Protein Information |
|
|---|---|
| Protein Name | Importin subunit alpha |
| Accession Code | Q02821 |
| Gene | SRP1 |
| Organism | Saccharomyces cerevisiae S288C (Taxonomy: 559292) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 542) | |
|
MDNGTDSSTSKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDESSVSADQQ FYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIAS GTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLS NLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPAL RAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTK KEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKA GGMEKIFNCQQNENDKIYEKAYKIIETYFGEEEDAVDETMAPQNAGNTFGFGSNVNQQFNFN |
|
Structure Viewer (PDB: 1EE4) |
|---|
Description |
||
|---|---|---|
| Cytoplasm, perinuclear region. Note=Mainly localized at the periphery of the nucleus. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) NLS-Dependent Protein Nuclear Import Complex (GO:0042564) Nuclear Envelope (GO:0005635) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Protein-Containing Complex (GO:0032991) |
|
Description |
|
|---|---|
| Functions in nuclear protein import as an adapter protein for importin beta nuclear receptors (PubMed:10913188). Binds specifically and directly to substrates containing either a simple or bipartite NLS motif (PubMed:10745017). Promotes docking of import substrates to the nuclear envelope (PubMed:8521485). Together with importin beta KAP95, mediates nuclear import of transcription factor GCN4 (PubMed:14648200). Together with tethering factor STS1, targets the proteasome to the nucleus (PubMed:10913188, PubMed:21075847). {Experimental EvidencePubMed:10745017, Experimental EvidencePubMed:10913188, Experimental EvidencePubMed:14648200, Experimental EvidencePubMed:21075847, Experimental EvidencePubMed:8521485}. | Assigned Ontology terms |
| Biological Process | Import Into Nucleus (GO:0051170) NLS-Bearing Protein Import Into Nucleus (GO:0006607) Proteasome Localization (GO:0031144) Protein Import Into Nucleus (GO:0006606) Protein Targeting To Membrane (GO:0006612) |
| Molecular Function | Disordered Domain Specific Binding (GO:0097718) Nuclear Import Signal Receptor Activity (GO:0061608) Nuclear Localization Sequence Binding (GO:0008139) Protein-Containing Complex Binding (GO:0044877) |
Interactions with Nuclear Envelope proteins (12 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| P20591 | Interferon-induced GTP-binding protein Mx1, N-terminally processed | EBI-11534426 | 0.56 |
| P20676 | Nucleoporin NUP1 | EBI-789997 | 0.69 |
| P32499 | Nucleoporin NUP2 | EBI-801825 | 0.78 |
| P34160 | Nuclear cap-binding protein complex subunit 1 | EBI-806268 | 0.69 |
| P39705 | Nucleoporin NUP60 | EBI-802293 | 0.69 |
| P40069 | Importin subunit beta-4 | EBI-804491 | 0.53 |
| Q06142 | Importin subunit beta-1 | EBI-784458 | 0.94 |
| Q08920 | Nuclear cap-binding protein subunit 2 | EBI-810994 | 0.77 |
| Q14974 | Importin subunit beta-1 | EBI-13942487 | 0.44 |
| Q03707 | Inner nuclear membrane protein SRC1 | EBI-16159762 | 0.68 |
| Q13137 | Calcium-binding and coiled-coil domain-containing protein 2 | EBI-11534474 | 0.56 |
| Q03281 | Inner nuclear membrane protein HEH2 | EBI-15598611 | 0.76 | Interactions with other proteins (171 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P22768 | Argininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase) | EBI-391461 | 0.37 |
| P00812 | Arginase (EC 3.5.3.1) | EBI-391464 | 0.37 |
| P33317 | Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (EC 3.6.1.23) (dUTP pyrophosphatase) | EBI-391467 | 0.37 |
| Q12178 | Cytosine deaminase (yCD) (EC 3.5.4.1) (Cytosine aminohydrolase) (Fluorocytosine resistance protein 1) | EBI-391470 | 0.37 |
| P28240 | Isocitrate lyase (ICL) (EC 4.1.3.1) (Methylisocitrate lyase) (MICA) (EC 4.1.3.30) (Threo-D(S)-isocitrate glyoxylate-lyase) | EBI-391473 | 0.37 |
| P06106 | Homocysteine/cysteine synthase (EC 2.5.1.47) (EC 2.5.1.49) (O-acetylserine/O-acetylhomoserine sulfhydrylase) (OAS-OAH SHLase) (OAS-OAH sulfhydrylase) | EBI-391476 | 0.37 |
| P53081 | NGG1-interacting factor 3 | EBI-391479 | 0.37 |
| P19881 | 4-nitrophenylphosphatase (PNPPase) (EC 3.1.3.41) | EBI-391482 | 0.37 |
| P36068 | SWI5-dependent HO expression protein 2 | EBI-391485 | 0.37 |
| P35497 | Sorbitol dehydrogenase 1 (SDH 1) (EC 1.1.1.-) (Polyol dehydrogenase) (Xylitol dehydrogenase) (EC 1.1.1.9) | EBI-391488 | 0.37 |
| P41835 | Thiamine biosynthetic bifunctional enzyme [Includes: Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase); Hydroxyethylthiazole kinase (EC 2.7.1.50) (4-methyl-5-beta-hydroxyethylthiazole kinase) (TH kinase) (THZ kinase)] | EBI-391491 | 0.37 |
| P34760 | Peroxiredoxin TSA1 (Prx) (EC 1.11.1.24) (Cytoplasmic thiol peroxidase 1) (cTPx 1) (Protector protein) (PRP) (Thiol-specific antioxidant protein 1) (Thioredoxin peroxidase type Ia) (TPx type Ia) (Thioredoxin-dependent peroxide reductase) (Thioredoxin-dependent peroxiredoxin TSA1) | EBI-391494 | 0.37 |
| P47165 | Xanthine phosphoribosyltransferase 1 (XPRT) (EC 2.4.2.-) | EBI-391497 | 0.37 |
| P38749 | AP-1-like transcription factor YAP3 | EBI-391500 | 0.37 |
| P43543 | Cyanamide hydratase DDI2 (CAH) (EC 4.2.1.69) (DNA damage-inducible protein 2) | EBI-391503 | 0.37 |
| P53215 | tRNA(His) guanylyltransferase (EC 2.7.7.79) (tRNA-histidine guanylyltransferase) | EBI-391506 | 0.37 |
| Q05016 | NADP-dependent 3-hydroxy acid dehydrogenase (L-allo-threonine dehydrogenase) (EC 1.1.1.-, EC 1.1.1.381) | EBI-391509 | 0.37 |
| P15108 | ATP-dependent molecular chaperone HSC82 (82 kDa heat shock cognate protein) (Heat shock protein Hsp90 constitutive isoform) | EBI-708957 | 0.56 |
| P46948 | Exosome complex component SKI6 (Extracellular mutant protein 20) (Ribosomal RNA-processing protein 41) (Superkiller protein 6) | EBI-789541 | 0.35 |
| P38792 | Exosome complex component RRP4 (Ribosomal RNA-processing protein 4) | EBI-791854 | 0.53 |
| P32799 | Cytochrome c oxidase subunit 13, mitochondrial (Cytochrome c oxidase polypeptide VIa) | EBI-792386 | 0.35 |
| P53859 | Exosome complex component CSL4 (CEP1 synthetic lethal protein 4) | EBI-792516 | 0.35 |
| P27466 | Calcium/calmodulin-dependent protein kinase I (EC 2.7.11.17) | EBI-793512 | 0.35 |
| P36124 | SET domain-containing protein 3 | EBI-794754 | 0.53 |
| Q12149 | Exosome complex exonuclease RRP6 (EC 3.1.13.-) (Ribosomal RNA-processing protein 6) | EBI-796196 | 0.67 |
| Q02724 | Ubiquitin-like-specific protease 1 (EC 3.4.22.68) | EBI-797293 | 0.59 |
| Q12124 | Mediator of RNA polymerase II transcription subunit 2 (Mediator complex subunit 2) | EBI-797390 | 0.35 |
| Q08278 | Mediator of RNA polymerase II transcription subunit 7 (Mediator complex subunit 7) | EBI-799246 | 0.35 |
| P53833 | Ribonucleases P/MRP protein subunit POP3 (RNA-processing protein POP3) (RNases MRP/P 22.6 kDa subunit) | EBI-799459 | 0.35 |
| P13259 | Choline-phosphate cytidylyltransferase (EC 2.7.7.15) (CTP:phosphocholine cytidylyltransferase) (CCT) (CT) (Phosphorylcholine transferase) | EBI-799593 | 0.69 |
| P53256 | Exosome complex component RRP46 (Ribosomal RNA-processing protein 46) | EBI-800712 | 0.35 |
| P53881 | 54S ribosomal protein L22, mitochondrial (Mitochondrial large ribosomal subunit protein uL22m) | EBI-800899 | 0.35 |
| P50111 | Protein ZDS1 (Protein NRC1) (RT2GS1) | EBI-803477 | 0.35 |
| P22215 | Uncharacterized transporter SLY41 | EBI-804242 | 0.35 |
| P53866 | Protein SQS1 (Squelch of splicing suppression protein 1) | EBI-804491 | 0.35 |
| P32337 | Importin subunit beta-3 (Karyopherin subunit beta-3) (Karyopherin-121) (Protein secretion enhancer 1) | EBI-804491 | 0.35 |
| P41940 | Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1-phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP-hexose pyrophosphorylase) | EBI-804491 | 0.35 |
| P00330 | Alcohol dehydrogenase 1 (EC 1.1.1.1) (Alcohol dehydrogenase I) (YADH-1) | EBI-804491 | 0.35 |
| Q12449 | Hsp90 co-chaperone AHA1 (Activator of Hsp90 ATPase protein 1) | EBI-807743 | 0.35 |
| Q08285 | Exosome complex component RRP40 (Ribosomal RNA-processing protein 40) | EBI-808713 | 0.35 |
| Q05636 | Exosome complex component RRP45 (Ribosomal RNA-processing protein 45) | EBI-809094 | 0.35 |
| Q12464 | RuvB-like protein 2 (RUVBL2) (EC 3.6.4.12) (TIP49-homology protein 2) (TIP49b homolog) | EBI-811656 | 0.53 |
| P28003 | SWIRM domain-containing protein FUN19 | EBI-815383 | 0.27 |
| Q06218 | ATP-dependent RNA helicase DBP9 (EC 3.6.4.13) (DEAD box protein 9) | EBI-817288 | 0.27 |
| Q12277 | Exosome complex component RRP42 (Ribosomal RNA-processing protein 42) | EBI-6963562 | 0.40 |
| P25359 | Exosome complex component RRP43 (Ribosomal RNA-processing protein 43) | EBI-6964469 | 0.56 |
| Q05543 | Regulator of Ty1 transposition protein 103 | EBI-6995482 | 0.56 |
| Q12460 | Nucleolar protein 56 (Ribosome biosynthesis protein SIK1) (Suppressor of I kappa b protein 1) | EBI-7021190 | 0.40 |
| P22579 | Transcriptional regulatory protein SIN3 | EBI-7021237 | 0.67 |
| Q06697 | Cell division control protein 73 (RNA polymerase-associated protein CDC73) | EBI-7044996 | 0.40 |
| P53072 | tRNA acetyltransferase TAN1 (EC 2.3.-.-) | EBI-7153795 | 0.40 |
| Q05900 | U1 small nuclear ribonucleoprotein C (U1 snRNP C) (U1-C) (U1C) | EBI-7156793 | 0.40 |
| P47108 | Nucleolar pre-ribosomal-associated protein 2 (Unhealthy ribosome biogenesis protein 2) | EBI-7162569 | 0.44 |
| P38806 | Chromatin modification-related protein YNG2 (ESA1-associated factor 4) (ING1 homolog 2) | EBI-7181311 | 0.40 |
| P53911 | Chromatin modification-related protein EAF7 (ESA1-associated factor 7) | EBI-7184902 | 0.40 |
| Q08162 | Exosome complex exonuclease DIS3 (EC 3.1.13.-) (EC 3.1.26.-) (Chromosome disjunction protein 3) (Ribosomal RNA-processing protein 44) | EBI-7271310 | 0.56 |
| P32324 | Elongation factor 2 (EF-2) (Eukaryotic elongation factor 2) (eEF2) (Ribosomal translocase) (Translation elongation factor 2) | EBI-7286906 | 0.56 |
| P19659 | Mediator of RNA polymerase II transcription subunit 15 (Autonomous replication regulatory protein 3) (Basal expression activator protein 1) (Defective silencing suppressor protein 4) (Mediator complex subunit 15) (Transcription regulatory protein GAL11) (Ty insertion suppressor protein 13) | EBI-7307988 | 0.40 |
| Q12499 | Nucleolar protein 58 (Nucleolar protein 5) | EBI-7435045 | 0.40 |
| P53261 | Pescadillo homolog (Nucleolar protein 7) (Ribosomal RNA-processing protein 13) | EBI-7436958 | 0.56 |
| P53397 | N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (AP lyase) (EC 4.2.99.18)] | EBI-7440707 | 0.44 |
| P22216 | Serine/threonine-protein kinase RAD53 (EC 2.7.12.1) (CHEK2 homolog) (Serine-protein kinase 1) | EBI-7509953 | 0.69 |
| Q04779 | Transcriptional regulatory protein RCO1 | EBI-7512888 | 0.40 |
| P53552 | THO complex subunit 2 (Low dye-binding protein 5) (THO complex subunit RLR1) (Zinc-regulated gene 13 protein) | EBI-7519241 | 0.56 |
| P49723 | Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2) | EBI-7582150 | 0.40 |
| P06843 | Protein SPT2 (Negative regulator of Ty transcription) | EBI-7751879 | 0.56 |
| Q01476 | Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.4.19.12) (Deubiquitinating enzyme 2) (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) | EBI-7792448 | 0.40 |
| Q04500 | U3 small nucleolar RNA-associated protein 14 (U3 snoRNA-associated protein 14) (U three protein 14) | EBI-7810284 | 0.40 |
| P22936 | Apurinic-apyrimidinic endonuclease 1 (AP endonuclease 1) (EC 3.1.21.-) | EBI-7900920 | 0.40 |
| P36036 | RNA annealing protein YRA2 | EBI-8226241 | 0.22 |
| P33307 | Importin alpha re-exporter (Chromosome segregation protein CSE1) | EBI-1041382 | 0.57 |
| P32562 | Cell cycle serine/threonine-protein kinase CDC5/MSD2 (EC 2.7.11.21) | EBI-2112894 | 0.53 |
| P06700 | NAD-dependent histone deacetylase SIR2 (EC 2.3.1.286) (Regulatory protein SIR2) (Silent information regulator 2) | EBI-2212712 | 0.40 |
| Q04087 | Monopolin complex subunit LRS4 (Loss of rDNA silencing protein 4) | EBI-2212766 | 0.40 |
| Q08904 | Protein RDR1 (Repressor of drug resistance protein 1) | EBI-2344792 | 0.37 |
| P53184 | Nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) (NAMase) | EBI-2345292 | 0.37 |
| P51601 | GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) | EBI-2345314 | 0.37 |
| P25367 | [PIN+] prion protein RNQ1 (Rich in asparagine and glutamine protein 1) | EBI-2345326 | 0.37 |
| P08536 | Sulfate adenylyltransferase (EC 2.7.7.4) (ATP-sulfurylase) (Methionine-requiring protein 3) (Sulfate adenylate transferase) (SAT) | EBI-2345887 | 0.37 |
| Q03063 | Down-regulator of invasive growth 1 (Regulator of STE12 protein 1) (Regulator of sterile twelve 1) | EBI-2345890 | 0.37 |
| P17423 | Homoserine kinase (HK) (HSK) (EC 2.7.1.39) | EBI-2345893 | 0.37 |
| P60010 | Actin (EC 3.6.4.-) | EBI-2346004 | 0.37 |
| P38821 | Aspartyl aminopeptidase 4 (EC 3.4.11.21) | EBI-2346115 | 0.37 |
| Q02895 | Putative aryl-alcohol dehydrogenase AAD16 (EC 1.1.1.-) | EBI-2346118 | 0.37 |
| Q12306 | Ubiquitin-like protein SMT3 | EBI-2346577 | 0.37 |
| Q06549 | Cytidine deaminase (CDA) (EC 3.5.4.5) (Cytidine aminohydrolase) | EBI-2346610 | 0.37 |
| P32318 | Thiamine thiazole synthase (EC 2.4.2.60) (Thiazole biosynthetic enzyme) | EBI-2346619 | 0.37 |
| P43619 | Nicotinate-nucleotide pyrophosphorylase [carboxylating] (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) (QAPRTase) | EBI-2346747 | 0.37 |
| Q03373 | Down-regulator of invasive growth 2 (Regulator of STE12 protein 2) (Regulator of sterile twelve 2) | EBI-2346812 | 0.55 |
| P09201 | Fructose-1,6-bisphosphatase (FBPase) (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase) | EBI-2346852 | 0.37 |
| Q12189 | Ribose-5-phosphate isomerase (EC 5.3.1.6) (D-ribose-5-phosphate ketol-isomerase) (Phosphoriboisomerase) | EBI-2347997 | 0.37 |
| P15202 | Peroxisomal catalase A (EC 1.11.1.6) | EBI-2348000 | 0.37 |
| P18759 | Vesicular-fusion protein SEC18 | EBI-2348009 | 0.37 |
| P38716 | Uncharacterized trans-sulfuration enzyme YHR112C | EBI-2348021 | 0.37 |
| Q12206 | Transcriptional modulator WTM2 | EBI-2348042 | 0.37 |
| P37366 | Cyclin CCL1 | EBI-2611238 | 0.35 |
| P13365 | G1/S-specific cyclin CLN3 | EBI-2611665 | 0.35 |
| P32350 | Dual specificity protein kinase KNS1 (EC 2.7.12.1) | EBI-2612391 | 0.35 |
| P40187 | GSY2-interacting protein PIG2 | EBI-2612903 | 0.35 |
| P38089 | Protein phosphatase 2C homolog 4 (PP2C-4) (EC 3.1.3.16) | EBI-2613131 | 0.35 |
| Q12224 | Transcription factor RLM1 | EBI-2613375 | 0.35 |
| P38255 | Transcriptional regulatory protein RXT2 | EBI-2613514 | 0.35 |
| P32447 | Histone chaperone ASF1 (Anti-silencing function protein 1) (yASF1) | EBI-2881693 | 0.00 |
| Q12495 | Chromatin assembly factor 1 subunit p90 (CAF-1 90 kDa subunit) (RAP1 localization factor 2) | EBI-16280136 | 0.53 |
| Q02796 | Transcriptional regulatory protein LGE1 (Large cells protein 1) | EBI-2885546 | 0.00 |
| Q04116 | Homeobox protein YHP1 | EBI-2889029 | 0.00 |
| P25303 | DnaJ-related protein SCJ1 (J protein SCJ1) | EBI-3659819 | 0.35 |
| P10591 | Heat shock protein SSA1 (Heat shock protein YG100) | EBI-3677844 | 0.35 |
| P11484 | Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb) | EBI-3784104 | 0.35 |
| P50875 | Transcription factor SPT20 | EBI-4376349 | 0.35 |
| P50102 | Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.4.19.12) (Deubiquitinating enzyme 8) (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) | EBI-4380099 | 0.35 |
| P38129 | Transcription initiation factor TFIID subunit 5 (TAFII-90) (TBP-associated factor 5) (TBP-associated factor 90 kDa) | EBI-4380674 | 0.35 |
| Q05027 | Transcription initiation factor TFIID subunit 9 (TAFII-17) (TAFII20) (TBP-associated factor 17 kDa) (TBP-associated factor 9) | EBI-4382094 | 0.35 |
| P35177 | Transcriptional activator SPT7 | EBI-4383599 | 0.35 |
| Q03330 | Histone acetyltransferase GCN5 (EC 2.3.1.48) (Histone crotonyltransferase GCN5) (EC 2.3.1.-) | EBI-4385804 | 0.35 |
| P53131 | Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 (EC 3.6.4.13) (Helicase JA1) | EBI-10903607 | 0.35 |
| O00635 | E3 ubiquitin-protein ligase TRIM38 (EC 2.3.2.27) (RING finger protein 15) (Tripartite motif-containing protein 38) (Zinc finger protein RoRet) | EBI-11534408 | 0.56 |
| Q7Z6G3 | N-terminal EF-hand calcium-binding protein 2 (EF-hand calcium-binding protein 2) (Neuronal calcium-binding protein 2) (Synaptotagmin-interacting protein 2) (Stip-2) | EBI-11534397 | 0.56 |
| A0A0C4DGF1 | Zinc finger and BTB domain-containing protein 32 | EBI-11534388 | 0.56 |
| Q96A10 | Endogenous retrovirus group K3 member 1 (HCG2043597, isoform CRA_b) (LOC113386 protein) | EBI-11534379 | 0.56 |
| P60709 | Actin, cytoplasmic 1 (EC 3.6.4.-) (Beta-actin) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed] | EBI-11534454 | 0.56 |
| P35520 | Cystathionine beta-synthase (EC 4.2.1.22) (Beta-thionase) (Serine sulfhydrase) | EBI-11534444 | 0.56 |
| P22234 | Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS) [Includes: Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC); Phosphoribosylaminoimidazole succinocarboxamide synthetase (EC 6.3.2.6) (SAICAR synthetase)] | EBI-11534435 | 0.56 |
| P13196 | 5-aminolevulinate synthase, non-specific, mitochondrial (ALAS-H) (EC 2.3.1.37) (5-aminolevulinic acid synthase 1) (Delta-ALA synthase 1) (Delta-aminolevulinate synthase 1) | EBI-11534417 | 0.56 |
| Q13557 | Calcium/calmodulin-dependent protein kinase type II subunit delta (CaM kinase II subunit delta) (CaMK-II subunit delta) (EC 2.7.11.17) | EBI-11534487 | 0.56 |
| P63261 | Actin, cytoplasmic 2 (EC 3.6.4.-) (Gamma-actin) [Cleaved into: Actin, cytoplasmic 2, N-terminally processed] | EBI-11534464 | 0.56 |
| Q9NS73 | MAP3K12-binding inhibitory protein 1 (MAPK upstream kinase-binding inhibitory protein) (MUK-binding inhibitory protein) | EBI-11534541 | 0.56 |
| Q9HAN9 | Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 (NMN/NaMN adenylyltransferase 1) (EC 2.7.7.1) (EC 2.7.7.18) (Nicotinamide-nucleotide adenylyltransferase 1) (NMN adenylyltransferase 1) (Nicotinate-nucleotide adenylyltransferase 1) (NaMN adenylyltransferase 1) | EBI-11534532 | 0.56 |
| Q8WVF5 | BTB/POZ domain-containing protein KCTD4 | EBI-11534523 | 0.56 |
| Q15041 | ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL-6-interacting protein 1) (Aip-1) (Apoptotic regulator in the membrane of the endoplasmic reticulum) | EBI-11534514 | 0.56 |
| Q15038 | DAZ-associated protein 2 (Deleted in azoospermia-associated protein 2) (Proline-rich transcript in brain protein) | EBI-11534505 | 0.56 |
| Q13867 | Bleomycin hydrolase (BH) (BLM hydrolase) (BMH) (EC 3.4.22.40) | EBI-11534496 | 0.56 |
| Q9NVV9 | THAP domain-containing protein 1 | EBI-11534559 | 0.56 |
| P05221 | Nucleoplasmin | EBI-16159838 | 0.56 |
| P33322 | H/ACA ribonucleoprotein complex subunit CBF5 (EC 5.4.99.-) (Centromere-binding factor 5) (Centromere/microtubule-binding protein CBF5) (H/ACA snoRNP protein CBF5) (Small nucleolar RNP protein CBF5) (p64') | EBI-16265066 | 0.35 |
| P47027 | DNA replication regulator DPB11 | EBI-16268315 | 0.35 |
| P34252 | DNA replication regulator SLD2 (DNA replication and checkpoint protein 1) | EBI-16268369 | 0.35 |
| P21268 | Cyclin-dependent kinase inhibitor FAR1 (CKI FAR1) (Factor arrest protein) | EBI-16269078 | 0.35 |
| P40316 | Securin | EBI-16275395 | 0.35 |
| P40348 | Replication factor C subunit 2 (Replication factor C2) (Activator 1 41 kDa subunit) | EBI-16279429 | 0.35 |
| Q12749 | Structural maintenance of chromosomes protein 6 (DNA repair protein RHC18) (Rad18 homolog) | EBI-16279839 | 0.35 |
| P22470 | Protein SAN1 | EBI-16281382 | 0.35 |
| P11978 | Regulatory protein SIR4 (Silent information regulator 4) | EBI-16282672 | 0.35 |
| Q00916 | U1 small nuclear ribonucleoprotein 70 kDa homolog (U1 70K) (U1 snRNP 70 kDa homolog) (U1-70K) (U1 small nuclear ribonucleoprotein SNP1) (U1 snRNP protein SNP1) | EBI-16283579 | 0.35 |
| Q03010 | Transcriptional regulatory protein UME1 (WD repeat-containing transcriptional modulator 3) | EBI-16284085 | 0.35 |
| P38811 | Transcription-associated protein 1 (p400 kDa component of SAGA) | EBI-16284085 | 0.35 |
| P15019 | Transaldolase (EC 2.2.1.2) | EBI-16284085 | 0.35 |
| P0CS90 | Import motor subunit, mitochondrial (EC 3.6.4.10) (Endonuclease SceI 75 kDa subunit) (Endo.SceI 75 kDa subunit) (mtHSP70) | EBI-16284085 | 0.35 |
| Q03782 | 56 kDa U1 small nuclear ribonucleoprotein component | EBI-16284085 | 0.35 |
| P38262 | SIR4-interacting protein SIF2 | EBI-16284085 | 0.35 |
| P39954 | Adenosylhomocysteinase (AdoHcyase) (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) | EBI-16284085 | 0.35 |
| Q02555 | Ribonuclease 3 (EC 3.1.26.3) (Ribonuclease III) (RNase III) | EBI-16284085 | 0.35 |
| P21538 | DNA-binding protein REB1 (QBP) | EBI-16284085 | 0.35 |
| P12709 | Glucose-6-phosphate isomerase (GPI) (EC 5.3.1.9) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) | EBI-16284085 | 0.35 |
| P06169 | Pyruvate decarboxylase isozyme 1 (EC 4.1.1.-) (EC 4.1.1.43) (EC 4.1.1.72) (EC 4.1.1.74) (Thiamine pyrophosphate-dependent 2-oxo-acid decarboxylase) (2ODC) | EBI-16284085 | 0.35 |
| P29468 | Poly(A) polymerase (PAP) (EC 2.7.7.19) (Polynucleotide adenylyltransferase) | EBI-16284085 | 0.35 |
| Q00539 | Protein NAM8 (Nuclear accommodation of mitochondria protein 8) (U1 snRNP component NAM8) | EBI-16284085 | 0.35 |
| P33441 | THO complex subunit MFT1 (Mitochondrial fusion target protein 1) | EBI-16284085 | 0.35 |
| P05694 | 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (EC 2.1.1.14) (Cobalamin-independent methionine synthase) (Delta-P8 protein) (Methionine synthase, vitamin-B12 independent isozyme) | EBI-16284085 | 0.35 |
| P00958 | Methionine--tRNA ligase, cytoplasmic (EC 6.1.1.10) (Methionyl-tRNA synthetase) (MetRS) | EBI-16284085 | 0.35 |
| P17629 | THO complex subunit HPR1 (Hyperrecombination protein 1) | EBI-16284085 | 0.35 |
| Q03532 | ATP-dependent RNA helicase HAS1 (EC 3.6.4.13) (Helicase associated with SET1 protein 1) | EBI-16284085 | 0.35 |
| Q07623 | Nucleolar protein 6 | EBI-16284085 | 0.35 |
| P45976 | Pre-mRNA polyadenylation factor FIP1 | EBI-16284085 | 0.35 |
| P14540 | Fructose-bisphosphate aldolase (FBP aldolase) (FBPA) (EC 4.1.2.13) (Fructose-1,6-bisphosphate aldolase) | EBI-16284085 | 0.35 |
| Q12432 | Chromatin modification-related protein EAF3 (ESA1-associated factor 3) | EBI-16284085 | 0.35 |
| P54115 | Magnesium-activated aldehyde dehydrogenase, cytosolic (EC 1.2.1.-) (EC 1.2.1.4) (Mg(2+)-activated acetaldehyde dehydrogenase) (Mg(2+)-ACDH) | EBI-16284085 | 0.35 |
| P19414 | Aconitate hydratase, mitochondrial (Aconitase) (EC 4.2.1.3) (Citrate hydro-lyase) | EBI-16284085 | 0.35 |
| Q12476 | Protein AIR2 (Arginine methyltransferase-interacting RING finger protein 2) | EBI-16287516 | 0.35 |
| Q07930 | Pre-mRNA leakage protein 1 | EBI-16290646 | 0.35 |
| Q00416 | Helicase SEN1 (EC 3.6.4.-) (tRNA-splicing endonuclease positive effector) | EBI-16421063 | 0.35 |
Database | Links |
| UNIPROT | Q02821 D6W0Z8 |
| PDB | 1BK5 1BK6 1EE4 1EE5 1UN0 1WA5 2C1T 4PVZ 4XZR 5H2W 5H2X 5T94 |
| Pfam | PF00514 PF16186 PF01749 |
| PROSITE | PS50176 PS51214 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory