Exocyst complex component 6 - Homo sapiens

Exocyst complex component 6 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Exocyst complex component 6
Accession Code	Q8TAG9
Gene	EXOC6
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 804)
MAENSESLGTVPEHERILQEIESTDTACVGPTLRSVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVE KLQLCLPVLEMYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQHQKTFSVSLQKQNKMKFGKNMYINRDRIPEERNETVL KHSLEEEDENEEEILTVQDLVDFSPVYRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLVL ELKNLTVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDIFEEDNYSPIPVVNEEEYKIVISKFPFQDPDLEKQSFPKKFPMSQSVPHIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKS TNLLLTRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINFLRSIFQVFTHL PGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKKNNIFAQFRKNDR DKQKLIETVVKQLRSLVNGMSQHM

Subcellular Location

Description
Cytoplasm {By SimilarityUniProtKB:O54923}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:O54923}. Cell projection, growth cone {By SimilarityUniProtKB:O54923}. Midbody, Midbody ring {ECO:0000269\|PubMed:16213214}. Note=Perinuclear in undifferentiated cells. Redistributes to growing neurites and growth cones during neuronal differentiation. Colocalizes with CNTRL/centriolin at the midbody ring (PubMed:16213214). {By SimilarityUniProtKB:O54923, ECO:0000269\|PubMed:16213214}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) Exocyst (GO:0000145) Flemming Body (GO:0090543) Growth Cone (GO:0030426) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane. Together with RAB11A, RAB3IP, RAB8A, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis (By similarity). {By Similarity}.
Assigned Ontology terms

Biological Process	Exocytosis (GO:0006887) Golgi To Plasma Membrane Transport (GO:0006893) Intracellular Protein Transport (GO:0006886) Membrane Fission (GO:0090148) Mitotic Cytokinesis (GO:0000281) Vesicle Docking Involved In Exocytosis (GO:0006904) Vesicle Tethering Involved In Exocytosis (GO:0090522)
Molecular Function

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (9 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O43542	DNA repair protein XRCC3	EBI-11129266	0.35
P0DTD1	2'-O-methyltransferase nsp16	EBI-26951880	0.49
P50148	Guanine nucleotide-binding protein G(q) subunit alpha	EBI-21673041	0.35
P62834	Ras-related protein Rap-1A	EBI-21673041	0.35
Q53GS7	mRNA export factor GLE1	EBI-25859244	0.56
Q8IYI6	Exocyst complex component 8	EBI-12450124	0.64
Q8TAG9	Self	EBI-3385859	0.37
Q9NV70	Exocyst complex component 1	EBI-12449995	0.51
O60645	Exocyst complex component 3	EBI-21673041	0.51
Interactions with other proteins (34 interactors)

Partner (UniProt)		IntAct	Confidence score
P02768	Albumin	EBI-1223494	0.35
Q9BQ95	Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial (Protein SITPEC)	EBI-3385759	0.37
P32119	Peroxiredoxin-2 (EC 1.11.1.24) (Natural killer cell-enhancing factor B) (NKEF-B) (PRP) (Thiol-specific antioxidant protein) (TSA) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thioredoxin-dependent peroxiredoxin 2)	EBI-3385854	0.37
Q96JB6	Lysyl oxidase homolog 4 (EC 1.4.3.-) (Lysyl oxidase-like protein 4) (Lysyl oxidase-related protein C)	EBI-3385849	0.37
Q92947	Glutaryl-CoA dehydrogenase, mitochondrial (GCD) (EC 1.3.8.6)	EBI-3385844	0.37
Q9Y3B2	Exosome complex component CSL4 (Exosome component 1)	EBI-3385839	0.37
P05067	Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31]	EBI-3385834	0.37
P29474	Nitric oxide synthase, endothelial (EC 1.14.13.39) (Constitutive NOS) (cNOS) (EC-NOS) (Endothelial NOS) (eNOS) (NOS type III) (NOSIII)	EBI-3385829	0.37
Q9Y2H9	Microtubule-associated serine/threonine-protein kinase 1 (EC 2.7.11.1) (Syntrophin-associated serine/threonine-protein kinase)	EBI-3385991	0.37
P49810	Presenilin-2 (PS-2) (EC 3.4.23.-) (AD3LP) (AD5) (E5-1) (STM-2) [Cleaved into: Presenilin-2 NTF subunit; Presenilin-2 CTF subunit]	EBI-3386181	0.37
Q96A65	Exocyst complex component 4 (Exocyst complex component Sec8)	EBI-10764425	0.73
P0DOE7	Matrix protein (M protein)	EBI-11327042	0.40
O00471	Exocyst complex component 5 (Exocyst complex component Sec10) (hSec10)	EBI-12450093	0.79
P61006	Ras-related protein Rab-8A (EC 3.6.5.2) (Oncogene c-mel)	EBI-12450124	0.51
Q9UPT5	Exocyst complex component 7 (Exocyst complex component Exo70)	EBI-12450124	0.51
Q96KP1	Exocyst complex component 2 (Exocyst complex component Sec5)	EBI-12450124	0.64
Q16891	MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89)	EBI-12450124	0.51
Q9Y2D4	Exocyst complex component 6B (Exocyst complex component Sec15B) (SEC15-like protein 2)	EBI-11923380	0.00
P32970	CD70 antigen (CD27 ligand) (CD27-L) (Tumor necrosis factor ligand superfamily member 7) (CD antigen CD70)	EBI-21512742	0.35
P35414	Apelin receptor (Angiotensin receptor-like 1) (G-protein coupled receptor APJ) (G-protein coupled receptor HG11)	EBI-21559824	0.35
P49146	Neuropeptide Y receptor type 2 (NPY2-R) (NPY-Y2 receptor) (Y2 receptor)	EBI-21569349	0.35
Q8N7X8	SIGLEC family-like protein 1	EBI-21585341	0.35
O75558	Syntaxin-11	EBI-21632742	0.35
Q96EV8	Dysbindin (Biogenesis of lysosome-related organelles complex 1 subunit 8) (BLOC-1 subunit 8) (Dysbindin-1) (Dystrobrevin-binding protein 1) (Hermansky-Pudlak syndrome 7 protein) (HPS7 protein)	EBI-21651992	0.35
P27930	Interleukin-1 receptor type 2 (IL-1R-2) (IL-1RT-2) (IL-1RT2) (CD121 antigen-like family member B) (CDw121b) (IL-1 type II receptor) (Interleukin-1 receptor beta) (IL-1R-beta) (Interleukin-1 receptor type II) (CD antigen CD121b) [Cleaved into: Interleukin-1 receptor type 2, membrane form (mIL-1R2) (mIL-1RII); Interleukin-1 receptor type 2, soluble form (sIL-1R2) (sIL-1RII)]	EBI-21662122	0.35
O60939	Sodium channel subunit beta-2	EBI-21671922	0.35
Q96LW7	Caspase recruitment domain-containing protein 19 (Bcl10-interacting CARD protein) (BinCARD)	EBI-21673041	0.35
Q5VIR6	Vacuolar protein sorting-associated protein 53 homolog	EBI-21673041	0.35
Q9H410	Kinetochore-associated protein DSN1 homolog	EBI-21673116	0.35
P08173	Muscarinic acetylcholine receptor M4	EBI-21707586	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
P0DTC5	Membrane protein (M) (E1 glycoprotein) (Matrix glycoprotein) (Membrane glycoprotein)	EBI-26495256	0.35
O43572	A-kinase anchor protein 10, mitochondrial (AKAP-10) (Dual specificity A kinase-anchoring protein 2) (D-AKAP-2) (Protein kinase A-anchoring protein 10) (PRKA10)	EBI-26451580	0.35
Q7Z699	Sprouty-related, EVH1 domain-containing protein 1 (Spred-1) (hSpred1)	EBI-25932191	0.56

Cross-References

Database	Links
UNIPROT	Q8TAG9 E9PHI3 Q5VXH8 Q9NZ24
Pfam	PF04091
OMIM	609672
DisGeNET	54536

Exocyst complex component 6 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (9 interactors)

Interactions with other proteins (34 interactors)

Cross-References

Database

Links

Description

Description