National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory
Protein Information |
|
|---|---|
| Protein Name | Regulator of nonsense transcripts 1 |
| Accession Code | Q92900 |
| Gene | UPF1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 1129) | |
|
MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGP EGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHL VRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLS WLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKL KESQTQDNITVRWDLGLNKKRIAYFTLPKTDSGNEDLVIIWLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGD EIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLP DLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSR EAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQ FRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALS AFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQ IGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYG VIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDR SSQGRPSSMYFQTHDQIGMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKGKTGRGGRQKNRFGLPG PSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQH GGVTGLSQY |
|
Structure Viewer (PDB: 2IYK) |
|---|
Description |
||
|---|---|---|
| Cytoplasm {Experimental EvidencePubMed:11163187}. Cytoplasm, P-body. Nucleus {Experimental EvidencePubMed:11163187, Experimental EvidencePubMed:18362360}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q9EPU0}. Note=Hyperphosphorylated form is targeted to the P-body, while unphosphorylated protein is distributed throughout the cytoplasm. Localized in the chromatoid bodies of round spermatids (By similarity). {ECO:0000250|UniProtKB:Q9EPU0}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Chromatin (GO:0000785) Chromosome, Telomeric Region (GO:0000781) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Exon-Exon Junction Complex (GO:0035145) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) P-Body (GO:0000932) Perinuclear Region Of Cytoplasm (GO:0048471) Supraspliceosomal Complex (GO:0044530) |
|
Description |
|
|---|---|
| RNA-dependent helicase required for nonsense-mediated decay (NMD) of aberrant mRNAs containing premature stop codons and modulates the expression level of normal mRNAs (PubMed:11163187, PubMed:16086026, PubMed:18172165, PubMed:21145460, PubMed:21419344, PubMed:24726324). Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation; its phosphorylation appears to be a key step in NMD (PubMed:11544179, PubMed:25220460). Recruited by release factors to stalled ribosomes together with the SMG1C protein kinase complex to form the transient SURF (SMG1-UPF1-eRF1-eRF3) complex (PubMed:19417104). In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) (located 50-55 or more nucleotides downstream from the termination codon) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD (PubMed:21419344). Phosphorylated UPF1 is recognized by EST1B/SMG5, SMG6 and SMG7 which are thought to provide a link to the mRNA degradation machinery involving exonucleolytic and endonucleolytic pathways, and to serve as adapters to protein phosphatase 2A (PP2A), thereby triggering UPF1 dephosphorylation and allowing the recycling of NMD factors (PubMed:12554878). UPF1 can also activate NMD without UPF2 or UPF3, and in the absence of the NMD-enhancing downstream EJC indicative for alternative NMD pathways (PubMed:18447585). Plays a role in replication-dependent histone mRNA degradation at the end of phase S; the function is independent of UPF2 (PubMed:16086026, PubMed:18172165). For the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed (PubMed:18447585, PubMed:25220460). The ATPase activity of UPF1 is required for disassembly of mRNPs undergoing NMD (PubMed:21145460). Together with UPF2 and dependent on TDRD6, mediates the degradation of mRNA harboring long 3'UTR by inducing the NMD machinery (By similarity). Also capable of unwinding double-stranded DNA and translocating on single-stranded DNA (PubMed:30218034). {By SimilarityUniProtKB:Q9EPU0, Experimental EvidencePubMed:11163187, Experimental EvidencePubMed:11544179, Experimental EvidencePubMed:12554878, Experimental EvidencePubMed:16086026, Experimental EvidencePubMed:18172165, Experimental EvidencePubMed:18447585, Experimental EvidencePubMed:19417104, Experimental EvidencePubMed:21145460, Experimental EvidencePubMed:21419344, Experimental EvidencePubMed:24726324, Experimental EvidencePubMed:25220460, Experimental EvidencePubMed:30218034}. | Assigned Ontology terms |
| Biological Process | 3'-UTR-Mediated MRNA Destabilization (GO:0061158) Cell Cycle Phase Transition (GO:0044770) Cellular Response To Interleukin-1 (GO:0071347) Cellular Response To Lipopolysaccharide (GO:0071222) DNA Duplex Unwinding (GO:0032508) DNA Repair (GO:0006281) DNA Replication (GO:0006260) Histone MRNA Catabolic Process (GO:0071044) MRNA Export From Nucleus (GO:0006406) Nuclear-Transcribed MRNA Catabolic Process (GO:0000956) Nuclear-Transcribed MRNA Catabolic Process, Endonucleolytic Cleavage-Dependent Decay (GO:0000294) Nuclear-Transcribed MRNA Catabolic Process, Nonsense-Mediated Decay (GO:0000184) Positive Regulation Of MRNA Catabolic Process (GO:0061014) Regulation Of Telomere Maintenance (GO:0032204) Regulation Of Translational Termination (GO:0006449) Telomere Maintenance Via Semi-Conservative Replication (GO:0032201) |
| Molecular Function | ATP Binding (GO:0005524) ATP Hydrolysis Activity (GO:0016887) Chromatin Binding (GO:0003682) Double-Stranded DNA Helicase Activity (GO:0036121) Helicase Activity (GO:0004386) Protein-Containing Complex Binding (GO:0044877) RNA Binding (GO:0003723) RNA Helicase Activity (GO:0003724) Telomeric DNA Binding (GO:0042162) Zinc Ion Binding (GO:0008270) |
Interactions with Nuclear Envelope proteins (9 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| Q9UI30 | Multifunctional methyltransferase subunit TRM112-like protein | EBI-374151 | 0.00 |
| Q9HAU5 | Regulator of nonsense transcripts 2 | EBI-536644 | 0.95 |
| Q92900 | Self | EBI-1013658 | 0.35 |
| Q99523 | Sortilin | EBI-11154667 | 0.35 |
| O15234 | Protein CASC3 | EBI-15784788 | 0.70 |
| Q92905 | COP9 signalosome complex subunit 5 | EBI-21325777 | 0.35 |
| Q14203 | Dynactin subunit 1 | EBI-11382201 | 0.27 |
| Q9UPY3 | Endoribonuclease Dicer | EBI-20621391 | 0.35 |
| Q9UBU9 | Nuclear RNA export factor 1 | EBI-3867844 | 0.35 | Interactions with other proteins (177 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| O95777 | U6 snRNA-associated Sm-like protein LSm8 | EBI-374478 | 0.00 |
| O77932 | Decapping and exoribonuclease protein (DXO) (EC 3.6.1.-) (5'-3' exoribonuclease DXO) (EC 3.1.13.-) (Dom-3 homolog Z) (NAD-capped RNA hydrolase DXO) (DeNADding enzyme DXO) (EC 3.6.1.-) | EBI-374506 | 0.00 |
| P54198 | Protein HIRA (TUP1-like enhancer of split protein 1) | EBI-374148 | 0.00 |
| Q96CS7 | Pleckstrin homology domain-containing family B member 2 (PH domain-containing family B member 2) (Evectin-2) | EBI-374154 | 0.00 |
| Q6IA69 | Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) (NAD(+) synthetase) | EBI-374157 | 0.00 |
| Q9NR19 | Acetyl-coenzyme A synthetase, cytoplasmic (EC 6.2.1.1) (Acetate--CoA ligase) (Acetyl-CoA synthetase) (ACS) (AceCS) (Acetyl-CoA synthetase 1) (AceCS1) (Acyl-CoA synthetase short-chain family member 2) (Acyl-activating enzyme) (Propionate--CoA ligase) (EC 6.2.1.17) | EBI-374160 | 0.00 |
| O95870 | Phosphatidylserine lipase ABHD16A (EC 3.1.-.-) (Alpha/beta hydrolase domain-containing protein 16A) (Abhydrolase domain-containing protein 16A) (HLA-B-associated transcript 5) (hBAT5) (Monoacylglycerol lipase ABHD16A) (EC 3.1.1.23) (Protein G5) | EBI-374163 | 0.00 |
| Q9BQY4 | Rhox homeobox family member 2 (Paired-like homeobox protein PEPP-2) (Testis homeobox gene 1) | EBI-374166 | 0.00 |
| Q5VT52 | Regulation of nuclear pre-mRNA domain-containing protein 2 | EBI-374169 | 0.00 |
| Q9UJJ9 | N-acetylglucosamine-1-phosphotransferase subunit gamma (GlcNAc-1-phosphotransferase subunit gamma) (UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma) | EBI-374172 | 0.00 |
| O95793 | Double-stranded RNA-binding protein Staufen homolog 1 | EBI-536589 | 0.71 |
| Q9BZI7 | Regulator of nonsense transcripts 3B (Nonsense mRNA reducing factor 3B) (Up-frameshift suppressor 3 homolog B) (hUpf3B) (Up-frameshift suppressor 3 homolog on chromosome X) (hUpf3p-X) | EBI-536644 | 0.85 |
| Q9NPI6 | mRNA-decapping enzyme 1A (EC 3.6.1.62) (Smad4-interacting transcriptional co-activator) (Transcription factor SMIF) | EBI-1006512 | 0.78 |
| Q8IU60 | m7GpppN-mRNA hydrolase (EC 3.6.1.62) (Nucleoside diphosphate-linked moiety X motif 20) (Nudix motif 20) (mRNA-decapping enzyme 2) (hDpc) | EBI-1006558 | 0.64 |
| Q6P2E9 | Enhancer of mRNA-decapping protein 4 (Autoantigen Ge-1) (Autoantigen RCD-8) (Human enhancer of decapping large subunit) (Hedls) | EBI-1006676 | 0.35 |
| Q96F86 | Enhancer of mRNA-decapping protein 3 (LSM16 homolog) (YjeF N-terminal domain-containing protein 2) (YjeF_N2) (hYjeF_N2) (YjeF domain-containing protein 1) | EBI-1006676 | 0.35 |
| Q9H1J1 | Regulator of nonsense transcripts 3A (Nonsense mRNA reducing factor 3A) (Up-frameshift suppressor 3 homolog A) (hUpf3) | EBI-1013658 | 0.56 |
| Q08491 | Superkiller protein 7 | EBI-1015023 | 0.40 |
| P63104 | 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1) | EBI-7196933 | 0.40 |
| Q92597 | Protein NDRG1 (Differentiation-related gene 1 protein) (DRG-1) (N-myc downstream-regulated gene 1 protein) (Nickel-specific induction protein Cap43) (Reducing agents and tunicamycin-responsive protein) (RTP) (Rit42) | EBI-1191079 | 0.40 |
| P02787 | Serotransferrin (Transferrin) (Beta-1 metal-binding globulin) (Siderophilin) | EBI-1221355 | 0.35 |
| Q9UL03 | Integrator complex subunit 6 (Int6) (DBI-1) (Protein DDX26) (Protein deleted in cancer 1) (DICE1) | EBI-7390665 | 0.40 |
| Q9UL18 | Protein argonaute-1 (Argonaute1) (hAgo1) (Argonaute RISC catalytic component 1) (Eukaryotic translation initiation factor 2C 1) (eIF-2C 1) (eIF2C 1) (Putative RNA-binding protein Q99) | EBI-7641372 | 0.35 |
| Q9UKV8 | Protein argonaute-2 (Argonaute2) (hAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF-2C 2) (eIF2C 2) (PAZ Piwi domain protein) (PPD) (Protein slicer) | EBI-7641372 | 0.35 |
| P62495 | Eukaryotic peptide chain release factor subunit 1 (Eukaryotic release factor 1) (eRF1) (Protein Cl1) (TB3-1) | EBI-7801134 | 0.35 |
| P15170 | Eukaryotic peptide chain release factor GTP-binding subunit ERF3A (Eukaryotic peptide chain release factor subunit 3a) (eRF3a) (G1 to S phase transition protein 1 homolog) | EBI-7801176 | 0.40 |
| Q96Q15 | Serine/threonine-protein kinase SMG1 (SMG-1) (hSMG-1) (EC 2.7.11.1) (Lambda/iota protein kinase C-interacting protein) (Lambda-interacting protein) (Nonsense mediated mRNA decay-associated PI3K-related kinase SMG1) | EBI-7801538 | 0.76 |
| P38919 | Eukaryotic initiation factor 4A-III (eIF-4A-III) (eIF4A-III) (EC 3.6.4.13) (ATP-dependent RNA helicase DDX48) (ATP-dependent RNA helicase eIF4A-3) (DEAD box protein 48) (Eukaryotic initiation factor 4A-like NUK-34) (Eukaryotic translation initiation factor 4A isoform 3) (Nuclear matrix protein 265) (NMP 265) (hNMP 265) [Cleaved into: Eukaryotic initiation factor 4A-III, N-terminally processed] | EBI-1776452 | 0.73 |
| Q13868 | Exosome complex component RRP4 (Exosome component 2) (Ribosomal RNA-processing protein 4) | EBI-1776452 | 0.35 |
| Q8IZH2 | 5'-3' exoribonuclease 1 (EC 3.1.13.-) (Strand-exchange protein 1 homolog) | EBI-1776452 | 0.53 |
| O00303 | Eukaryotic translation initiation factor 3 subunit F (eIF3f) (Deubiquitinating enzyme eIF3f) (EC 3.4.19.12) (Eukaryotic translation initiation factor 3 subunit 5) (eIF-3-epsilon) (eIF3 p47) | EBI-1776488 | 0.35 |
| Q14152 | Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 subunit 10) (eIF-3-theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) | EBI-1776488 | 0.62 |
| Q9BY44 | Eukaryotic translation initiation factor 2A (eIF-2A) (65 kDa eukaryotic translation initiation factor 2A) [Cleaved into: Eukaryotic translation initiation factor 2A, N-terminally processed] | EBI-1776650 | 0.35 |
| P55884 | Eukaryotic translation initiation factor 3 subunit B (eIF3b) (Eukaryotic translation initiation factor 3 subunit 9) (Prt1 homolog) (hPrt1) (eIF-3-eta) (eIF3 p110) (eIF3 p116) | EBI-1776650 | 0.35 |
| P20042 | Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 subunit beta) (eIF-2-beta) | EBI-1780552 | 0.35 |
| Q7ARD3 | Transcriptional regulator | EBI-2856375 | 0.00 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-2878124 | 0.35 |
| Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | EBI-7950968 | 0.35 |
| Q99459 | Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein) | EBI-7954144 | 0.35 |
| P11940 | Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1) | EBI-3903950 | 0.53 |
| Q86US8 | Telomerase-binding protein EST1A (EC 3.1.-.-) (Ever shorter telomeres 1A) (hEST1A) (Nonsense mediated mRNA decay factor SMG6) (Smg-6 homolog) (hSmg5/7a) | EBI-3400857 | 0.50 |
| Q92540 | Nonsense-mediated mRNA decay factor SMG7 (SMG-7 homolog) (hSMG-7) | EBI-3400857 | 0.53 |
| Q9UPR3 | Nonsense-mediated mRNA decay factor SMG5 (EST1-like protein B) (LPTS-RP1) (LPTS-interacting protein) (SMG-5 homolog) (hSMG-5) | EBI-3400857 | 0.50 |
| Q9Y5S9 | RNA-binding protein 8A (Binder of OVCA1-1) (BOV-1) (RNA-binding motif protein 8A) (RNA-binding protein Y14) (Ribonucleoprotein RBM8A) | EBI-3867797 | 0.64 |
| Q15287 | RNA-binding protein with serine-rich domain 1 (SR-related protein LDC2) | EBI-3867801 | 0.35 |
| Q8IYB3 | Serine/arginine repetitive matrix protein 1 (SR-related nuclear matrix protein of 160 kDa) (SRm160) (Ser/Arg-related nuclear matrix protein) | EBI-3867832 | 0.35 |
| Q86V81 | THO complex subunit 4 (Tho4) (Ally of AML-1 and LEF-1) (Aly/REF export factor) (Transcriptional coactivator Aly/REF) (bZIP-enhancing factor BEF) | EBI-3867856 | 0.35 |
| P35659 | Protein DEK | EBI-3869271 | 0.40 |
| Q8IYD1 | Eukaryotic peptide chain release factor GTP-binding subunit ERF3B (Eukaryotic peptide chain release factor subunit 3b) (eRF3b) (G1 to S phase transition protein 2 homolog) | EBI-3869636 | 0.58 |
| Q149F3 | Eukaryotic peptide chain release factor GTP-binding subunit ERF3B (Eukaryotic peptide chain release factor subunit 3b) (eRF3b) (G1 to S phase transition protein 2 homolog) | EBI-3870213 | 0.40 |
| Q12796 | Proline-rich nuclear receptor coactivator 1 (Proline-rich protein 2) (Protein B4-2) | EBI-3903305 | 0.37 |
| Q9NPJ4 | Proline-rich nuclear receptor coactivator 2 | EBI-3903302 | 0.62 |
| P26196 | Probable ATP-dependent RNA helicase DDX6 (EC 3.6.4.13) (ATP-dependent RNA helicase p54) (DEAD box protein 6) (Oncogene RCK) | EBI-4302807 | 0.27 |
| P62913 | 60S ribosomal protein L11 (CLL-associated antigen KW-12) (Large ribosomal subunit protein uL5) | EBI-3903945 | 0.35 |
| P13639 | Elongation factor 2 (EF-2) | EBI-3903945 | 0.35 |
| P52298 | Nuclear cap-binding protein subunit 2 (20 kDa nuclear cap-binding protein) (Cell proliferation-inducing gene 55 protein) (NCBP 20 kDa subunit) (CBP20) (NCBP-interacting protein 1) (NIP1) | EBI-3903950 | 0.53 |
| Q09161 | Nuclear cap-binding protein subunit 1 (80 kDa nuclear cap-binding protein) (CBP80) (NCBP 80 kDa subunit) | EBI-3903950 | 0.69 |
| P62424 | 60S ribosomal protein L7a (Large ribosomal subunit protein eL8) (PLA-X polypeptide) (Surfeit locus protein 3) | EBI-3903973 | 0.35 |
| P62753 | 40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6) | EBI-3903973 | 0.35 |
| Q8ND04 | Nonsense-mediated mRNA decay factor SMG8 (Amplified in breast cancer gene 2 protein) (Protein smg-8 homolog) | EBI-3903928 | 0.35 |
| Q9H0W8 | Nonsense-mediated mRNA decay factor SMG9 | EBI-3903928 | 0.35 |
| P23396 | 40S ribosomal protein S3 (EC 4.2.99.18) (Small ribosomal subunit protein uS3) | EBI-3903935 | 0.35 |
| P67870 | Casein kinase II subunit beta (CK II beta) (Phosvitin) (Protein G5a) | EBI-7137830 | 0.37 |
| O14746 | Telomerase reverse transcriptase (EC 2.7.7.49) (HEST2) (Telomerase catalytic subunit) (Telomerase-associated protein 2) (TP2) | EBI-7068109 | 0.52 |
| Q96AP0 | Adrenocortical dysplasia protein homolog (POT1 and TIN2-interacting protein) | EBI-7068137 | 0.52 |
| Q6QDQ4 | Nucleoprotein (Nucleocapsid protein) | EBI-5276631 | 0.35 |
| O95758 | Polypyrimidine tract-binding protein 3 (Regulator of differentiation 1) (Rod1) | EBI-7850130 | 0.35 |
| P03496 | Non-structural protein 1 (NS1) (NS1A) | EBI-6154589 | 0.53 |
| O56264 | Non-structural protein 1 (NS1) (NS1A) | EBI-6157161 | 0.35 |
| P19320 | Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106) | EBI-6189915 | 0.35 |
| Q86VP6 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-21322532 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| Q93034 | Cullin-5 (CUL-5) (Vasopressin-activated calcium-mobilizing receptor 1) (VACM-1) | EBI-21331078 | 0.35 |
| Q4VGL6 | Roquin-1 (Roquin) (EC 2.3.2.27) (Protein Sanroque) (RING finger and C3H zinc finger protein 1) (RING finger and CCCH-type zinc finger domain-containing protein 1) | EBI-8759371 | 0.35 |
| P0C090 | Roquin-2 (EC 2.3.2.27) (Membrane-associated nucleic acid-binding protein) (RING finger and CCCH-type zinc finger domain-containing protein 2) (RING-type E3 ubiquitin transferase Roquin-2) | EBI-8759987 | 0.35 |
| O75164 | Lysine-specific demethylase 4A (EC 1.14.11.66) (EC 1.14.11.69) (JmjC domain-containing histone demethylation protein 3A) (Jumonji domain-containing protein 2A) ([histone H3]-trimethyl-L-lysine(36) demethylase 4A) ([histone H3]-trimethyl-L-lysine(9) demethylase 4A) | EBI-8793243 | 0.35 |
| Q9UN81 | LINE-1 retrotransposable element ORF1 protein (L1ORF1p) (LINE retrotransposable element 1) (LINE1 retrotransposable element 1) | EBI-8874497 | 0.58 |
| Q8TE30 | RNA-directed DNA polymerase (EC 2.7.7.49) | EBI-8875022 | 0.35 |
| Q16543 | Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed] | EBI-9393294 | 0.35 |
| P67809 | Y-box-binding protein 1 (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor) | EBI-9985228 | 0.35 |
| Q16666 | Gamma-interferon-inducible protein 16 (Ifi-16) (Interferon-inducible myeloid differentiation transcriptional activator) | EBI-9995438 | 0.35 |
| O14862 | Interferon-inducible protein AIM2 (Absent in melanoma 2) | EBI-9995694 | 0.35 |
| P41218 | Myeloid cell nuclear differentiation antigen | EBI-9996028 | 0.35 |
| P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11324725 | 0.35 |
| P03211 | Epstein-Barr nuclear antigen 1 (EBNA-1) (EBV nuclear antigen 1) | EBI-11722110 | 0.35 |
| Q6VGS8 | 14.3 kDa protein (Control protein E4orf1) (E4 orf 1) | EBI-11733617 | 0.35 |
| Q9NZN8 | CCR4-NOT transcription complex subunit 2 (CCR4-associated factor 2) | EBI-11026348 | 0.35 |
| Q6ZQ29 | Serine/threonine-protein kinase TAO2 (EC 2.7.11.1) (Thousand and one amino acid protein 2) | EBI-11075869 | 0.35 |
| P70372 | ELAV-like protein 1 (Elav-like generic protein) (Hu-antigen R) (HuR) (MelG) | EBI-11075952 | 0.35 |
| P54368 | Ornithine decarboxylase antizyme 1 (AZ1) (ODC-Az) | EBI-11123446 | 0.35 |
| Q9Z172 | Small ubiquitin-related modifier 3 (SUMO-3) (SMT3 homolog 1) (Ubiquitin-like protein SMT3A) (Smt3A) | EBI-11157923 | 0.35 |
| Q6SPF0 | Sterile alpha motif domain-containing protein 1 (SAM domain-containing protein 1) (Atherin) | EBI-11160311 | 0.35 |
| P19712 | Genome polyprotein [Cleaved into: N-terminal protease (N-pro) (EC 3.4.22.-) (Autoprotease p20); Capsid protein C (Core protein); E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); Viroporin p7; Non-structural protein 2-3 (NS2-3); Cysteine protease NS2 (EC 3.4.22.-) (Non-structural protein 2); Serine protease NS3 (EC 3.4.21.113) (EC 3.6.1.15) (EC 3.6.4.13) (Non-structural protein 3); Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); Non-structural protein 5A (NS5A); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B)] | EBI-10901375 | 0.35 |
| Q7Z7A1 | Centriolin (Centrosomal protein 1) (Centrosomal protein of 110 kDa) (Cep110) | EBI-11371427 | 0.27 |
| Q8N4C6 | Ninein (hNinein) (Glycogen synthase kinase 3 beta-interacting protein) (GSK3B-interacting protein) | EBI-11374469 | 0.27 |
| Q96NL6 | Sodium channel and clathrin linker 1 (Sodium channel-associated protein 1) | EBI-11376636 | 0.27 |
| O60308 | Centrosomal protein of 104 kDa (Cep104) | EBI-11380299 | 0.27 |
| Q15468 | SCL-interrupting locus protein (TAL-1-interrupting locus protein) | EBI-11383475 | 0.27 |
| Q5SW79 | Centrosomal protein of 170 kDa (Cep170) (KARP-1-binding protein) (KARP1-binding protein) | EBI-11385552 | 0.27 |
| Q5TB80 | Centrosomal protein of 162 kDa (Cep162) (Protein QN1 homolog) | EBI-11385924 | 0.27 |
| Q68CZ1 | Protein fantom (Nephrocystin-8) (RPGR-interacting protein 1-like protein) (RPGRIP1-like protein) | EBI-11386978 | 0.27 |
| Q96LK0 | Centrosomal protein of 19 kDa (Cep19) | EBI-11395817 | 0.27 |
| Q6P5F9 | Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog) | EBI-11603310 | 0.35 |
| Q13509 | Tubulin beta-3 chain (Tubulin beta-4 chain) (Tubulin beta-III) | EBI-11897134 | 0.35 |
| Q71U36 | Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain] | EBI-11897791 | 0.35 |
| P03466 | Nucleoprotein (Nucleocapsid protein) (Protein N) | EBI-12577908 | 0.35 |
| I6TAH8 | Nucleoprotein (Nucleocapsid protein) (Protein N) | EBI-12580639 | 0.35 |
| Q5EP28 | Nucleoprotein (Nucleocapsid protein) (Protein N) | EBI-12582318 | 0.35 |
| C5E522 | Nucleoprotein (Nucleocapsid protein) (Protein N) | EBI-12583659 | 0.35 |
| C5E524 | Non-structural protein 1 (NS1) | EBI-12584088 | 0.35 |
| Q1K9H2 | Nucleoprotein (Nucleocapsid protein) (Protein N) | EBI-12586510 | 0.35 |
| P56945 | Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas) | EBI-15099687 | 0.35 |
| O95478 | Ribosome biogenesis protein NSA2 homolog (Hairy cell leukemia protein 1) (TGF-beta-inducible nuclear protein 1) | EBI-21528968 | 0.35 |
| Q9GZY0 | Nuclear RNA export factor 2 (Cancer/testis antigen 39) (CT39) (TAP-like protein 2) (TAPL-2) | EBI-21528397 | 0.35 |
| P16104 | Histone H2AX (H2a/x) (Histone H2A.X) | EBI-21578956 | 0.35 |
| P22492 | Histone H1t (Testicular H1 histone) | EBI-21580683 | 0.35 |
| P47902 | Homeobox protein CDX-1 (Caudal-type homeobox protein 1) | EBI-21581572 | 0.35 |
| P08621 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | EBI-21606424 | 0.35 |
| O60293 | Zinc finger C3H1 domain-containing protein (Coiled-coil domain-containing protein 131) (Proline/serine-rich coiled-coil protein 2) | EBI-21634559 | 0.35 |
| P55075 | Fibroblast growth factor 8 (FGF-8) (Androgen-induced growth factor) (AIGF) (Heparin-binding growth factor 8) (HBGF-8) | EBI-21635166 | 0.35 |
| Q8IXZ2 | Zinc finger CCCH domain-containing protein 3 (Smad-interacting CPSF-like factor) | EBI-21635987 | 0.35 |
| Q12905 | Interleukin enhancer-binding factor 2 (Nuclear factor of activated T-cells 45 kDa) | EBI-21665924 | 0.35 |
| P10412 | Histone H1.4 (Histone H1b) (Histone H1s-4) | EBI-21665473 | 0.35 |
| Q12926 | ELAV-like protein 2 (ELAV-like neuronal protein 1) (Hu-antigen B) (HuB) (Nervous system-specific RNA-binding protein Hel-N1) | EBI-21666158 | 0.35 |
| Q96AK3 | DNA dC->dU-editing enzyme APOBEC-3D (A3D) (A3DE) (EC 3.5.4.38) | EBI-21666867 | 0.35 |
| Q9NQ55 | Suppressor of SWI4 1 homolog (Ssf-1) (Brix domain-containing protein 3) (Peter Pan homolog) | EBI-21667205 | 0.35 |
| Q7Z2W4 | Zinc finger CCCH-type antiviral protein 1 (ADP-ribosyltransferase diphtheria toxin-like 13) (ARTD13) (Inactive Poly [ADP-ribose] polymerase 13) (PARP13) (Zinc finger CCCH domain-containing protein 2) (Zinc finger antiviral protein) (ZAP) | EBI-21679163 | 0.35 |
| Q8WYQ5 | Microprocessor complex subunit DGCR8 (DiGeorge syndrome critical region 8) | EBI-21679517 | 0.35 |
| Q13595 | Transformer-2 protein homolog alpha (TRA-2 alpha) (TRA2-alpha) (Transformer-2 protein homolog A) | EBI-21690239 | 0.35 |
| Q9NQX1 | PR domain zinc finger protein 5 (EC 2.1.1.-) (PR domain-containing protein 5) | EBI-21728580 | 0.35 |
| Q96HE9 | Proline-rich protein 11 | EBI-21733724 | 0.35 |
| B0UZZ8 | Chromosome 6 open reading frame 11 (WD repeat domain 46, isoform CRA_d) (cDNA, FLJ96697) | EBI-21740634 | 0.35 |
| Q02539 | Histone H1.1 (Histone H1a) | EBI-21742951 | 0.35 |
| Q9BYG3 | MKI67 FHA domain-interacting nucleolar phosphoprotein (Nucleolar phosphoprotein Nopp34) (Nucleolar protein interacting with the FHA domain of pKI-67) (hNIFK) | EBI-21743958 | 0.35 |
| Q9NZM5 | Ribosome biogenesis protein NOP53 (Glioma tumor suppressor candidate region gene 2 protein) (Protein interacting with carboxyl terminus 1) (PICT-1) (p60) | EBI-21744295 | 0.35 |
| Q66K89 | Transcription factor E4F1 (EC 2.3.2.27) (E4F transcription factor 1) (Putative E3 ubiquitin-protein ligase E4F1) (RING-type E3 ubiquitin transferase E4F1) (Transcription factor E4F) (p120E4F) (p50E4F) | EBI-21745571 | 0.35 |
| P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed] | EBI-21752216 | 0.35 |
| Q96SI9 | Spermatid perinuclear RNA-binding protein | EBI-21752787 | 0.35 |
| Q86VM9 | Zinc finger CCCH domain-containing protein 18 (Nuclear protein NHN1) | EBI-21769401 | 0.35 |
| Q02878 | 60S ribosomal protein L6 (Large ribosomal subunit protein eL6) (Neoplasm-related protein C140) (Tax-responsive enhancer element-binding protein 107) (TaxREB107) | EBI-21778758 | 0.35 |
| Q8TBF4 | Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (U11/U12 small nuclear ribonucleoprotein 31 kDa protein) (U11/U12 snRNP 31 kDa protein) (U11/U12-31K) | EBI-21780331 | 0.35 |
| Q9H9Y2 | Ribosome production factor 1 (Brix domain-containing protein 5) (Ribosome biogenesis protein RPF1) | EBI-21794281 | 0.35 |
| Q9H609 | Zinc finger protein 576 | EBI-21821387 | 0.35 |
| Q9Y316 | Protein MEMO1 (C21orf19-like protein) (Hepatitis C virus NS5A-transactivated protein 7) (HCV NS5A-transactivated protein 7) (Mediator of ErbB2-driven cell motility 1) (Mediator of cell motility 1) (Memo-1) | EBI-21887469 | 0.35 |
| Q14493 | Histone RNA hairpin-binding protein (Histone stem-loop-binding protein) | EBI-15555844 | 0.50 |
| P61326 | Protein mago nashi homolog | EBI-15674190 | 0.35 |
| P55265 | Double-stranded RNA-specific adenosine deaminase (DRADA) (EC 3.5.4.37) (136 kDa double-stranded RNA-binding protein) (p136) (Interferon-inducible protein 4) (IFI-4) (K88DSRBP) | EBI-15694802 | 0.52 |
| Q9BTM9 | Ubiquitin-related modifier 1 | EBI-15902685 | 0.35 |
| P06730 | Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (eIF-4F 25 kDa subunit) (mRNA cap-binding protein) | EBI-16057922 | 0.46 |
| Q86U42 | Polyadenylate-binding protein 2 (PABP-2) (Poly(A)-binding protein 2) (Nuclear poly(A)-binding protein 1) (Poly(A)-binding protein II) (PABII) (Polyadenylate-binding nuclear protein 1) | EBI-16058014 | 0.35 |
| Q6ZNJ1 | Neurobeachin-like protein 2 | EBI-16749633 | 0.35 |
| P22087 | rRNA 2'-O-methyltransferase fibrillarin (EC 2.1.1.-) (34 kDa nucleolar scleroderma antigen) (Histone-glutamine methyltransferase) (U6 snRNA 2'-O-methyltransferase fibrillarin) | EBI-16792282 | 0.42 |
| P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | EBI-20799352 | 0.35 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-21360986 | 0.35 |
| Q9BZR8 | Apoptosis facilitator Bcl-2-like protein 14 (Bcl2-L-14) (Apoptosis regulator Bcl-G) | EBI-21258469 | 0.35 |
| Q15646 | 2'-5'-oligoadenylate synthase-like protein (2'-5'-OAS-related protein) (2'-5'-OAS-RP) (59 kDa 2'-5'-oligoadenylate synthase-like protein) (Thyroid receptor-interacting protein 14) (TR-interacting protein 14) (TRIP-14) (p59 OASL) (p59OASL) | EBI-21262435 | 0.35 |
| Q15139 | Serine/threonine-protein kinase D1 (EC 2.7.11.13) (Protein kinase C mu type) (Protein kinase D) (nPKC-D1) (nPKC-mu) | EBI-25395029 | 0.35 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| P0DTC9 | Nucleoprotein (N) (Nucleocapsid protein) (NC) (Protein N) | EBI-25490574 | 0.64 |
| Q9C0B5 | Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375) | EBI-25636144 | 0.35 |
| Q53F19 | Nuclear cap-binding protein subunit 3 (Protein ELG) | EBI-26396827 | 0.35 |
| Q96LU5 | Mitochondrial inner membrane protease subunit 1 (EC 3.4.21.-) (IMP1-like protein) | EBI-27050332 | 0.35 |
| Q96T52 | Mitochondrial inner membrane protease subunit 2 (EC 3.4.21.-) (IMP2-like protein) | EBI-27050444 | 0.35 |
| P05154 | Plasma serine protease inhibitor (Acrosomal serine protease inhibitor) (Plasminogen activator inhibitor 3) (PAI-3) (PAI3) (Protein C inhibitor) (PCI) (Serpin A5) | EBI-27038496 | 0.35 |
| Q13363 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) | EBI-27044482 | 0.35 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27108918 | 0.35 |
| Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | EBI-27111302 | 0.35 |
| Q9HCE1 | Helicase MOV-10 (EC 3.6.4.13) (Armitage homolog) (Moloney leukemia virus 10 protein) | EBI-27090881 | 0.35 |
| K0BVN3 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | EBI-27090881 | 0.35 |
| Q99592 | Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171) | EBI-27093179 | 0.35 |
| Q92630 | Dual specificity tyrosine-phosphorylation-regulated kinase 2 (EC 2.7.12.1) | EBI-28952324 | 0.27 |
| Q8NCK7 | Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11) | EBI-27105115 | 0.35 |
| Q9BZB8 | Cytoplasmic polyadenylation element-binding protein 1 (CPE-BP1) (CPE-binding protein 1) (h-CPEB) (hCPEB-1) | EBI-29019560 | 0.42 |
| O43474 | Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor) | EBI-29020028 | 0.35 |
| O60248 | Protein SOX-15 (Protein SOX-12) (Protein SOX-20) | EBI-29371942 | 0.35 |
| P48431 | Transcription factor SOX-2 | EBI-29721059 | 0.27 |
Database | Links |
| UNIPROT | Q92900 O00239 O43343 Q86Z25 Q92842 |
| PDB | 2GJK 2GK6 2GK7 2IYK 2WJV 2WJY 2XZO 2XZP 6EJ5 6Z3R |
| Pfam | PF13086 PF13087 PF04851 PF18141 PF09416 |
| PROSITE | PS51997 |
| OMIM | 601430 |
| DisGeNET | 5976 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory