Importin subunit alpha - Saccharomyces cerevisiae S288C

Importin subunit alpha (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Importin subunit alpha
Accession Code	Q02821
Gene	SRP1
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 542)
MDNGTDSSTSKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDESSVSADQQ FYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIAS GTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLS NLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPAL RAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTK KEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKA GGMEKIFNCQQNENDKIYEKAYKIIETYFGEEEDAVDETMAPQNAGNTFGFGSNVNQQFNFN

Structure Viewer (PDB: 5H2X)

Subcellular Location

Description
Cytoplasm, perinuclear region. Note=Mainly localized at the periphery of the nucleus.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) NLS-Dependent Protein Nuclear Import Complex (GO:0042564) Nuclear Envelope (GO:0005635) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Protein-Containing Complex (GO:0032991)

Biology & Function

Description
Functions in nuclear protein import as an adapter protein for importin beta nuclear receptors (PubMed:10913188). Binds specifically and directly to substrates containing either a simple or bipartite NLS motif (PubMed:10745017). Promotes docking of import substrates to the nuclear envelope (PubMed:8521485). Together with importin beta KAP95, mediates nuclear import of transcription factor GCN4 (PubMed:14648200). Together with tethering factor STS1, targets the proteasome to the nucleus (PubMed:10913188, PubMed:21075847). {Experimental EvidencePubMed:10745017, Experimental EvidencePubMed:10913188, Experimental EvidencePubMed:14648200, Experimental EvidencePubMed:21075847, Experimental EvidencePubMed:8521485}.
Assigned Ontology terms

Biological Process	Import Into Nucleus (GO:0051170) NLS-Bearing Protein Import Into Nucleus (GO:0006607) Proteasome Localization (GO:0031144) Protein Import Into Nucleus (GO:0006606) Protein Targeting To Membrane (GO:0006612)
Molecular Function	Disordered Domain Specific Binding (GO:0097718) Nuclear Import Signal Receptor Activity (GO:0061608) Nuclear Localization Sequence Binding (GO:0008139) Protein-Containing Complex Binding (GO:0044877)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (12 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P20591	Interferon-induced GTP-binding protein Mx1, N-terminally processed	EBI-11534426	0.56
P20676	Nucleoporin NUP1	EBI-789997	0.69
P32499	Nucleoporin NUP2	EBI-801825	0.78
P34160	Nuclear cap-binding protein complex subunit 1	EBI-806268	0.69
P39705	Nucleoporin NUP60	EBI-802293	0.69
P40069	Importin subunit beta-4	EBI-804491	0.53
Q06142	Importin subunit beta-1	EBI-784458	0.94
Q08920	Nuclear cap-binding protein subunit 2	EBI-810994	0.77
Q14974	Importin subunit beta-1	EBI-13942487	0.44
Q03707	Inner nuclear membrane protein SRC1	EBI-16159762	0.68
Q13137	Calcium-binding and coiled-coil domain-containing protein 2	EBI-11534474	0.56
Q03281	Inner nuclear membrane protein HEH2	EBI-15598611	0.76
Interactions with other proteins (171 interactors)

Partner (UniProt)		IntAct	Confidence score
P22768	Argininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase)	EBI-391461	0.37
P00812	Arginase (EC 3.5.3.1)	EBI-391464	0.37
P33317	Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) (EC 3.6.1.23) (dUTP pyrophosphatase)	EBI-391467	0.37
Q12178	Cytosine deaminase (yCD) (EC 3.5.4.1) (Cytosine aminohydrolase) (Fluorocytosine resistance protein 1)	EBI-391470	0.37
P28240	Isocitrate lyase (ICL) (EC 4.1.3.1) (Methylisocitrate lyase) (MICA) (EC 4.1.3.30) (Threo-D(S)-isocitrate glyoxylate-lyase)	EBI-391473	0.37
P06106	Homocysteine/cysteine synthase (EC 2.5.1.47) (EC 2.5.1.49) (O-acetylserine/O-acetylhomoserine sulfhydrylase) (OAS-OAH SHLase) (OAS-OAH sulfhydrylase)	EBI-391476	0.37
P53081	NGG1-interacting factor 3	EBI-391479	0.37
P19881	4-nitrophenylphosphatase (PNPPase) (EC 3.1.3.41)	EBI-391482	0.37
P36068	SWI5-dependent HO expression protein 2	EBI-391485	0.37
P35497	Sorbitol dehydrogenase 1 (SDH 1) (EC 1.1.1.-) (Polyol dehydrogenase) (Xylitol dehydrogenase) (EC 1.1.1.9)	EBI-391488	0.37
P41835	Thiamine biosynthetic bifunctional enzyme [Includes: Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase); Hydroxyethylthiazole kinase (EC 2.7.1.50) (4-methyl-5-beta-hydroxyethylthiazole kinase) (TH kinase) (THZ kinase)]	EBI-391491	0.37
P34760	Peroxiredoxin TSA1 (Prx) (EC 1.11.1.24) (Cytoplasmic thiol peroxidase 1) (cTPx 1) (Protector protein) (PRP) (Thiol-specific antioxidant protein 1) (Thioredoxin peroxidase type Ia) (TPx type Ia) (Thioredoxin-dependent peroxide reductase) (Thioredoxin-dependent peroxiredoxin TSA1)	EBI-391494	0.37
P47165	Xanthine phosphoribosyltransferase 1 (XPRT) (EC 2.4.2.-)	EBI-391497	0.37
P38749	AP-1-like transcription factor YAP3	EBI-391500	0.37
P43543	Cyanamide hydratase DDI2 (CAH) (EC 4.2.1.69) (DNA damage-inducible protein 2)	EBI-391503	0.37
P53215	tRNA(His) guanylyltransferase (EC 2.7.7.79) (tRNA-histidine guanylyltransferase)	EBI-391506	0.37
Q05016	NADP-dependent 3-hydroxy acid dehydrogenase (L-allo-threonine dehydrogenase) (EC 1.1.1.-, EC 1.1.1.381)	EBI-391509	0.37
P15108	ATP-dependent molecular chaperone HSC82 (82 kDa heat shock cognate protein) (Heat shock protein Hsp90 constitutive isoform)	EBI-708957	0.56
P46948	Exosome complex component SKI6 (Extracellular mutant protein 20) (Ribosomal RNA-processing protein 41) (Superkiller protein 6)	EBI-789541	0.35
P38792	Exosome complex component RRP4 (Ribosomal RNA-processing protein 4)	EBI-791854	0.53
P32799	Cytochrome c oxidase subunit 13, mitochondrial (Cytochrome c oxidase polypeptide VIa)	EBI-792386	0.35
P53859	Exosome complex component CSL4 (CEP1 synthetic lethal protein 4)	EBI-792516	0.35
P27466	Calcium/calmodulin-dependent protein kinase I (EC 2.7.11.17)	EBI-793512	0.35
P36124	SET domain-containing protein 3	EBI-794754	0.53
Q12149	Exosome complex exonuclease RRP6 (EC 3.1.13.-) (Ribosomal RNA-processing protein 6)	EBI-796196	0.67
Q02724	Ubiquitin-like-specific protease 1 (EC 3.4.22.68)	EBI-797293	0.59
Q12124	Mediator of RNA polymerase II transcription subunit 2 (Mediator complex subunit 2)	EBI-797390	0.35
Q08278	Mediator of RNA polymerase II transcription subunit 7 (Mediator complex subunit 7)	EBI-799246	0.35
P53833	Ribonucleases P/MRP protein subunit POP3 (RNA-processing protein POP3) (RNases MRP/P 22.6 kDa subunit)	EBI-799459	0.35
P13259	Choline-phosphate cytidylyltransferase (EC 2.7.7.15) (CTP:phosphocholine cytidylyltransferase) (CCT) (CT) (Phosphorylcholine transferase)	EBI-799593	0.69
P53256	Exosome complex component RRP46 (Ribosomal RNA-processing protein 46)	EBI-800712	0.35
P53881	54S ribosomal protein L22, mitochondrial (Mitochondrial large ribosomal subunit protein uL22m)	EBI-800899	0.35
P50111	Protein ZDS1 (Protein NRC1) (RT2GS1)	EBI-803477	0.35
P22215	Uncharacterized transporter SLY41	EBI-804242	0.35
P53866	Protein SQS1 (Squelch of splicing suppression protein 1)	EBI-804491	0.35
P32337	Importin subunit beta-3 (Karyopherin subunit beta-3) (Karyopherin-121) (Protein secretion enhancer 1)	EBI-804491	0.35
P41940	Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1-phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP-hexose pyrophosphorylase)	EBI-804491	0.35
P00330	Alcohol dehydrogenase 1 (EC 1.1.1.1) (Alcohol dehydrogenase I) (YADH-1)	EBI-804491	0.35
Q12449	Hsp90 co-chaperone AHA1 (Activator of Hsp90 ATPase protein 1)	EBI-807743	0.35
Q08285	Exosome complex component RRP40 (Ribosomal RNA-processing protein 40)	EBI-808713	0.35
Q05636	Exosome complex component RRP45 (Ribosomal RNA-processing protein 45)	EBI-809094	0.35
Q12464	RuvB-like protein 2 (RUVBL2) (EC 3.6.4.12) (TIP49-homology protein 2) (TIP49b homolog)	EBI-811656	0.53
P28003	SWIRM domain-containing protein FUN19	EBI-815383	0.27
Q06218	ATP-dependent RNA helicase DBP9 (EC 3.6.4.13) (DEAD box protein 9)	EBI-817288	0.27
Q12277	Exosome complex component RRP42 (Ribosomal RNA-processing protein 42)	EBI-6963562	0.40
P25359	Exosome complex component RRP43 (Ribosomal RNA-processing protein 43)	EBI-6964469	0.56
Q05543	Regulator of Ty1 transposition protein 103	EBI-6995482	0.56
Q12460	Nucleolar protein 56 (Ribosome biosynthesis protein SIK1) (Suppressor of I kappa b protein 1)	EBI-7021190	0.40
P22579	Transcriptional regulatory protein SIN3	EBI-7021237	0.67
Q06697	Cell division control protein 73 (RNA polymerase-associated protein CDC73)	EBI-7044996	0.40
P53072	tRNA acetyltransferase TAN1 (EC 2.3.-.-)	EBI-7153795	0.40
Q05900	U1 small nuclear ribonucleoprotein C (U1 snRNP C) (U1-C) (U1C)	EBI-7156793	0.40
P47108	Nucleolar pre-ribosomal-associated protein 2 (Unhealthy ribosome biogenesis protein 2)	EBI-7162569	0.44
P38806	Chromatin modification-related protein YNG2 (ESA1-associated factor 4) (ING1 homolog 2)	EBI-7181311	0.40
P53911	Chromatin modification-related protein EAF7 (ESA1-associated factor 7)	EBI-7184902	0.40
Q08162	Exosome complex exonuclease DIS3 (EC 3.1.13.-) (EC 3.1.26.-) (Chromosome disjunction protein 3) (Ribosomal RNA-processing protein 44)	EBI-7271310	0.56
P32324	Elongation factor 2 (EF-2) (Eukaryotic elongation factor 2) (eEF2) (Ribosomal translocase) (Translation elongation factor 2)	EBI-7286906	0.56
P19659	Mediator of RNA polymerase II transcription subunit 15 (Autonomous replication regulatory protein 3) (Basal expression activator protein 1) (Defective silencing suppressor protein 4) (Mediator complex subunit 15) (Transcription regulatory protein GAL11) (Ty insertion suppressor protein 13)	EBI-7307988	0.40
Q12499	Nucleolar protein 58 (Nucleolar protein 5)	EBI-7435045	0.40
P53261	Pescadillo homolog (Nucleolar protein 7) (Ribosomal RNA-processing protein 13)	EBI-7436958	0.56
P53397	N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (AP lyase) (EC 4.2.99.18)]	EBI-7440707	0.44
P22216	Serine/threonine-protein kinase RAD53 (EC 2.7.12.1) (CHEK2 homolog) (Serine-protein kinase 1)	EBI-7509953	0.69
Q04779	Transcriptional regulatory protein RCO1	EBI-7512888	0.40
P53552	THO complex subunit 2 (Low dye-binding protein 5) (THO complex subunit RLR1) (Zinc-regulated gene 13 protein)	EBI-7519241	0.56
P49723	Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2)	EBI-7582150	0.40
P06843	Protein SPT2 (Negative regulator of Ty transcription)	EBI-7751879	0.56
Q01476	Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.4.19.12) (Deubiquitinating enzyme 2) (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2)	EBI-7792448	0.40
Q04500	U3 small nucleolar RNA-associated protein 14 (U3 snoRNA-associated protein 14) (U three protein 14)	EBI-7810284	0.40
P22936	Apurinic-apyrimidinic endonuclease 1 (AP endonuclease 1) (EC 3.1.21.-)	EBI-7900920	0.40
P36036	RNA annealing protein YRA2	EBI-8226241	0.22
P33307	Importin alpha re-exporter (Chromosome segregation protein CSE1)	EBI-1041382	0.57
P32562	Cell cycle serine/threonine-protein kinase CDC5/MSD2 (EC 2.7.11.21)	EBI-2112894	0.53
P06700	NAD-dependent histone deacetylase SIR2 (EC 2.3.1.286) (Regulatory protein SIR2) (Silent information regulator 2)	EBI-2212712	0.40
Q04087	Monopolin complex subunit LRS4 (Loss of rDNA silencing protein 4)	EBI-2212766	0.40
Q08904	Protein RDR1 (Repressor of drug resistance protein 1)	EBI-2344792	0.37
P53184	Nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) (NAMase)	EBI-2345292	0.37
P51601	GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I)	EBI-2345314	0.37
P25367	[PIN+] prion protein RNQ1 (Rich in asparagine and glutamine protein 1)	EBI-2345326	0.37
P08536	Sulfate adenylyltransferase (EC 2.7.7.4) (ATP-sulfurylase) (Methionine-requiring protein 3) (Sulfate adenylate transferase) (SAT)	EBI-2345887	0.37
Q03063	Down-regulator of invasive growth 1 (Regulator of STE12 protein 1) (Regulator of sterile twelve 1)	EBI-2345890	0.37
P17423	Homoserine kinase (HK) (HSK) (EC 2.7.1.39)	EBI-2345893	0.37
P60010	Actin (EC 3.6.4.-)	EBI-2346004	0.37
P38821	Aspartyl aminopeptidase 4 (EC 3.4.11.21)	EBI-2346115	0.37
Q02895	Putative aryl-alcohol dehydrogenase AAD16 (EC 1.1.1.-)	EBI-2346118	0.37
Q12306	Ubiquitin-like protein SMT3	EBI-2346577	0.37
Q06549	Cytidine deaminase (CDA) (EC 3.5.4.5) (Cytidine aminohydrolase)	EBI-2346610	0.37
P32318	Thiamine thiazole synthase (EC 2.4.2.60) (Thiazole biosynthetic enzyme)	EBI-2346619	0.37
P43619	Nicotinate-nucleotide pyrophosphorylase [carboxylating] (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) (QAPRTase)	EBI-2346747	0.37
Q03373	Down-regulator of invasive growth 2 (Regulator of STE12 protein 2) (Regulator of sterile twelve 2)	EBI-2346812	0.55
P09201	Fructose-1,6-bisphosphatase (FBPase) (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase)	EBI-2346852	0.37
Q12189	Ribose-5-phosphate isomerase (EC 5.3.1.6) (D-ribose-5-phosphate ketol-isomerase) (Phosphoriboisomerase)	EBI-2347997	0.37
P15202	Peroxisomal catalase A (EC 1.11.1.6)	EBI-2348000	0.37
P18759	Vesicular-fusion protein SEC18	EBI-2348009	0.37
P38716	Uncharacterized trans-sulfuration enzyme YHR112C	EBI-2348021	0.37
Q12206	Transcriptional modulator WTM2	EBI-2348042	0.37
P37366	Cyclin CCL1	EBI-2611238	0.35
P13365	G1/S-specific cyclin CLN3	EBI-2611665	0.35
P32350	Dual specificity protein kinase KNS1 (EC 2.7.12.1)	EBI-2612391	0.35
P40187	GSY2-interacting protein PIG2	EBI-2612903	0.35
P38089	Protein phosphatase 2C homolog 4 (PP2C-4) (EC 3.1.3.16)	EBI-2613131	0.35
Q12224	Transcription factor RLM1	EBI-2613375	0.35
P38255	Transcriptional regulatory protein RXT2	EBI-2613514	0.35
P32447	Histone chaperone ASF1 (Anti-silencing function protein 1) (yASF1)	EBI-2881693	0.00
Q12495	Chromatin assembly factor 1 subunit p90 (CAF-1 90 kDa subunit) (RAP1 localization factor 2)	EBI-16280136	0.53
Q02796	Transcriptional regulatory protein LGE1 (Large cells protein 1)	EBI-2885546	0.00
Q04116	Homeobox protein YHP1	EBI-2889029	0.00
P25303	DnaJ-related protein SCJ1 (J protein SCJ1)	EBI-3659819	0.35
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-3677844	0.35
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-3784104	0.35
P50875	Transcription factor SPT20	EBI-4376349	0.35
P50102	Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.4.19.12) (Deubiquitinating enzyme 8) (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8)	EBI-4380099	0.35
P38129	Transcription initiation factor TFIID subunit 5 (TAFII-90) (TBP-associated factor 5) (TBP-associated factor 90 kDa)	EBI-4380674	0.35
Q05027	Transcription initiation factor TFIID subunit 9 (TAFII-17) (TAFII20) (TBP-associated factor 17 kDa) (TBP-associated factor 9)	EBI-4382094	0.35
P35177	Transcriptional activator SPT7	EBI-4383599	0.35
Q03330	Histone acetyltransferase GCN5 (EC 2.3.1.48) (Histone crotonyltransferase GCN5) (EC 2.3.1.-)	EBI-4385804	0.35
P53131	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 (EC 3.6.4.13) (Helicase JA1)	EBI-10903607	0.35
O00635	E3 ubiquitin-protein ligase TRIM38 (EC 2.3.2.27) (RING finger protein 15) (Tripartite motif-containing protein 38) (Zinc finger protein RoRet)	EBI-11534408	0.56
Q7Z6G3	N-terminal EF-hand calcium-binding protein 2 (EF-hand calcium-binding protein 2) (Neuronal calcium-binding protein 2) (Synaptotagmin-interacting protein 2) (Stip-2)	EBI-11534397	0.56
A0A0C4DGF1	Zinc finger and BTB domain-containing protein 32	EBI-11534388	0.56
Q96A10	Endogenous retrovirus group K3 member 1 (HCG2043597, isoform CRA_b) (LOC113386 protein)	EBI-11534379	0.56
P60709	Actin, cytoplasmic 1 (EC 3.6.4.-) (Beta-actin) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed]	EBI-11534454	0.56
P35520	Cystathionine beta-synthase (EC 4.2.1.22) (Beta-thionase) (Serine sulfhydrase)	EBI-11534444	0.56
P22234	Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS) [Includes: Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC); Phosphoribosylaminoimidazole succinocarboxamide synthetase (EC 6.3.2.6) (SAICAR synthetase)]	EBI-11534435	0.56
P13196	5-aminolevulinate synthase, non-specific, mitochondrial (ALAS-H) (EC 2.3.1.37) (5-aminolevulinic acid synthase 1) (Delta-ALA synthase 1) (Delta-aminolevulinate synthase 1)	EBI-11534417	0.56
Q13557	Calcium/calmodulin-dependent protein kinase type II subunit delta (CaM kinase II subunit delta) (CaMK-II subunit delta) (EC 2.7.11.17)	EBI-11534487	0.56
P63261	Actin, cytoplasmic 2 (EC 3.6.4.-) (Gamma-actin) [Cleaved into: Actin, cytoplasmic 2, N-terminally processed]	EBI-11534464	0.56
Q9NS73	MAP3K12-binding inhibitory protein 1 (MAPK upstream kinase-binding inhibitory protein) (MUK-binding inhibitory protein)	EBI-11534541	0.56
Q9HAN9	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 (NMN/NaMN adenylyltransferase 1) (EC 2.7.7.1) (EC 2.7.7.18) (Nicotinamide-nucleotide adenylyltransferase 1) (NMN adenylyltransferase 1) (Nicotinate-nucleotide adenylyltransferase 1) (NaMN adenylyltransferase 1)	EBI-11534532	0.56
Q8WVF5	BTB/POZ domain-containing protein KCTD4	EBI-11534523	0.56
Q15041	ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL-6-interacting protein 1) (Aip-1) (Apoptotic regulator in the membrane of the endoplasmic reticulum)	EBI-11534514	0.56
Q15038	DAZ-associated protein 2 (Deleted in azoospermia-associated protein 2) (Proline-rich transcript in brain protein)	EBI-11534505	0.56
Q13867	Bleomycin hydrolase (BH) (BLM hydrolase) (BMH) (EC 3.4.22.40)	EBI-11534496	0.56
Q9NVV9	THAP domain-containing protein 1	EBI-11534559	0.56
P05221	Nucleoplasmin	EBI-16159838	0.56
P33322	H/ACA ribonucleoprotein complex subunit CBF5 (EC 5.4.99.-) (Centromere-binding factor 5) (Centromere/microtubule-binding protein CBF5) (H/ACA snoRNP protein CBF5) (Small nucleolar RNP protein CBF5) (p64')	EBI-16265066	0.35
P47027	DNA replication regulator DPB11	EBI-16268315	0.35
P34252	DNA replication regulator SLD2 (DNA replication and checkpoint protein 1)	EBI-16268369	0.35
P21268	Cyclin-dependent kinase inhibitor FAR1 (CKI FAR1) (Factor arrest protein)	EBI-16269078	0.35
P40316	Securin	EBI-16275395	0.35
P40348	Replication factor C subunit 2 (Replication factor C2) (Activator 1 41 kDa subunit)	EBI-16279429	0.35
Q12749	Structural maintenance of chromosomes protein 6 (DNA repair protein RHC18) (Rad18 homolog)	EBI-16279839	0.35
P22470	Protein SAN1	EBI-16281382	0.35
P11978	Regulatory protein SIR4 (Silent information regulator 4)	EBI-16282672	0.35
Q00916	U1 small nuclear ribonucleoprotein 70 kDa homolog (U1 70K) (U1 snRNP 70 kDa homolog) (U1-70K) (U1 small nuclear ribonucleoprotein SNP1) (U1 snRNP protein SNP1)	EBI-16283579	0.35
Q03010	Transcriptional regulatory protein UME1 (WD repeat-containing transcriptional modulator 3)	EBI-16284085	0.35
P38811	Transcription-associated protein 1 (p400 kDa component of SAGA)	EBI-16284085	0.35
P15019	Transaldolase (EC 2.2.1.2)	EBI-16284085	0.35
P0CS90	Import motor subunit, mitochondrial (EC 3.6.4.10) (Endonuclease SceI 75 kDa subunit) (Endo.SceI 75 kDa subunit) (mtHSP70)	EBI-16284085	0.35
Q03782	56 kDa U1 small nuclear ribonucleoprotein component	EBI-16284085	0.35
P38262	SIR4-interacting protein SIF2	EBI-16284085	0.35
P39954	Adenosylhomocysteinase (AdoHcyase) (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase)	EBI-16284085	0.35
Q02555	Ribonuclease 3 (EC 3.1.26.3) (Ribonuclease III) (RNase III)	EBI-16284085	0.35
P21538	DNA-binding protein REB1 (QBP)	EBI-16284085	0.35
P12709	Glucose-6-phosphate isomerase (GPI) (EC 5.3.1.9) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI)	EBI-16284085	0.35
P06169	Pyruvate decarboxylase isozyme 1 (EC 4.1.1.-) (EC 4.1.1.43) (EC 4.1.1.72) (EC 4.1.1.74) (Thiamine pyrophosphate-dependent 2-oxo-acid decarboxylase) (2ODC)	EBI-16284085	0.35
P29468	Poly(A) polymerase (PAP) (EC 2.7.7.19) (Polynucleotide adenylyltransferase)	EBI-16284085	0.35
Q00539	Protein NAM8 (Nuclear accommodation of mitochondria protein 8) (U1 snRNP component NAM8)	EBI-16284085	0.35
P33441	THO complex subunit MFT1 (Mitochondrial fusion target protein 1)	EBI-16284085	0.35
P05694	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (EC 2.1.1.14) (Cobalamin-independent methionine synthase) (Delta-P8 protein) (Methionine synthase, vitamin-B12 independent isozyme)	EBI-16284085	0.35
P00958	Methionine--tRNA ligase, cytoplasmic (EC 6.1.1.10) (Methionyl-tRNA synthetase) (MetRS)	EBI-16284085	0.35
P17629	THO complex subunit HPR1 (Hyperrecombination protein 1)	EBI-16284085	0.35
Q03532	ATP-dependent RNA helicase HAS1 (EC 3.6.4.13) (Helicase associated with SET1 protein 1)	EBI-16284085	0.35
Q07623	Nucleolar protein 6	EBI-16284085	0.35
P45976	Pre-mRNA polyadenylation factor FIP1	EBI-16284085	0.35
P14540	Fructose-bisphosphate aldolase (FBP aldolase) (FBPA) (EC 4.1.2.13) (Fructose-1,6-bisphosphate aldolase)	EBI-16284085	0.35
Q12432	Chromatin modification-related protein EAF3 (ESA1-associated factor 3)	EBI-16284085	0.35
P54115	Magnesium-activated aldehyde dehydrogenase, cytosolic (EC 1.2.1.-) (EC 1.2.1.4) (Mg(2+)-activated acetaldehyde dehydrogenase) (Mg(2+)-ACDH)	EBI-16284085	0.35
P19414	Aconitate hydratase, mitochondrial (Aconitase) (EC 4.2.1.3) (Citrate hydro-lyase)	EBI-16284085	0.35
Q12476	Protein AIR2 (Arginine methyltransferase-interacting RING finger protein 2)	EBI-16287516	0.35
Q07930	Pre-mRNA leakage protein 1	EBI-16290646	0.35
Q00416	Helicase SEN1 (EC 3.6.4.-) (tRNA-splicing endonuclease positive effector)	EBI-16421063	0.35

Cross-References

Database	Links
UNIPROT	Q02821 D6W0Z8
PDB	1BK5 1BK6 1EE4 1EE5 1UN0 1WA5 2C1T 4PVZ 4XZR 5H2W 5H2X 5T94
Pfam	PF00514 PF16186 PF01749
PROSITE	PS50176 PS51214

Importin subunit alpha (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Structure Viewer (PDB: 5H2X)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (12 interactors)

Interactions with other proteins (171 interactors)

Cross-References

Database

Links

Description

Description