sensitivity protein 1 | EBI-3765806 | 0.35 |
P40164 | Serine/threonine-protein phosphatase 4 regulatory subunit 3 (PP4R3) | EBI-3765814 | 0.35 |
Q04373 | Pumilio homology domain family member 6 | EBI-3765822 | 0.35 |
Q08647 | Multisubstrate pseudouridine synthase 7 (EC 5.4.99.-) (EC 5.4.99.27) (RNA pseudouridylate synthase 7) (RNA-uridine isomerase 7) (tRNA pseudouridine(13) synthase) | EBI-3765830 | 0.35 |
P52489 | Pyruvate kinase 2 (PK 2) (EC 2.7.1.40) | EBI-3765838 | 0.35 |
P40352 | DNA repair and recombination protein RAD26 (EC 3.6.4.12) (ATP-dependent helicase RAD26) | EBI-3765846 | 0.35 |
P14736 | DNA repair protein RAD4 | EBI-3765854 | 0.35 |
P32849 | DNA repair protein RAD5 (EC 3.6.4.-) (Radiation sensitivity protein 5) (Revertibility protein 2) | EBI-3765862 | 0.35 |
P12753 | DNA repair protein RAD50 (EC 3.6.-.-) (153 kDa protein) | EBI-3765870 | 0.53 |
P53063 | Decapping nuclease RAI1 (ScRai1) (EC 3.6.1.-) (NAD-capped RNA hydrolase RAI1) (DeNADding enzyme RAI1) (EC 3.6.1.-) (RAT1-interacting protein) | EBI-3765878 | 0.35 |
Q02792 | 5'-3' exoribonuclease 2 (EC 3.1.13.-) (Ribonucleic acid-trafficking protein 1) (p116) | EBI-3765886 | 0.35 |
P47104 | Regulator of V-ATPase in vacuolar membrane protein 1 (Suppression of the onset of impotence protein 3) | EBI-3765894 | 0.35 |
P25332 | Ribokinase (RK) (EC 2.7.1.15) | EBI-3765902 | 0.35 |
P39531 | Recyclin-1 | EBI-3765910 | 0.35 |
P12689 | DNA repair protein REV1 (EC 2.7.7.-) (Reversionless protein 1) | EBI-3765918 | 0.35 |
P14284 | DNA polymerase zeta catalytic subunit (EC 2.7.7.7) (Protein reversionless 3) | EBI-3765926 | 0.35 |
Q12090 | RNA exonuclease 3 (EC 3.1.-.-) | EBI-3765934 | 0.35 |
P38629 | Replication factor C subunit 3 (Replication factor C3) (Activator 1 40 kDa subunit) | EBI-3765942 | 0.35 |
Q06407 | Rho-type GTPase-activating protein 2 | EBI-3765950 | 0.35 |
P19263 | Mediator of RNA polymerase II transcription subunit 14 (Glucose repression regulatory protein 1) (Mediator complex subunit 14) | EBI-3765959 | 0.35 |
P40395 | Guanine nucleotide exchange factor subunit RIC1 (Protein RIC1) (Ribosome control protein 1) (Ric1p) | EBI-3765967 | 0.35 |
P29539 | Telomere length regulator protein RIF1 (RAP1-interacting factor 1) | EBI-3765975 | 0.35 |
P32445 | Single-stranded DNA-binding protein RIM1, mitochondrial (Mitochondrial ssDNA-binding protein) | EBI-3765983 | 0.35 |
P43565 | Serine/threonine-protein kinase RIM15 (EC 2.7.11.1) | EBI-3765991 | 0.35 |
Q08562 | ATP-dependent helicase ULS1 (EC 3.6.4.-) (Role in silencing protein 1) (Ubiquitin ligase for SUMO conjugates protein 1) | EBI-3765999 | 0.35 |
Q08961 | Ribosomal lysine N-methyltransferase 1 (EC 2.1.1.-) | EBI-3766007 | 0.35 |
Q03942 | Ribosomal lysine N-methyltransferase 2 (EC 2.1.1.-) | EBI-3766015 | 0.35 |
P53552 | THO complex subunit 2 (Low dye-binding protein 5) (THO complex subunit RLR1) (Zinc-regulated gene 13 protein) | EBI-3766023 | 0.35 |
P39975 | Sporulation protein RMD6 (Required for meiotic nuclear division protein 6) | EBI-3766031 | 0.35 |
P32611 | 54S ribosomal protein RML2, mitochondrial (L2) (Mitochondrial large ribosomal subunit protein uL2m) | EBI-3766039 | 0.35 |
Q04740 | Ribonuclease H (RNase H) (EC 3.1.26.4) | EBI-3766047 | 0.35 |
P21672 | Ribonucleoside-diphosphate reductase large chain 2 (EC 1.17.4.1) (Ribonucleotide reductase DNA damage-inducible regulatory subunit 2) (Ribonucleotide reductase R1 subunit 2) (Ribonucleotide reductase large subunit 2) | EBI-3766055 | 0.53 |
P49723 | Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2) | EBI-3766063 | 0.35 |
P51862 | RHO1 GDP-GTP exchange protein 2 | EBI-3766071 | 0.35 |
P08518 | DNA-directed RNA polymerase II subunit RPB2 (RNA polymerase II subunit 2) (EC 2.7.7.6) (B150) (DNA-directed RNA polymerase II 140 kDa polypeptide) | EBI-3766079 | 0.35 |
P32910 | DNA-directed RNA polymerase III subunit RPC6 (RNA polymerase III subunit C6) (C34) (DNA-directed RNA polymerase III 36 kDa polypeptide) | EBI-3766087 | 0.35 |
P36160 | Ribosome biogenesis protein RPF2 | EBI-3766095 | 0.35 |
P38249 | Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 110 kDa subunit homolog) (eIF3 p110) (Translation initiation factor eIF3, p110 subunit homolog) | EBI-3766103 | 0.35 |
P05748 | 60S ribosomal protein L15-A (L13) (Large ribosomal subunit protein eL15-A) (RP15R) (YL10) (YP18) | EBI-3766111 | 0.35 |
P54780 | 60S ribosomal protein L15-B (L13) (Large ribosomal subunit protein eL15-B) (RP15R) (YL10) (YP18) | EBI-3766119 | 0.35 |
P14126 | 60S ribosomal protein L3 (Large ribosomal subunit protein uL3) (Maintenance of killer protein 8) (RP1) (Trichodermin resistance protein) (YL1) | EBI-3766127 | 0.35 |
P49166 | 60S ribosomal protein L37-A (L43) (Large ribosomal subunit protein eL37-A) (YL35) (YP55) | EBI-3766135 | 0.35 |
P05739 | 60S ribosomal protein L6-B (L17) (Large ribosomal subunit protein eL6-B) (RP18) (YL16) | EBI-3766143 | 0.35 |
P05737 | 60S ribosomal protein L7-A (L6) (Large ribosomal subunit protein uL30-A) (RP11) (YL8) | EBI-3766151 | 0.35 |
Q12213 | 60S ribosomal protein L7-B (L6) (Large ribosomal subunit protein uL30-B) (RP11) (YL8) | EBI-3766159 | 0.35 |
P38764 | 26S proteasome regulatory subunit RPN1 (HMG-CoA reductase degradation protein 2) (Proteasome non-ATPase subunit 1) | EBI-3766167 | 0.35 |
P38886 | 26S proteasome regulatory subunit RPN10 | EBI-3766175 | 0.35 |
P53196 | 26S proteasome regulatory subunit RPN14 (Proteasome non-ATPase subunit 14) | EBI-3766183 | 0.35 |
P04050 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220) | EBI-3766191 | 0.35 |
P38786 | Ribonuclease P/MRP protein subunit RPP1 (EC 3.1.26.5) (RNA-processing protein RPP1) (RNaseP/MRP 32.2 kDa subunit) | EBI-3766199 | 0.35 |
P35271 | 40S ribosomal protein S18-A (Small ribosomal subunit protein uS13-A) | EBI-3766207 | 0.35 |
P33442 | 40S ribosomal protein S1-A (RP10A) (Small ribosomal subunit protein eS1-A) | EBI-3766215 | 0.35 |
P38701 | 40S ribosomal protein S20 (Small ribosomal subunit protein uS10) | EBI-3766223 | 0.35 |
P26786 | 40S ribosomal protein S7-A (RP30) (RP40) (Small ribosomal subunit protein eS7-A) | EBI-3766232 | 0.35 |
P53549 | 26S proteasome subunit RPT4 (26S protease subunit SUG2) (Proteasomal cap subunit) | EBI-3766240 | 0.35 |
P33297 | 26S proteasome regulatory subunit 6A (Tat-binding protein homolog 1) (TBP-1) | EBI-3766248 | 0.35 |
Q01939 | 26S proteasome regulatory subunit 8 homolog (Protein CIM3) (Protein SUG1) (Tat-binding protein TBY1) | EBI-3766256 | 0.35 |
Q12348 | COP9 signalosome complex subunit 10 | EBI-3766264 | 0.35 |
P25359 | Exosome complex component RRP43 (Ribosomal RNA-processing protein 43) | EBI-3766272 | 0.35 |
Q05022 | rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5) | EBI-3766280 | 0.35 |
Q02206 | Chromatin structure-remodeling complex subunit RSC4 (RSC complex subunit RSC4) (Remodel the structure of chromatin complex subunit 4) | EBI-3766288 | 0.35 |
P13856 | Ras-related protein RSR1 (EC 3.6.5.2) | EBI-3766296 | 0.35 |
P38903 | Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform (PP2A, B subunit, B' delta isoform) (Protein RTS1) (Protein SCS1) | EBI-3766304 | 0.35 |
P40962 | Zinc finger protein RTS2 | EBI-3766312 | 0.35 |
P53289 | Protein phosphatase type 2A regulatory subunit RTS3 | EBI-3766320 | 0.35 |
P10659 | S-adenosylmethionine synthase 1 (AdoMet synthase 1) (EC 2.5.1.6) (Methionine adenosyltransferase 1) (MAT 1) | EBI-3766336 | 0.35 |
P50110 | Sorting assembly machinery 37 kDa subunit (MAS37 protein) (Mitochondrial 37 kDa outer membrane protein) | EBI-3766344 | 0.35 |
P53036 | SIT4-associating protein SAP4 | EBI-3766352 | 0.35 |
P53324 | Steryl acetyl hydrolase 1 (EC 3.1.1.-) | EBI-3766360 | 0.35 |
Q04002 | Sister chromatid cohesion protein 2 | EBI-3766368 | 0.35 |
Q12334 | Protein SCM3 (Suppressor of chromosome missegregation protein 3) | EBI-3766376 | 0.35 |
P38072 | Protein SCO2, mitochondrial | EBI-3766384 | 0.35 |
P48415 | COPII coat assembly protein SEC16 (Protein transport protein SEC16) | EBI-3766392 | 0.35 |
P18759 | Vesicular-fusion protein SEC18 | EBI-3766400 | 0.35 |
P32844 | Exocyst complex component SEC6 | EBI-3766408 | 0.35 |
P32855 | Exocyst complex component SEC8 | EBI-3766416 | 0.35 |
Q04228 | UBX domain-containing protein 2 (Secretion lowering protein 1) | EBI-3766424 | 0.35 |
Q00416 | Helicase SEN1 (EC 3.6.4.-) (tRNA-splicing endonuclease positive effector) | EBI-3766432 | 0.35 |
P33330 | Phosphoserine aminotransferase (PSAT) (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) | EBI-3766440 | 0.35 |
P36124 | SET domain-containing protein 3 | EBI-3766448 | 0.35 |
Q12369 | Protein SFI1 (Suppressor of fermentation induced loss of stress resistance protein 1) | EBI-3766456 | 0.35 |
P34223 | UBX domain-containing protein 1 (Suppressor of high-copy PP1 protein) | EBI-3766472 | 0.35 |
Q07657 | Seventh homolog of septin 1 (Septation protein 7) | EBI-3766480 | 0.35 |
P53266 | Cytochrome oxidase assembly protein SHY1 (SURF1 homolog of Yeast) (SURF1-like protein) | EBI-3766488 | 0.35 |
Q12460 | Nucleolar protein 56 (Ribosome biosynthesis protein SIK1) (Suppressor of I kappa b protein 1) | EBI-3766496 | 0.35 |
P22579 | Transcriptional regulatory protein SIN3 | EBI-3766504 | 0.35 |
P53965 | Inositol phosphatase SIW14 (EC 3.6.1.52) (5-PP-InsP phosphatase) (Inositol pyrophosphate phosphatase SIW14) (Oxidant-induced cell-cycle arrest protein 3) (Synthetic interaction with WHI2 protein 14) | EBI-3766512 | 0.35 |
Q06315 | Protein SKG3 (Suppressor of lethality of KEX2-GAS1 double null mutant protein 3) | EBI-3766520 | 0.35 |
P35207 | Antiviral helicase SKI2 (EC 3.6.4.13) (Superkiller protein 2) | EBI-3766528 | 0.35 |
P42843 | F-box protein SKP2 | EBI-3766536 | 0.35 |
Q02775 | Pre-mRNA-splicing factor SLU7 (Synthetic lethal with U2 snRNA protein 17) (Synthetic lethal with U5 snRNA protein 7) | EBI-3766544 | 0.35 |
P32908 | Structural maintenance of chromosomes protein 1 (DA-box protein SMC1) | EBI-3766552 | 0.35 |
P12904 | 5'-AMP-activated protein kinase subunit gamma (AMPK gamma) (AMPK subunit gamma) (Regulatory protein CAT3) (Sucrose non-fermenting protein 4) | EBI-3766568 | 0.35 |
P32568 | Protein SNQ2 | EBI-3766576 | 0.35 |
P25357 | Probable DNA-binding protein SNT1 (SANT domain-containing protein 1) | EBI-3766584 | 0.35 |
P53127 | E3 ubiquitin-protein ligase SNT2 (EC 2.3.2.27) (Histone E3 ligase SNT2) (RING-type E3 ubiquitin transferase SNT2) (SANT domain-containing protein 2) | EBI-3766592 | 0.35 |
Q04748 | Protein SOV1, mitochondrial | EBI-3766600 | 0.35 |
P23201 | Protein SPA2 | EBI-3766608 | 0.35 |
P25808 | ATP-dependent rRNA helicase SPB4 (EC 3.6.4.13) (Suppressor of PAB1 protein 4) | EBI-3766616 | 0.35 |
P32380 | Spindle pole body component 110 (Extragenic suppressor of CMD1-1 mutant protein 1) (Nuclear filament-related protein 1) (Spindle pole body spacer protein SPC110) | EBI-3766624 | 0.35 |
P36126 | Phospholipase D1 (PLD 1) (EC 3.1.4.4) (Choline phosphatase 1) (Meiosis-specific sporulation-specific protein 14) (Phosphatidylcholine-hydrolyzing phospholipase D1) | EBI-3766632 | 0.35 |
Q03868 | Prospore membrane adapter protein SPO71 (Sporulation-specific protein 71) | EBI-3766640 | 0.35 |
Q03012 | COMPASS component SPP1 (Complex proteins associated with SET1 protein SPP1) (Set1C component SPP1) (Suppressor of PRP protein 1) | EBI-3766648 | 0.35 |
P08458 | Sporulation-specific protein 1 (EC 2.7.11.1) | EBI-3766656 | 0.53 |
P32558 | FACT complex subunit SPT16 (Cell division control protein 68) (Facilitates chromatin transcription complex subunit SPT16) (Suppressor of Ty protein 16) | EBI-3766664 | 0.35 |
Q12020 | Protein SRL2 (Suppressor of RAD53 null lethality protein 2) | EBI-3766680 | 0.35 |
P38688 | Signal recognition particle subunit SRP72 (Signal recognition particle 72 kDa protein homolog) | EBI-3766688 | 0.35 |
P53599 | MAP kinase kinase kinase SSK2 (EC 2.7.11.25) (Suppressor of sensor kinase 2) | EBI-3766696 | 0.53 |
P47821 | RNA polymerase II holoenzyme cyclin-like subunit (Suppressor of RNA polymerase B 11) | EBI-3766704 | 0.35 |
P11972 | Protein SST2 | EBI-3766712 | 0.35 |
P46679 | Protein STB2 | EBI-3766720 | 0.35 |
P18851 | Guanine nucleotide-binding protein subunit beta | EBI-3766728 | 0.53 |
P32597 | Nuclear protein STH1/NPS1 (EC 3.6.4.12) (ATP-dependent helicase STH1) (Chromatin structure-remodeling complex protein STH1) (SNF2 homolog) | EBI-3766736 | 0.35 |
P53101 | Cystathionine beta-lyase (CBL) (EC 4.4.1.13) (Beta-cystathionase) (Cysteine lyase) (Cysteine-S-conjugate beta-lyase) (Sulfur transfer protein 3) | EBI-3766744 | 0.35 |
P37297 | Phosphatidylinositol 4-kinase STT4 (PI4-kinase) (PtdIns-4-kinase) (EC 2.7.1.67) | EBI-3766752 | 0.35 |
P38198 | Protein STU1 (Suppressor of tubulin 1) | EBI-3766760 | 0.35 |
P09064 | Eukaryotic translation initiation factor 2 subunit beta (eIF-2-beta) | EBI-3766768 | 0.35 |
P46676 | Suppressor of mar1-1 protein (SUM1-1 protein) | EBI-3766776 | 0.35 |
P12385 | Eukaryotic peptide chain release factor subunit 1 (Eukaryotic release factor 1) (eRF1) (Omnipotent suppressor protein 1) | EBI-3766784 | 0.35 |
P31376 | SWR1-complex protein 3 | EBI-3766792 | 0.35 |
P08153 | Transcriptional factor SWI5 | EBI-3766800 | 0.35 |
P40528 | Protein SYG1 | EBI-3766808 | 0.35 |
P40468 | Cell morphogenesis protein PAG1 (Protein TAO3) | EBI-3766816 | 0.35 |
Q06510 | Tafazzin (Taz) (EC 2.3.1.-) | EBI-3766824 | 0.35 |
Q12466 | Tricalbin-1 | EBI-3766832 | 0.35 |
Q03640 | Tricalbin-3 | EBI-3766840 | 0.35 |
P38228 | Mitochondrial chaperone TCM62 | EBI-3766848 | 0.35 |
P00359 | Glyceraldehyde-3-phosphate dehydrogenase 3 (GAPDH 3) (EC 1.2.1.12) | EBI-3766856 | 0.35 |
P02994 | Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A) | EBI-3766864 | 0.35 |
P41903 | Peroxisomal acyl-coenzyme A thioester hydrolase 1 (EC 3.1.2.2) (Peroxisomal long-chain acyl-CoA thioesterase 1) | EBI-3766872 | 0.35 |
P36145 | Transcription initiation factor IIE subunit beta (TFIIE-beta) (Factor A 43 kDa subunit) (Transcription factor A small subunit) | EBI-3766880 | 0.35 |
Q02939 | General transcription and DNA repair factor IIH subunit TFB2 (TFIIH subunit TFB2) (RNA polymerase II transcription factor B 52 kDa subunit) (RNA polymerase II transcription factor B p52 subunit) (RNA polymerase II transcription factor B subunit 2) | EBI-3766888 | 0.35 |
P32367 | Transcription factor tau 95 kDa subunit (TFIIIC 95 kDa subunit) (Transcription factor C subunit 1) | EBI-3766896 | 0.35 |
P14306 | Carboxypeptidase Y inhibitor (CPY inhibitor) (CDC25 suppressor 1) (I(C)) (Ic) (Protein DKA1) (Protein NSP1) | EBI-3766904 | 0.35 |
P10081 | ATP-dependent RNA helicase eIF4A (EC 3.6.4.13) (Eukaryotic initiation factor 4A) (eIF-4A) (Stimulator factor I 37 kDa component) (Translation initiation factor 1/2) (p37) | EBI-3766912 | 0.35 |
P34167 | Eukaryotic translation initiation factor 4B (eIF-4B) | EBI-3766920 | 0.35 |
P40217 | Eukaryotic translation initiation factor 3 subunit I (eIF3i) (Eukaryotic translation initiation factor 3 39 kDa subunit) (eIF-3 39 kDa subunit) (eIF3 p39) | EBI-3766928 | 0.35 |
Q04067 | Eukaryotic translation initiation factor 3 subunit G (eIF3g) (Eukaryotic translation initiation factor 3 RNA-binding subunit) (eIF-3 RNA-binding subunit) (Translation initiation factor eIF3 p33 subunit) (eIF3 p33) | EBI-3766936 | 0.35 |
P38431 | Eukaryotic translation initiation factor 5 (eIF-5) | EBI-3766944 | 0.35 |
Q01852 | Mitochondrial import inner membrane translocase subunit TIM44 (Inner membrane import site protein 45) (ISP45) (Membrane import machinery protein MIM44) (Mitochondrial protein import protein 1) | EBI-3766952 | 0.35 |
Q02208 | Topoisomerase 1-associated factor 2 | EBI-3766960 | 0.35 |
P35169 | Serine/threonine-protein kinase TOR1 (EC 2.7.11.1) (Dominant rapamycin resistance protein 1) (Phosphatidylinositol kinase homolog TOR1) (Target of rapamycin kinase 1) | EBI-3766976 | 0.35 |
P40032 | Prolyl 3,4-dihydroxylase TPA1 (EC 1.14.11.-) (Termination and polyadenylation protein 1) (uS12 prolyl 3,4-dihydroxylase) | EBI-3766984 | 0.35 |
P40414 | Tropomyosin-2 | EBI-3766992 | 0.35 |
P48561 | Poly(A) RNA polymerase protein 1 (EC 2.7.7.19) (Topoisomerase 1-related protein TRF5) | EBI-3767000 | 0.35 |
P12685 | High-affinity potassium transport protein | EBI-3767008 | 0.35 |
Q04183 | Trafficking protein particle complex II-specific subunit 120 (TRAPP II-specific subunit 120) (Transport protein particle 120 kDa subunit) | EBI-3767016 | 0.35 |
P40061 | Target of rapamycin complex 2 subunit TSC11 (TORC2 subunit TSC11) (Adheres voraciously to TOR2 protein 3) (Temperature-sensitive CSG2 suppressor protein 11) | EBI-3767024 | 0.35 |
P09733 | Tubulin alpha-1 chain (EC 3.6.5.-) | EBI-3767032 | 0.35 |
P09734 | Tubulin alpha-3 chain (EC 3.6.5.-) | EBI-3767040 | 0.35 |
P52488 | Ubiquitin-activating enzyme E1-like (Polymerase-interacting protein 2) (SMT3-activating enzyme subunit 2) | EBI-3767048 | 0.35 |
P25037 | Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.4.19.12) (Deubiquitinating enzyme 1) (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) | EBI-3767056 | 0.35 |
Q06682 | UBX domain-containing protein 5 | EBI-3767064 | 0.35 |
P07259 | Protein URA2 [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] | EBI-3767072 | 0.35 |
P03962 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) (Uridine 5'-monophosphate synthase) (UMP synthase) | EBI-3767080 | 0.35 |
P25386 | Intracellular protein transport protein USO1 (Int-1) | EBI-3767088 | 0.35 |
P35194 | U3 small nucleolar RNA-associated protein 20 (U3 snoRNA-associated protein 20) (U three protein 20) | EBI-3767096 | 0.35 |
P53254 | U3 small nucleolar RNA-associated protein 22 (U3 snoRNA-associated protein 22) (U three protein 22) | EBI-3767104 | 0.35 |
Q06679 | U3 small nucleolar RNA-associated protein 4 (U3 snoRNA-associated protein 4) (U three protein 4) (U3 protein 4 required for transcription) (t-UTP4) | EBI-3767112 | 0.35 |
Q07468 | Vacuolar morphogenesis protein 6 (Vacuolar protein sorting-associated protein 39) | EBI-3767120 | 0.35 |
P40522 | Transcription factor VHR1 (VHT1 regulator 1) | EBI-3767128 | 0.35 |
Q06337 | Chromatin modification-related protein EAF1 (ESA1-associated factor 1) (Vacuolar import and degradation protein 21) | EBI-3767136 | 0.35 |
P40157 | Vacuolar import and degradation protein 27 | EBI-3767144 | 0.35 |
P40547 | Vacuolar import and degradation protein 28 (Glucose-induced degradation protein 5) | EBI-3767152 | 0.35 |
P16140 | V-type proton ATPase subunit B (V-ATPase subunit B) (V-ATPase 57 kDa subunit) (Vacuolar proton pump subunit B) | EBI-3767160 | 0.35 |
P23643 | Vacuolar protein sorting-associated protein 3 (Vacuolar protein-targeting protein 17) | EBI-3767168 | 0.35 |
Q03433 | Vacuolar protein sorting-associated protein 71 (SWR complex protein 6) | EBI-3767176 | 0.35 |
P40438 | VPS10 homolog 1 (Sortilin VTH1) | EBI-3767184 | 0.35 |
P40890 | VPS10 homolog 2 (Sortilin VTH2) | EBI-3767192 | 0.35 |
P33767 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 (Oligosaccharyl transferase subunit WBP1) (Oligosaccharyl transferase subunit beta) | EBI-3767200 | 0.35 |
Q12416 | G1-specific transcriptional repressor WHI5 | EBI-3767208 | 0.35 |
P38749 | AP-1-like transcription factor YAP3 | EBI-3767216 | 0.35 |
O13527 | Truncated transposon Ty1-A Gag-Pol polyprotein (TY1B) (Transposon Ty1 TYB polyprotein) [Cleaved into: Integrase (IN) (Pol-p71) (p84) (p90); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (Pol-p63) (p60)] | EBI-3767224 | 0.35 |
P40017 | Carnitine O-acetyltransferase YAT2 (EC 2.3.1.7) | EBI-3767232 | 0.35 |
P34220 | Deoxyribonuclease Tat-D (EC 3.1.21.-) | EBI-3767240 | 0.35 |
P34225 | Guanine-nucleotide exchange factor YEL1 (EFA6-like protein 1) | EBI-3767248 | 0.35 |
Q12491 | Transposon Ty2-B Gag-Pol polyprotein (TY2A-TY2B) (Transposon Ty2 TYA-TYB polyprotein) [Cleaved into: Capsid protein (CA); Ty2 protease (PR) (EC 3.4.23.-); Integrase (IN); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4)] | EBI-3767256 | 0.35 |
Q12193 | Transposon Ty1-BR Gag-Pol polyprotein (Gag-Pol-p199) (TY1A-TY1B) (Transposon Ty1 TYA-TYB polyprotein) (p190) [Cleaved into: Capsid protein (CA) (Gag-p45) (p54); Ty1 protease (PR) (EC 3.4.23.-) (Pol-p20) (p23); Integrase (IN) (Pol-p71) (p84) (p90); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (Pol-p63) (p60)] | EBI-3767271 | 0.35 |
P38219 | Obg-like ATPase 1 | EBI-3767279 | 0.35 |
P38266 | Altered inheritance of mitochondria protein 3 | EBI-3767287 | 0.35 |
P38331 | 5'-deoxynucleotidase YBR242W (EC 3.1.3.89) | EBI-3767295 | 0.35 |
P38332 | Diphthine methyltransferase (EC 3.1.1.97) (Diphthamide biosynthesis protein 7) (Endosomal recycling protein 1) (Regulator of rDNA transcription protein 2) | EBI-3767303 | 0.35 |
P39109 | Metal resistance protein YCF1 (ABC-type Cd(2+) transporter) (EC 7.2.2.2) (ABC-type glutathione-S-conjugate transporter) (EC 7.6.2.3) (Yeast cadmium factor 1) | EBI-3767311 | 0.35 |
P25616 | Cold tolerance protein 1 | EBI-3767319 | 0.35 |
Q06156 | Condensin complex subunit 1 (XCAP-D2 homolog) | EBI-3767327 | 0.35 |
Q07349 | MIOREX complex component 9 (Mitochondrial organization of gene expression protein 9) | EBI-3767335 | 0.35 |
Q12516 | Regulator of phospholipase D SRF1 (SPO14 regulatory factor 1) | EBI-3767343 | 0.35 |
Q06640 | F-box protein YDR306C | EBI-3767351 | 0.35 |
Q04411 | Uracil catabolism protein 2 | EBI-3767359 | 0.35 |
P89887 | Putative uncharacterized protein YEL076C-A | EBI-3767367 | 0.35 |
Q3E7X8 | Y' element ATP-dependent helicase YEL077C (EC 3.6.4.12) | EBI-3767379 | 0.35 |
P40028 | Holliday junction resolvase YEN1 (EC 3.1.-.-) | EBI-3767387 | 0.35 |
P40085 | Endoplasmic reticulum membrane protein 65 (65 kDa endoplasmic reticulum membrane protein) | EBI-3767395 | 0.35 |
P43560 | Membrane-anchored lipid-binding protein LAM5 (Lipid transfer at contact site protein 2) (Lipid transfer protein anchored at membrane contact sites 1) | EBI-3767403 | 0.35 |
P43597 | Uncharacterized protein YFR016C | EBI-3767411 | 0.35 |
P53144 | 5'-deoxynucleotidase YGK1 (EC 3.1.3.89) | EBI-3767419 | 0.35 |
P53100 | Putative 2-hydroxyacid dehydrogenase YGL185C (EC 1.-.-.-) | EBI-3767427 | 0.35 |
P53077 | Maintenance of telomere capping protein 3, mitochondrial | EBI-3767435 | 0.35 |
P53234 | Uncharacterized protein YGR053C | EBI-3767443 | 0.35 |
P53246 | Late endosome and vacuole interface protein 11 | EBI-3767451 | 0.35 |
Q99315 | Transposon Ty3-G Gag-Pol polyprotein (Gag3-Pol3) (Transposon Ty3-1 TYA-TYB polyprotein) [Cleaved into: Capsid protein (CA) (p24); Spacer peptide p3; Nucleocapsid protein p11 (NC); Ty3 protease (PR) (EC 3.4.23.-) (p16); Spacer peptide J; Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (p55); Integrase p61 (IN); Integrase p58 (IN)] | EBI-3767459 | 0.35 |
P50089 | Uncharacterized protein YGR237C | EBI-3767474 | 0.35 |
P53321 | Putative uncharacterized protein YGR259C | EBI-3767482 | 0.35 |
Q05900 | U1 small nuclear ribonucleoprotein C (U1 snRNP C) (U1-C) (U1C) | EBI-3767490 | 0.35 |
P0C2J7 | Transposon Ty4-H Gag-Pol polyprotein (TY4A-TY4B) (Transposon Ty4 TYA-TYB polyprotein) [Includes: Capsid protein (CA); Ty4 protease (PR) (EC 3.4.23.-); Integrase (IN); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4)] | EBI-3767498 | 0.35 |
P38842 | UPF0641 membrane protein YHR140W | EBI-3767506 | 0.35 |
P47024 | Transposon Ty4-J Gag-Pol polyprotein (TY4A-TY4B) (Transposon Ty4 TYA-TYB polyprotein) [Includes: Capsid protein (CA); Ty4 protease (PR) (EC 3.4.23.-); Integrase (IN); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4)] | EBI-3767514 | 0.35 |
P47101 | UPF0508 protein YJR030C | EBI-3767522 | 0.35 |
P28320 | Splicing factor YJU2 | EBI-3767530 | 0.35 |
P34246 | Maintenance of telomere capping protein 2 | EBI-3767538 | 0.35 |
P34248 | Probable intramembrane protease YKL100C (EC 3.4.23.-) | EBI-3767546 | 0.35 |
P28273 | 5-oxoprolinase (EC 3.5.2.9) (5-oxo-L-prolinase) (5-OPase) (Pyroglutamase) | EBI-3767554 | 0.35 |
P36158 | Uncharacterized protein YKR078W | EBI-3767562 | 0.35 |
Q07799 | ELMO family protein LMO1 | EBI-3767570 | 0.35 |
Q12244 | Uncharacterized transcriptional regulatory protein YLL054C | EBI-3767578 | 0.35 |
Q12177 | Uncharacterized protein YLL056C | EBI-3767586 | 0.35 |
Q07897 | Protein CMS1 (Complementation of MCM10 suppressor protein 1) | EBI-3767594 | 0.35 |
Q12110 | Uncharacterized protein YLR049C | EBI-3767602 | 0.35 |
Q12288 | Putative glutamine amidotransferase YLR126C (EC 2.4.2.-) | EBI-3767610 | 0.35 |
Q06247 | Putative uncharacterized protein YLR173W | EBI-3767622 | 0.35 |
Q06152 | Uncharacterized protein YLR271W | EBI-3767630 | 0.35 |
Q05867 | Uncharacterized protein YLR283W, mitochondrial | EBI-3767638 | 0.35 |
Q06159 | Autophagy-related protein 39 | EBI-3767646 | 0.35 |
Q06479 | F-box protein YLR352W | EBI-3767654 | 0.35 |
Q06409 | DOCK-like protein 1 | EBI-3767662 | 0.35 |
O13577 | Damage-regulated import facilitator 1 | EBI-3767670 | 0.35 |
Q04533 | Putative cystathionine gamma-synthase YML082W (EC 2.5.1.48) (O-succinylhomoserine (thiol)-lyase) | EBI-3767678 | 0.35 |
Q04371 | Damage-control phosphatase YMR027W (EC 3.1.3.-) (Sugar phosphate phosphatase YMR027W) | EBI-3767686 | 0.35 |
P0CF18 | Uncharacterized protein YMR085W | EBI-3767694 | 0.35 |
Q03153 | ATPase synthesis protein 25, mitochondrial (OLI1 mRNA stabilization factor) | EBI-3767709 | 0.35 |
Q04471 | Abasic site processing protein YMR114C (EC 3.4.-.-) | EBI-3767717 | 0.35 |
Q03496 | tRNA (cytidine(32)-2'-O)-methyltransferase non-catalytic subunit TRM732 | EBI-3767725 | 0.35 |
P40168 | Uncharacterized protein YNL195C | EBI-3767733 | 0.35 |
P53850 | Restriction of telomere capping protein 4 | EBI-3767753 | 0.35 |
P53837 | Putative uncharacterized protein YNL276C | EBI-3767765 | 0.35 |
P53756 | ABC transporter ATP-binding protein/permease PDR18 (Pleiotropic drug resistance protein 18) | EBI-3767773 | 0.35 |
P53757 | Uncharacterized isomerase YNR071C (EC 5.-.-.-) | EBI-3767781 | 0.35 |
Q99247 | DUB-associated factor 1 | EBI-3767789 | 0.53 |
Q12496 | Uncharacterized protein YOL098C | EBI-3767797 | 0.35 |
Q08270 | Uncharacterized protein YOL131W | EBI-3767805 | 0.35 |
Q08457 | Mitochondrial morphogenesis protein SLD7 (Synthetic lethality with DPB11-24 mutation protein 7) | EBI-3767813 | 0.35 |
Q12275 | Uncharacterized protein YOR093C | EBI-3767821 | 0.35 |
P53049 | Oligomycin resistance ATP-dependent permease YOR1 (ABC transporter YOR1) (ABC-type Cd(2+) transporter) (EC 7.2.2.2) (ABC-type glutathione-S-conjugate transporter) (EC 7.6.2.3) (Yeast oligomycin resistance protein 1) | EBI-3767829 | 0.35 |
Q12032 | Altered inheritance of mitochondria protein 41, mitochondrial | EBI-3767837 | 0.35 |
Q08748 | Uncharacterized protein YOR296W | EBI-3767845 | 0.35 |
Q02754 | Uncharacterized protein YPL067C | EBI-3767853 | 0.35 |
Q02895 | Putative aryl-alcohol dehydrogenase AAD16 (EC 1.1.1.-) | EBI-3767861 | 0.35 |
Q08964 | Putative ISWI chromatin-remodeling complex subunit YPL216W | EBI-3767869 | 0.35 |
Q06813 | Uncharacterized protein YPR078C | EBI-3767877 | 0.35 |
Q06108 | Regulator of the glycerol channel 1 | EBI-3767885 | 0.35 |
P01123 | GTP-binding protein YPT1 (Protein YP2) (Rab GTPase YPT1) (Transport GTPase YPT1) | EBI-3767893 | 0.35 |
P51996 | GTP-binding protein YPT32/YPT11 (Rab GTPase YPT32) | EBI-3767901 | 0.35 |
P36019 | GTP-binding protein YPT53 | EBI-3767909 | 0.35 |
Q12159 | RNA annealing protein YRA1 | EBI-3767917 | 0.35 |
P53819 | Y' element ATP-dependent helicase protein 1 copy 6 (EC 3.6.4.12) | EBI-3767925 | 0.35 |
P40341 | Mitochondrial respiratory chain complexes assembly protein YTA12 (EC 3.4.24.-) (Tat-binding homolog 12) | EBI-3767933 | 0.35 |
P40328 | Probable 26S proteasome subunit YTA6 (Tat-binding homolog 6) | EBI-3767941 | 0.35 |
P40340 | ATPase histone chaperone YTA7 (EC 3.6.1.-) (ATPase family AAA domain-containing protein YTA7) (AAA-ATPase) (Tat-binding homolog 7) | EBI-3767949 | 0.35 |
P31111 | Synaptonemal complex protein ZIP1 | EBI-3767957 | 0.35 |
P22202 | Heat shock protein SSA4 | EBI-3767965 | 0.35 |
A0A023PZA9 | Putative uncharacterized protein YDR230W | EBI-3862867 | 0.35 |
P22146 | 1,3-beta-glucanosyltransferase GAS1 (EC 2.4.1.-) (Glycolipid-anchored surface protein 1) (Glycoprotein GP115) | EBI-6900105 | 0.27 |
P04150 | Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) | EBI-9819201 | 0.50 |
P25367 | [PIN+] prion protein RNQ1 (Rich in asparagine and glutamine protein 1) | EBI-15790589 | 0.44 |
Q08601 | Metacaspase-1 (EC 3.4.22.-) [Cleaved into: Large subunit p20; Small subunit p10] | EBI-15865212 | 0.35 |
Q12004 | General transcription and DNA repair factor IIH subunit TFB4 (TFIIH subunit TFB4) (RNA polymerase II transcription factor B 34 kDa subunit) (RNA polymerase II transcription factor B p34 subunit) (RNA polymerase II transcription factor B subunit 4) | EBI-15942387 | 0.35 |
Q00776 | AP-1 complex subunit mu-1-I (Clathrin assembly protein complex 1 mu-1-I medium chain) (Clathrin coat assembly protein AP54) (Clathrin coat-associated protein AP54) (Golgi adaptor AP-1 54 kDa protein) (HA1 54 kDa subunit) (Mu(1)-adaptin) (Mu1-I-adaptin) | EBI-16263794 | 0.35 |
P38153 | AP-3 complex subunit mu (AP-3 adaptor complex mu3A subunit) (Adaptor-related protein complex 3 subunit mu) (Mu-adaptin 3A) (Mu3-adaptin) | EBI-16263895 | 0.35 |
P32381 | Actin-related protein 2 (Actin-like protein ARP2) (Actin-like protein 2) | EBI-16264169 | 0.35 |
P26448 | Mitotic check point protein BUB2 (Cell cycle arrest protein BUB2) | EBI-16264549 | 0.35 |
P53323 | EKC/KEOPS complex subunit BUD32 (EC 3.6.-.-) (Atypical serine/threonine protein kinase BUD32) (EC 2.7.11.1) (Bud site selection protein 32) (Low-dye-binding protein 14) (piD261) | EBI-16264767 | 0.35 |
P00546 | Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (Cell division control protein 28) (Cell division protein kinase 1) | EBI-16265841 | 0.35 |
P25656 | Cell division control protein 50 | EBI-16266167 | 0.35 |
Q00362 | Protein phosphatase PP2A regulatory subunit B (Cell division control protein 55) (PR55) | EBI-16266261 | 0.35 |
P06243 | Cell division control protein 7 (EC 2.7.11.1) | EBI-16266350 | 0.35 |
P04819 | DNA ligase 1 (EC 6.5.1.1) (DNA ligase I) (Polydeoxyribonucleotide synthase [ATP] 1) | EBI-16266449 | 0.35 |
P38147 | Serine/threonine-protein kinase CHK1 (EC 2.7.11.1) (Checkpoint kinase 1) | EBI-16266584 | 0.35 |
Q01649 | Spindle pole body-associated protein CIK1 (Chromosome instability and karyogamy protein 1) | EBI-16266663 | 0.35 |
P24869 | G2/mitotic-specific cyclin-2 | EBI-16266949 | 0.35 |
P41735 | 5-demethoxyubiquinone hydroxylase, mitochondrial (DMQ hydroxylase) (EC 1.14.99.60) (Catabolite repression protein 5) (Ubiquinone biosynthesis monooxygenase COQ7) | EBI-16267444 | 0.35 |
P47027 | DNA replication regulator DPB11 | EBI-16268315 | 0.35 |
P17214 | Telomere elongation protein EST1 (Ever shorter telomeres protein 1) | EBI-16268957 | 0.35 |
P32502 | Translation initiation factor eIF-2B subunit beta (GCD complex subunit GCD7) (Guanine nucleotide exchange factor subunit GCD7) (eIF-2B GDP-GTP exchange factor subunit beta) | EBI-16269661 | 0.35 |
P32598 | Serine/threonine-protein phosphatase PP1-2 (EC 3.1.3.16) | EBI-16270070 | 0.35 |
P06774 | Transcriptional activator HAP2 | EBI-16270452 | 0.35 |
P13434 | Transcriptional activator HAP3 (UAS2 regulatory protein A) | EBI-16270569 | 0.35 |
Q99181 | Protein HSH49 | EBI-16271249 | 0.35 |
P32464 | Protein HYM1 | EBI-16271424 | 0.35 |
P32581 | Meiosis induction protein kinase IME2/SME1 (EC 2.7.11.1) | EBI-16271455 | 0.35 |
P13902 | Protein INO4 | EBI-16271541 | 0.35 |
P14681 | Mitogen-activated protein kinase KSS1 (MAP kinase KSS1) (EC 2.7.11.24) (Kinase suppressor of SST2) | EBI-16272210 | 0.35 |
Q12446 | Proline-rich protein LAS17 | EBI-16272438 | 0.35 |
Q02574 | DNA damage checkpoint control protein MEC3 | EBI-16273337 | 0.35 |
P39014 | F-box protein MET30 (E3 ubiquitin ligase complex SCF(Met30) subunit MET30) (Methionine-requiring protein 30) | EBI-16273553 | 0.35 |
P26188 | Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63) (6-O-methylguanine-DNA methyltransferase) (MGMT) (DNA repair MTase) (O-6-methylguanine-DNA-alkyltransferase) | EBI-16273684 | 0.35 |
P32491 | MAP kinase kinase MKK2/SSP33 (EC 2.7.12.2) | EBI-16273903 | 0.35 |
Q04149 | Crossover junction endonuclease MUS81 (EC 3.1.22.-) (MMS and UV-sensitive protein 81) | EBI-16274423 | 0.35 |
Q02931 | NET1-associated nuclear protein 1 (U three protein 17) (t-17) (U3 protein 17 required for transcription) (U3 small nucleolar RNA-associated protein 17) (U3 snoRNA-associated protein 17) | EBI-16274579 | 0.35 |
P40354 | Protein N-terminal amidase (NT-amidase) (EC 3.5.1.-) | EBI-16274812 | 0.35 |
P39108 | Peroxisomal targeting signal 2 receptor (PTS2 receptor) (Peroxin-7) (Peroxisome import protein PAS7) | EBI-16275488 | 0.35 |
P16862 | ATP-dependent 6-phosphofructokinase subunit beta (EC 2.7.1.11) (ATP-dependent 6-phosphofructokinase) (ATP-PFK) (Phosphofructokinase 2) (Phosphohexokinase) | EBI-16275628 | 0.35 |
P25615 | DNA polymerase IV (POL IV) (EC 2.7.7.7) | EBI-16276002 | 0.35 |
P23594 | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit (EC 3.1.3.16) | EBI-16276062 | 0.35 |
P30620 | DNA cross-link repair protein PSO2/SNM1 (EC 3.1.-.-) | EBI-16276917 | 0.35 |
P34221 | Protein phosphatase 2C homolog 3 (PP2C-3) (EC 3.1.3.16) | EBI-16277075 | 0.35 |
P25635 | Periodic tryptophan protein 2 (U three protein 1) (U3 small nucleolar RNA-associated protein 1) (U3 snoRNA-associated protein 1) | EBI-16277306 | 0.35 |
Q04049 | DNA polymerase eta (EC 2.7.7.7) (Radiation-sensitive protein 30) | EBI-16278245 | 0.35 |
Q12223 | DNA repair protein RAD59 | EBI-16278713 | 0.35 |
P40348 | Replication factor C subunit 2 (Replication factor C2) (Activator 1 41 kDa subunit) | EBI-16279429 | 0.35 |
Q12300 | High glucose sensor RGT2 (Low-affinity glucose receptor RGT2) (Low-affinity transporter-like sensor RGT2) (Restores glucose transport protein 2) | EBI-16279741 | 0.35 |
Q12749 | Structural maintenance of chromosomes protein 6 (DNA repair protein RHC18) (Rad18 homolog) | EBI-16279839 | 0.35 |
P05317 | 60S acidic ribosomal protein P0 (A0) (L10e) (Large ribosomal subunit protein uL10) | EBI-16280656 | 0.35 |
P33298 | 26S proteasome regulatory subunit 6B homolog (Protein YNT1) (Tat-binding homolog 2) | EBI-16280713 | 0.35 |
P41811 | Coatomer subunit beta' (Beta'-coat protein) (Beta'-COP) | EBI-16281700 | 0.35 |
P38262 | SIR4-interacting protein SIF2 | EBI-16282437 | 0.35 |
P32259 | Mediator of RNA polymerase II transcription subunit 16 (Global transcriptional regulator SIN4) (Mediator complex subunit 16) (SNF1 suppressor protein 4) (SWI4 suppressor protein 5) (Transcriptional silencing factor 3) (YGP1 expression regulatory protein 1) | EBI-16282486 | 0.35 |
P34164 | SNF1 protein kinase subunit beta-2 (Protein SPM2) (SNF1-interacting protein 2) | EBI-16282515 | 0.35 |
P06701 | Regulatory protein SIR3 (Silent information regulator 3) | EBI-16282584 | 0.35 |
P20604 | Serine/threonine-protein phosphatase PP1-1 (EC 3.1.3.16) | EBI-16282774 | 0.35 |
Q00772 | Mitogen-activated protein kinase SLT2/MPK1 (MAP kinase MPK1) (EC 2.7.11.24) | EBI-16283115 | 0.35 |
P41808 | Sporulation-specific mitogen-activated protein kinase SMK1 (MAP kinase SMK1) (EC 2.7.11.24) | EBI-16283296 | 0.35 |
Q00916 | U1 small nuclear ribonucleoprotein 70 kDa homolog (U1 70K) (U1 snRNP 70 kDa homolog) (U1-70K) (U1 small nuclear ribonucleoprotein SNP1) (U1 snRNP protein SNP1) | EBI-16283579 | 0.35 |
Q12379 | Anaphase-promoting complex subunit SWM1 (Anaphase-promoting complex subunit 13) (Spore wall maturation protein 1) | EBI-16284692 | 0.35 |
P38987 | Protein TEM1 | EBI-16285008 | 0.35 |
P53916 | Probable phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TEP1 (EC 3.1.3.67) | EBI-16285181 | 0.35 |
P53632 | Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4) | EBI-16285647 | 0.35 |
P52490 | Ubiquitin-conjugating enzyme E2 13 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme 13) (Ubiquitin carrier protein 13) (Ubiquitin-protein ligase 13) | EBI-16285898 | 0.35 |
P14680 | Dual specificity protein kinase YAK1 (EC 2.7.12.1) | EBI-16286565 | 0.35 |
P38191 | Protein yippee-like MOH1 | EBI-16286723 | 0.35 |
P38319 | Tyrosyl-DNA phosphodiesterase 1 (Tyr-DNA phosphodiesterase 1) (EC 3.1.4.-) | EBI-16286900 | 0.35 |
Q03899 | F-box protein YDR131C | EBI-16287816 | 0.35 |
Q03944 | Vacuolar protein sorting-associated protein 64 (Factor arrest protein 9) | EBI-16287890 | 0.35 |
Q05498 | rRNA-processing protein FCF1 (FAF1-copurifying factor 1) | EBI-16288251 | 0.35 |
P87263 | Putative uncharacterized protein YER066C-A | EBI-16288516 | 0.35 |
P53156 | Uncharacterized protein YGL081W | EBI-16288834 | 0.35 |
P53295 | Ribosome-interacting GTPase 2 (GTP-binding protein RBG2) | EBI-16289121 | 0.35 |
P36005 | Serine/threonine-protein kinase KDX1 (EC 2.7.11.1) (Kinase dead X-talker protein 1) (MPK1-like protein kinase 1) | EBI-16290101 | 0.35 |
P32807 | ATP-dependent DNA helicase II subunit 1 (EC 3.6.4.12) (ATP-dependent DNA helicase II subunit Ku70) (High affinity DNA-binding factor subunit 1) | EBI-16290244 | 0.35 |
Q04437 | ATP-dependent DNA helicase II subunit 2 (EC 3.6.4.12) (ATP-dependent DNA helicase II subunit Ku80) (High affinity DNA-binding factor subunit 2) (Yeast Ku80) | EBI-16290301 | 0.35 |
P53877 | Pre-rRNA-processing protein IPI3 (Involved in processing IST2 protein 3) | EBI-16291922 | 0.35 |
Q12152 | Putative serine/threonine-protein kinase YPL150W (EC 2.7.11.1) | EBI-16292374 | 0.35 |
P0CE41 | Heme-responsive zinc finger transcription factor HAP1 (CYP1 activatory protein) (Heme activator protein 1) | EBI-16401531 | 0.35 |
Database | Links |
UNIPROT | P25491 D6W1B6 |
PDB | 1NLT 1XAO 5VSO |
Pfam | PF00226 PF01556 PF00684 |
PROSITE | PS00636 PS50076 PS51188 |