Protein Information |
|
---|---|
Protein Name | Hypoxia-inducible factor 1-alpha inhibitor |
Accession Code | Q9NWT6 |
Gene | HIF1AN |
Organism | Homo sapiens | Human (Taxonomy: 9606) |
Part of Reference Proteome? | Yes |
Sequence (Length: 349) | |
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEY LQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVM DFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQS QVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMR NIEKMLGEALGNPQEVGPLLNTMIKGRYN |
Structure Viewer (PDB: 6H9J) |
---|
Description |
||
---|---|---|
Nucleus. Cytoplasm. Cytoplasm, perinuclear region. Note=Mainly cytoplasmic localization, but interaction with NOTCH1 results in nuclear localization and interaction with ABPA3 results in perinuclear localization in macrophages. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
Topology | Source | Annotation Type |
Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) Nucleoplasm (GO:0005654) Perinuclear Region Of Cytoplasm (GO:0048471) |
Interactions with Nuclear Envelope proteins (10 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | EBI-8565753 | 0.78 |
P58546 | Myotrophin | EBI-15602804 | 0.44 |
Q86UE4 | Protein LYRIC | EBI-16813719 | 0.35 |
Q8WXH0 | Nesprin-2 | EBI-12502476 | 0.35 |
Q9H4L5 | Oxysterol-binding protein-related protein 3 | EBI-21638930 | 0.35 |
Q9NUQ3 | Gamma-taxilin | EBI-21638930 | 0.35 |
Q9P0L0 | Vesicle-associated membrane protein-associated protein A | EBI-12502476 | 0.35 |
O96018 | Amyloid-beta A4 precursor protein-binding family A member 3 | EBI-15099018 | 0.75 |
O75190 | DnaJ homolog subfamily B member 6 | EBI-12502476 | 0.35 |
Q06787 | Fragile X messenger ribonucleoprotein 1 | EBI-12502476 | 0.35 | Interactions with other proteins (204 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
Q96DX5 | Ankyrin repeat and SOCS box protein 9 (ASB-9) | EBI-754615 | 0.78 |
Q8WXK3 | Ankyrin repeat and SOCS box protein 13 (ASB-13) | EBI-755812 | 0.55 |
Q9Y283 | Inversin (Inversion of embryo turning homolog) (Nephrocystin-2) | EBI-759370 | 0.64 |
Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | EBI-1035055 | 0.92 |
Q6GQQ9 | OTU domain-containing protein 7B (EC 3.4.19.12) (Cellular zinc finger anti-NF-kappa-B protein) (Cezanne) (Zinc finger A20 domain-containing protein 1) (Zinc finger protein Cezanne) | EBI-2510717 | 0.56 |
Q9H2K2 | Poly [ADP-ribose] polymerase tankyrase-2 (EC 2.4.2.30) (ADP-ribosyltransferase diphtheria toxin-like 6) (ARTD6) (Poly [ADP-ribose] polymerase 5B) (Protein poly-ADP-ribosyltransferase tankyrase-2) (EC 2.4.2.-) (TNKS-2) (TRF1-interacting ankyrin-related ADP-ribose polymerase 2) (Tankyrase II) (Tankyrase-2) (TANK2) (Tankyrase-like protein) (Tankyrase-related protein) | EBI-8565642 | 0.74 |
Q8TAK5 | GA-binding protein subunit beta-2 (GABP subunit beta-2) (GABPB-2) | EBI-8565789 | 0.44 |
Q9HBA0 | Transient receptor potential cation channel subfamily V member 4 (TrpV4) (Osm-9-like TRP channel 4) (OTRPC4) (Transient receptor potential protein 12) (TRP12) (Vanilloid receptor-like channel 2) (Vanilloid receptor-like protein 2) (VRL-2) (Vanilloid receptor-related osmotically-activated channel) (VR-OAC) | EBI-8565771 | 0.44 |
Q8IY67 | Ribonucleoprotein PTB-binding 1 (Protein raver-1) | EBI-12502476 | 0.35 |
P54132 | RecQ-like DNA helicase BLM (EC 3.6.4.12) (Bloom syndrome protein) (DNA helicase, RecQ-like type 2) (RecQ2) (RecQ protein-like 3) | EBI-12502476 | 0.35 |
Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C (PP6-ARS-C) (Serine/threonine-protein phosphatase 6 regulatory subunit ARS-C) (Ankyrin repeat domain-containing protein 52) | EBI-12502476 | 0.64 |
Q05823 | 2-5A-dependent ribonuclease (2-5A-dependent RNase) (EC 3.1.26.-) (Ribonuclease 4) (Ribonuclease L) (RNase L) | EBI-12502476 | 0.79 |
Q9NVH0 | Exonuclease 3'-5' domain-containing protein 2 (EC 3.1.11.1) (3'-5' exoribonuclease EXD2) (EC 3.1.13.-) (Exonuclease 3'-5' domain-like-containing protein 2) | EBI-12502476 | 0.35 |
Q9NWX5 | Ankyrin repeat and SOCS box protein 6 (ASB-6) | EBI-12502476 | 0.53 |
Q68DC2 | Ankyrin repeat and SAM domain-containing protein 6 (Ankyrin repeat domain-containing protein 14) (SamCystin) (Sterile alpha motif domain-containing protein 6) (SAM domain-containing protein 6) | EBI-12502476 | 0.35 |
Q9NU02 | Ankyrin repeat and EF-hand domain-containing protein 1 (Ankyrin repeat domain-containing protein 5) | EBI-12502476 | 0.35 |
O95218 | Zinc finger Ran-binding domain-containing protein 2 (Zinc finger protein 265) (Zinc finger, splicing) | EBI-12502476 | 0.35 |
Q969S3 | Cytoplasmic 60S subunit biogenesis factor ZNF622 (Zinc finger protein 622) (Zinc finger-like protein 9) | EBI-12502476 | 0.35 |
Q8N5A5 | Zinc finger CCCH-type with G patch domain-containing protein (G patch domain-containing protein 6) (Zinc finger CCCH domain-containing protein 9) (Zinc finger and G patch domain-containing protein) | EBI-12502476 | 0.35 |
Q9NUD5 | Zinc finger CCHC domain-containing protein 3 | EBI-12502476 | 0.35 |
Q8WYQ9 | Zinc finger CCHC domain-containing protein 14 (BDG-29) | EBI-12502476 | 0.35 |
Q86T24 | Transcriptional regulator Kaiso (Zinc finger and BTB domain-containing protein 33) | EBI-12502476 | 0.35 |
Q9BQA1 | Methylosome protein 50 (MEP-50) (Androgen receptor cofactor p44) (WD repeat-containing protein 77) (p44/Mep50) | EBI-12502476 | 0.35 |
Q96MT7 | Cilia- and flagella-associated protein 44 (WD repeat-containing protein 52) | EBI-12502476 | 0.35 |
Q14157 | Ubiquitin-associated protein 2-like (Protein NICE-4) | EBI-12502476 | 0.35 |
Q9UPQ9 | Trinucleotide repeat-containing gene 6B protein | EBI-12502476 | 0.35 |
Q9UM00 | Calcium load-activated calcium channel (CLAC channel) (Transmembrane and coiled-coil domain-containing protein 1) (Transmembrane and coiled-coil domains protein 4) (Xenogeneic cross-immune protein PCIA3) | EBI-12502476 | 0.35 |
Q9Y4G6 | Talin-2 | EBI-12502476 | 0.35 |
Q99081 | Transcription factor 12 (TCF-12) (Class B basic helix-loop-helix protein 20) (bHLHb20) (DNA-binding protein HTF4) (E-box-binding protein) (Transcription factor HTF-4) | EBI-12502476 | 0.35 |
Q15370 | Elongin-B (EloB) (Elongin 18 kDa subunit) (RNA polymerase II transcription factor SIII subunit B) (SIII p18) (Transcription elongation factor B polypeptide 2) | EBI-12502476 | 0.35 |
Q15369 | Elongin-C (EloC) (Elongin 15 kDa subunit) (RNA polymerase II transcription factor SIII subunit C) (SIII p15) (Transcription elongation factor B polypeptide 1) | EBI-12502476 | 0.35 |
Q92844 | TRAF family member-associated NF-kappa-B activator (TRAF-interacting protein) (I-TRAF) | EBI-12502476 | 0.35 |
Q9UNL2 | Translocon-associated protein subunit gamma (TRAP-gamma) (Signal sequence receptor subunit gamma) (SSR-gamma) | EBI-12502476 | 0.35 |
Q9Y2K2 | Serine/threonine-protein kinase SIK3 (EC 2.7.11.1) (Salt-inducible kinase 3) (SIK-3) (Serine/threonine-protein kinase QSK) | EBI-12502476 | 0.35 |
P60468 | Protein transport protein Sec61 subunit beta | EBI-12502476 | 0.35 |
O43159 | Ribosomal RNA-processing protein 8 (EC 2.1.1.-) (Cerebral protein 1) (Nucleomethylin) | EBI-12502476 | 0.35 |
P62847 | 40S ribosomal protein S24 (Small ribosomal subunit protein eS24) | EBI-12502476 | 0.35 |
P62841 | 40S ribosomal protein S15 (RIG protein) (Small ribosomal subunit protein uS19) | EBI-12502476 | 0.35 |
Q5VT52 | Regulation of nuclear pre-mRNA domain-containing protein 2 | EBI-12502476 | 0.35 |
P61927 | 60S ribosomal protein L37 (G1.16) (Large ribosomal subunit protein eL37) | EBI-12502476 | 0.35 |
P61353 | 60S ribosomal protein L27 (Large ribosomal subunit protein eL27) | EBI-12502476 | 0.35 |
P57078 | Receptor-interacting serine/threonine-protein kinase 4 (EC 2.7.11.1) (Ankyrin repeat domain-containing protein 3) (PKC-delta-interacting protein kinase) | EBI-12502476 | 0.50 |
Q7L0Y3 | tRNA methyltransferase 10 homolog C (HBV pre-S2 trans-regulated protein 2) (Mitochondrial ribonuclease P protein 1) (Mitochondrial RNase P protein 1) (RNA (guanine-9-)-methyltransferase domain-containing protein 1) (Renal carcinoma antigen NY-REN-49) (mRNA methyladenosine-N(1)-methyltransferase) (EC 2.1.1.-) (tRNA (adenine(9)-N(1))-methyltransferase) (EC 2.1.1.218) (tRNA (guanine(9)-N(1))-methyltransferase) (EC 2.1.1.221) | EBI-12502476 | 0.35 |
Q04206 | Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) | EBI-12502476 | 0.35 |
Q9HCJ3 | Ribonucleoprotein PTB-binding 2 (Protein raver-2) | EBI-12502476 | 0.35 |
Q2TAL8 | Transcriptional regulator QRICH1 (Glutamine-rich protein 1) | EBI-12502476 | 0.35 |
O00487 | 26S proteasome non-ATPase regulatory subunit 14 (EC 3.4.19.-) (26S proteasome regulatory subunit RPN11) (26S proteasome-associated PAD1 homolog 1) | EBI-12502476 | 0.35 |
Q9UNM6 | 26S proteasome non-ATPase regulatory subunit 13 (26S proteasome regulatory subunit RPN9) (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5) | EBI-12502476 | 0.35 |
O75832 | 26S proteasome non-ATPase regulatory subunit 10 (26S proteasome regulatory subunit p28) (Gankyrin) (p28(GANK)) | EBI-12502476 | 0.59 |
P62195 | 26S proteasome regulatory subunit 8 (26S proteasome AAA-ATPase subunit RPT6) (Proteasome 26S subunit ATPase 5) (Proteasome subunit p45) (Thyroid hormone receptor-interacting protein 1) (TRIP1) (p45/SUG) | EBI-12502476 | 0.35 |
P35998 | 26S proteasome regulatory subunit 7 (26S proteasome AAA-ATPase subunit RPT1) (Proteasome 26S subunit ATPase 2) | EBI-12502476 | 0.35 |
Q5H9R7 | Serine/threonine-protein phosphatase 6 regulatory subunit 3 (SAPS domain family member 3) (Sporulation-induced transcript 4-associated protein SAPL) | EBI-12502476 | 0.35 |
Q9UPN7 | Serine/threonine-protein phosphatase 6 regulatory subunit 1 (SAPS domain family member 1) | EBI-12502476 | 0.35 |
O15355 | Protein phosphatase 1G (EC 3.1.3.16) (Protein phosphatase 1C) (Protein phosphatase 2C isoform gamma) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) | EBI-12502476 | 0.35 |
P62875 | DNA-directed RNA polymerases I, II, and III subunit RPABC5 (RNA polymerases I, II, and III subunit ABC5) (DNA-directed RNA polymerase III subunit L) (RNA polymerase II 7.6 kDa subunit) (RPB7.6) (RPB10 homolog) | EBI-12502476 | 0.35 |
P30876 | DNA-directed RNA polymerase II subunit RPB2 (EC 2.7.7.6) (DNA-directed RNA polymerase II 140 kDa polypeptide) (DNA-directed RNA polymerase II subunit B) (RNA polymerase II subunit 2) (RNA polymerase II subunit B2) | EBI-12502476 | 0.35 |
Q4KWH8 | 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-eta-1) (Phospholipase C-eta-1) (PLC-eta-1) (Phospholipase C-like protein 3) (PLC-L3) | EBI-12502476 | 0.35 |
O60733 | 85/88 kDa calcium-independent phospholipase A2 (CaI-PLA2) (EC 3.1.1.4) (2-lysophosphatidylcholine acylhydrolase) (EC 3.1.1.5) (Group VI phospholipase A2) (GVI PLA2) (Intracellular membrane-associated calcium-independent phospholipase A2 beta) (iPLA2-beta) (Palmitoyl-CoA hydrolase) (EC 3.1.2.2) (Patatin-like phospholipase domain-containing protein 9) (PNPLA9) | EBI-12502476 | 0.35 |
Q8IZ21 | Phosphatase and actin regulator 4 | EBI-12502476 | 0.35 |
P08237 | ATP-dependent 6-phosphofructokinase, muscle type (ATP-PFK) (PFK-M) (EC 2.7.1.11) (6-phosphofructokinase type A) (Phosphofructo-1-kinase isozyme A) (PFK-A) (Phosphohexokinase) | EBI-12502476 | 0.35 |
Q8N3A8 | Protein mono-ADP-ribosyltransferase PARP8 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 16) (ARTD16) (Poly [ADP-ribose] polymerase 8) (PARP-8) | EBI-12502476 | 0.35 |
Q9BXW6 | Oxysterol-binding protein-related protein 1 (ORP-1) (OSBP-related protein 1) | EBI-12502476 | 0.53 |
Q9H857 | 5'-nucleotidase domain-containing protein 2 (EC 3.1.3.-) | EBI-12502476 | 0.35 |
Q9UM47 | Neurogenic locus notch homolog protein 3 (Notch 3) [Cleaved into: Notch 3 extracellular truncation; Notch 3 intracellular domain] | EBI-12502476 | 0.53 |
Q04721 | Neurogenic locus notch homolog protein 2 (Notch 2) (hN2) [Cleaved into: Notch 2 extracellular truncation (N2ECD); Notch 2 intracellular domain (N2ICD)] | EBI-12502476 | 0.35 |
Q9Y3T9 | Nucleolar complex protein 2 homolog (Protein NOC2 homolog) (NOC2-like protein) (Novel INHAT repressor) | EBI-12502476 | 0.35 |
O00221 | NF-kappa-B inhibitor epsilon (NF-kappa-BIE) (I-kappa-B-epsilon) (IkB-E) (IkB-epsilon) (IkappaBepsilon) | EBI-12502476 | 0.35 |
P25963 | NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3) | EBI-12502476 | 0.73 |
Q00653 | Nuclear factor NF-kappa-B p100 subunit (DNA-binding factor KBF2) (H2TF1) (Lymphocyte translocation chromosome 10 protein) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2) (Oncogene Lyt-10) (Lyt10) [Cleaved into: Nuclear factor NF-kappa-B p52 subunit] | EBI-12502476 | 0.53 |
Q9P032 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 (Hormone-regulated proliferation-associated protein of 20 kDa) | EBI-12502476 | 0.35 |
Q9Y6Q9 | Nuclear receptor coactivator 3 (NCoA-3) (EC 2.3.1.48) (ACTR) (Amplified in breast cancer 1 protein) (AIB-1) (CBP-interacting protein) (pCIP) (Class E basic helix-loop-helix protein 42) (bHLHe42) (Receptor-associated coactivator 3) (RAC-3) (Steroid receptor coactivator protein 3) (SRC-3) (Thyroid hormone receptor activator molecule 1) (TRAM-1) | EBI-12502476 | 0.35 |
Q9HCH0 | Nck-associated protein 5-like (NCKAP5-like) (Centrosomal protein of 169 kDa) (Cep169) | EBI-12502476 | 0.35 |
P41227 | N-alpha-acetyltransferase 10 (EC 2.3.1.255) (N-terminal acetyltransferase complex ARD1 subunit homolog A) (hARD1) (NatA catalytic subunit Naa10) | EBI-12502476 | 0.35 |
Q9NZJ7 | Mitochondrial carrier homolog 1 (Presenilin-associated protein) | EBI-12502476 | 0.35 |
Q8TE76 | MORC family CW-type zinc finger protein 4 (Zinc finger CW-type coiled-coil domain protein 2) (Zinc finger CW-type domain protein 4) | EBI-12502476 | 0.35 |
Q5TCX8 | Mitogen-activated protein kinase kinase kinase 21 (EC 2.7.11.25) (Mitogen-activated protein kinase kinase kinase MLK4) (Mixed lineage kinase 4) | EBI-12502476 | 0.64 |
Q15773 | Myeloid leukemia factor 2 (Myelodysplasia-myeloid leukemia factor 2) | EBI-12502476 | 0.35 |
Q96AX9 | E3 ubiquitin-protein ligase MIB2 (EC 2.3.2.27) (Mind bomb homolog 2) (Novel zinc finger protein) (Novelzin) (Putative NF-kappa-B-activating protein 002N) (RING-type E3 ubiquitin transferase MIB2) (Skeletrophin) (Zinc finger ZZ type with ankyrin repeat domain protein 1) | EBI-12502476 | 0.35 |
O43318 | Mitogen-activated protein kinase kinase kinase 7 (EC 2.7.11.25) (Transforming growth factor-beta-activated kinase 1) (TGF-beta-activated kinase 1) | EBI-12502476 | 0.35 |
Q7L5Y9 | E3 ubiquitin-protein transferase MAEA (EC 2.3.2.27) (Cell proliferation-inducing gene 5 protein) (Erythroblast macrophage protein) (Human lung cancer oncogene 10 protein) (HLC-10) (Macrophage erythroblast attacher) (P44EMLP) | EBI-12502476 | 0.35 |
Q9BRK4 | Leucine zipper putative tumor suppressor 2 (hLZTS2) (Protein LAPSER1) | EBI-12502476 | 0.35 |
P83369 | U7 snRNA-associated Sm-like protein LSm11 | EBI-12502476 | 0.35 |
Q9ULH0 | Kinase D-interacting substrate of 220 kDa (Ankyrin repeat-rich membrane-spanning protein) | EBI-12502476 | 0.35 |
Q8N163 | Cell cycle and apoptosis regulator protein 2 (Cell division cycle and apoptosis regulator protein 2) (DBIRD complex subunit KIAA1967) (Deleted in breast cancer gene 1 protein) (DBC-1) (DBC.1) (NET35) (p30 DBC) | EBI-12502476 | 0.35 |
Q7LBC6 | Lysine-specific demethylase 3B (EC 1.14.11.65) (JmjC domain-containing histone demethylation protein 2B) (Jumonji domain-containing protein 1B) (Nuclear protein 5qNCA) ([histone H3]-dimethyl-L-lysine(9) demethylase 3B) | EBI-12502476 | 0.35 |
Q96SI1 | BTB/POZ domain-containing protein KCTD15 (Potassium channel tetramerization domain-containing protein 15) | EBI-12502476 | 0.35 |
Q13418 | Integrin-linked protein kinase (EC 2.7.11.1) (59 kDa serine/threonine-protein kinase) (Beta-integrin-linked kinase) (ILK-1) (ILK-2) (p59ILK) | EBI-12502476 | 0.59 |
Q12894 | Interferon-related developmental regulator 2 (Protein SKMC15) | EBI-12502476 | 0.35 |
Q9ULT8 | E3 ubiquitin-protein ligase HECTD1 (EC 2.3.2.26) (E3 ligase for inhibin receptor) (EULIR) (HECT domain-containing protein 1) | EBI-12502476 | 0.64 |
Q00341 | Vigilin (High density lipoprotein-binding protein) (HDL-binding protein) | EBI-12502476 | 0.35 |
O15379 | Histone deacetylase 3 (HD3) (EC 3.5.1.98) (Protein deacetylase HDAC3) (EC 3.5.1.-) (Protein deacylase HDAC3) (EC 3.5.1.-) (RPD3-2) (SMAP45) | EBI-12502476 | 0.35 |
Q9Y450 | HBS1-like protein (ERFS) | EBI-12502476 | 0.35 |
Q9H6D7 | HAUS augmin-like complex subunit 4 | EBI-12502476 | 0.35 |
Q8IYU2 | E3 ubiquitin-protein ligase HACE1 (EC 2.3.2.26) (HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1) (HECT-type E3 ubiquitin transferase HACE1) | EBI-12502476 | 0.35 |
Q9UKJ3 | G patch domain-containing protein 8 | EBI-12502476 | 0.35 |
O60547 | GDP-mannose 4,6 dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) (GMD) | EBI-12502476 | 0.53 |
Q9NRA8 | Eukaryotic translation initiation factor 4E transporter (4E-T) (eIF4E transporter) (Eukaryotic translation initiation factor 4E nuclear import factor 1) | EBI-12502476 | 0.53 |
P06730 | Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (eIF-4F 25 kDa subunit) (mRNA cap-binding protein) | EBI-12502476 | 0.35 |
Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 (EC 2.1.1.-) (EC 2.1.1.367) (Euchromatic histone-lysine N-methyltransferase 1) (Eu-HMTase1) (G9a-like protein 1) (GLP) (GLP1) (Histone H3-K9 methyltransferase 5) (H3-K9-HMTase 5) (Lysine N-methyltransferase 1D) | EBI-12502476 | 0.35 |
Q96F86 | Enhancer of mRNA-decapping protein 3 (LSM16 homolog) (YjeF N-terminal domain-containing protein 2) (YjeF_N2) (hYjeF_N2) (YjeF domain-containing protein 1) | EBI-12502476 | 0.35 |
Q9Y678 | Coatomer subunit gamma-1 (Gamma-1-coat protein) (Gamma-1-COP) | EBI-12502476 | 0.35 |
A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | EBI-12502476 | 0.35 |
Q99439 | Calponin-2 (Calponin H2, smooth muscle) (Neutral calponin) | EBI-12502476 | 0.35 |
Q96ST8 | Centrosomal protein of 89 kDa (Cep89) (Centrosomal protein 123) (Cep123) (Coiled-coil domain-containing protein 123) | EBI-12502476 | 0.35 |
Q5VT06 | Centrosome-associated protein 350 (Cep350) (Centrosome-associated protein of 350 kDa) | EBI-12502476 | 0.35 |
Q12834 | Cell division cycle protein 20 homolog (p55CDC) | EBI-12502476 | 0.35 |
Q8WXE0 | Caskin-2 (CASK-interacting protein 2) | EBI-12502476 | 0.35 |
Q9UKZ1 | CCR4-NOT transcription complex subunit 11 | EBI-12502476 | 0.35 |
Q9BY42 | Replication termination factor 2 (RTF2) (Replication termination factor 2 domain-containing protein 1) | EBI-12502476 | 0.35 |
Q6ZUT1 | Uncharacterized protein NKAPD1 (NKAP domain containing protein 1) | EBI-12502476 | 0.35 |
P20290 | Transcription factor BTF3 (Nascent polypeptide-associated complex subunit beta) (NAC-beta) (RNA polymerase B transcription factor 3) | EBI-12502476 | 0.35 |
Q9NVI7 | ATPase family AAA domain-containing protein 3A | EBI-12502476 | 0.35 |
Q8NBU5 | Outer mitochondrial transmembrane helix translocase (EC 7.4.2.-) (ATPase family AAA domain-containing protein 1) (hATAD1) (Thorase) | EBI-12502476 | 0.35 |
Q9H765 | Ankyrin repeat and SOCS box protein 8 (ASB-8) | EBI-12502476 | 0.64 |
P27540 | Aryl hydrocarbon receptor nuclear translocator (ARNT protein) (Class E basic helix-loop-helix protein 2) (bHLHe2) (Dioxin receptor, nuclear translocator) (Hypoxia-inducible factor 1-beta) (HIF-1-beta) (HIF1-beta) | EBI-12502476 | 0.35 |
Q92625 | Ankyrin repeat and SAM domain-containing protein 1A (Odin) | EBI-12502476 | 0.64 |
Q9ULJ7 | Ankyrin repeat domain-containing protein 50 | EBI-24286767 | 0.56 |
Q8N8A2 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (PP6-ARS-B) (Serine/threonine-protein phosphatase 6 regulatory subunit ARS-B) (Ankyrin repeat domain-containing protein 44) | EBI-12502476 | 0.35 |
O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A (PP6-ARS-A) (Serine/threonine-protein phosphatase 6 regulatory subunit ARS-A) (Ankyrin repeat domain-containing protein 28) (Phosphatase interactor targeting protein hnRNP K) (PITK) | EBI-12502476 | 0.35 |
Q96NW4 | Ankyrin repeat domain-containing protein 27 (VPS9 domain-containing protein) | EBI-12502476 | 0.53 |
O75179 | Ankyrin repeat domain-containing protein 17 (Gene trap ankyrin repeat protein) (Serologically defined breast cancer antigen NY-BR-16) | EBI-12502476 | 0.35 |
Q8IWZ3 | Ankyrin repeat and KH domain-containing protein 1 (HIV-1 Vpr-binding ankyrin repeat protein) (Multiple ankyrin repeats single KH domain) (hMASK) | EBI-12502476 | 0.35 |
Q9P2R3 | Rabankyrin-5 (Rank-5) (Ankyrin repeat and FYVE domain-containing protein 1) (Ankyrin repeats hooked to a zinc finger motif) | EBI-12502476 | 0.35 |
Q96FW1 | Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1) | EBI-10770028 | 0.70 |
P46531 | Neurogenic locus notch homolog protein 1 (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) [Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD)] | EBI-11473706 | 0.44 |
P19838 | Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor KBF1) (EBP-1) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) [Cleaved into: Nuclear factor NF-kappa-B p50 subunit] | EBI-11322417 | 0.74 |
P47086 | Uncharacterized protein YJR011C | EBI-11532399 | 0.56 |
Q6P5F9 | Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog) | EBI-11603310 | 0.35 |
Q6PG48 | ANKRD12 protein | EBI-24615512 | 0.56 |
Q7Z713 | Ankyrin repeat domain-containing protein 37 (Low-density lipoprotein receptor-related protein 2-binding protein) (hLrp2bp) | EBI-24425210 | 0.56 |
Q9H672 | Ankyrin repeat and SOCS box protein 7 (ASB-7) | EBI-24534882 | 0.56 |
Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 (EC 2.7.11.1) (Protein kinase PKK2) (Sugen kinase 288) (SgK288) (X-kinase) | EBI-25272595 | 0.67 |
Q96P71 | N-terminal EF-hand calcium-binding protein 3 (Amyloid-beta A4 protein-binding family A member 2-binding protein) (Nek2-interacting protein 1) (Neuronal calcium-binding protein 3) (X11L-binding protein 51) | EBI-15098946 | 0.40 |
Q9Y575 | Ankyrin repeat and SOCS box protein 3 (ASB-3) | EBI-21571836 | 0.35 |
Q9UPU5 | Ubiquitin carboxyl-terminal hydrolase 24 (EC 3.4.19.12) (Deubiquitinating enzyme 24) (Ubiquitin thioesterase 24) (Ubiquitin-specific-processing protease 24) | EBI-21638930 | 0.35 |
Q9UHD2 | Serine/threonine-protein kinase TBK1 (EC 2.7.11.1) (NF-kappa-B-activating kinase) (T2K) (TANK-binding kinase 1) | EBI-21638930 | 0.35 |
Q9H6R7 | WD repeat and coiled-coil-containing protein | EBI-21638930 | 0.35 |
Q9BQS8 | FYVE and coiled-coil domain-containing protein 1 (Zinc finger FYVE domain-containing protein 7) | EBI-21638930 | 0.53 |
Q8WXD9 | Caskin-1 (CASK-interacting protein 1) | EBI-21638930 | 0.35 |
Q8TES7 | Fas-binding factor 1 (FBF-1) (Protein albatross) | EBI-21638930 | 0.35 |
Q8TBX8 | Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma (EC 2.7.1.149) (Phosphatidylinositol 5-phosphate 4-kinase type II gamma) (PI(5)P 4-kinase type II gamma) (PIP4KII-gamma) | EBI-21638930 | 0.35 |
Q15653 | NF-kappa-B inhibitor beta (NF-kappa-BIB) (I-kappa-B-beta) (IkB-B) (IkB-beta) (IkappaBbeta) (Thyroid receptor-interacting protein 9) (TR-interacting protein 9) (TRIP-9) | EBI-21638930 | 0.53 |
Q05086 | Ubiquitin-protein ligase E3A (EC 2.3.2.26) (E6AP ubiquitin-protein ligase) (HECT-type ubiquitin transferase E3A) (Human papillomavirus E6-associated protein) (Oncogenic protein-associated protein E6-AP) (Renal carcinoma antigen NY-REN-54) | EBI-21638930 | 0.53 |
Q04864 | Proto-oncogene c-Rel | EBI-21638930 | 0.35 |
Q01484 | Ankyrin-2 (ANK-2) (Ankyrin-B) (Brain ankyrin) (Non-erythroid ankyrin) | EBI-21638930 | 0.35 |
P78356 | Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-beta) (Diphosphoinositide kinase 2-beta) (Phosphatidylinositol 5-phosphate 4-kinase type II beta) (PI(5)P 4-kinase type II beta) (PIP4KII-beta) (PtdIns(5)P-4-kinase isoform 2-beta) | EBI-21638930 | 0.53 |
P55196 | Afadin (ALL1-fused gene from chromosome 6 protein) (Protein AF-6) (Afadin adherens junction formation factor) | EBI-21638930 | 0.35 |
P47974 | mRNA decay activator protein ZFP36L2 (Butyrate response factor 2) (EGF-response factor 2) (ERF-2) (TPA-induced sequence 11d) (Zinc finger protein 36, C3H1 type-like 2) (ZFP36-like 2) | EBI-21638930 | 0.35 |
P40222 | Alpha-taxilin | EBI-21638930 | 0.53 |
Q12955 | Ankyrin-3 (ANK-3) (Ankyrin-G) | EBI-21638930 | 0.35 |
Q8WXI3 | Ankyrin repeat and SOCS box protein 10 (ASB-10) | EBI-21754620 | 0.35 |
Q9BW85 | Splicing factor YJU2 (Coiled-coil domain-containing protein 94) | EBI-21758292 | 0.35 |
Q9Y574 | Ankyrin repeat and SOCS box protein 4 (ASB-4) | EBI-21801297 | 0.35 |
Q8WVL7 | Ankyrin repeat domain-containing protein 49 (Fetal globin-inducing factor) | EBI-21811862 | 0.69 |
Q3KP44 | Ankyrin repeat domain-containing protein 55 | EBI-21876401 | 0.35 |
Q96NS5 | Ankyrin repeat and SOCS box protein 16 (ASB-16) | EBI-21897846 | 0.35 |
Q495B1 | Ankyrin repeat and death domain-containing protein 1A | EBI-21900536 | 0.40 |
Q9UK73 | Protein fem-1 homolog B (FEM1b) (FEM1-beta) (Fem-1-like death receptor-binding protein alpha) (Fem-1-like in apoptotic pathway protein alpha) (F1A-alpha) | EBI-15602843 | 0.59 |
Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | EBI-15602883 | 0.51 |
Q06547 | GA-binding protein subunit beta-1 (GABP subunit beta-1) (GABPB-1) (GABP subunit beta-2) (GABPB-2) (Nuclear respiratory factor 2) (Transcription factor E4TF1-47) (Transcription factor E4TF1-53) | EBI-15603005 | 0.44 |
P55273 | Cyclin-dependent kinase 4 inhibitor D (p19-INK4d) | EBI-15603110 | 0.44 |
O14974 | Protein phosphatase 1 regulatory subunit 12A (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (Protein phosphatase myosin-binding subunit) | EBI-15603359 | 0.44 |
Q9UL18 | Protein argonaute-1 (Argonaute1) (hAgo1) (Argonaute RISC catalytic component 1) (Eukaryotic translation initiation factor 2C 1) (eIF-2C 1) (eIF2C 1) (Putative RNA-binding protein Q99) | EBI-16813719 | 0.35 |
P09012 | U1 small nuclear ribonucleoprotein A (U1 snRNP A) (U1-A) (U1A) | EBI-16813719 | 0.35 |
O14497 | AT-rich interactive domain-containing protein 1A (ARID domain-containing protein 1A) (B120) (BRG1-associated factor 250) (BAF250) (BRG1-associated factor 250a) (BAF250A) (Osa homolog 1) (hOSA1) (SWI-like protein) (SWI/SNF complex protein p270) (SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1) (hELD) | EBI-16813719 | 0.35 |
Q4U2R6 | 39S ribosomal protein L51, mitochondrial (L51mt) (MRP-L51) (Mitochondrial large ribosomal subunit protein mL51) (bMRP-64) (bMRP64) | EBI-16813719 | 0.35 |
Q9Y2X3 | Nucleolar protein 58 (Nucleolar protein 5) | EBI-16813719 | 0.35 |
Q9Y2T7 | Y-box-binding protein 2 (Contrin) (DNA-binding protein C) (Dbpc) (Germ cell-specific Y-box-binding protein) (MSY2 homolog) | EBI-16813719 | 0.35 |
Q9UQ35 | Serine/arginine repetitive matrix protein 2 (300 kDa nuclear matrix antigen) (Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa) (SR-related nuclear matrix protein of 300 kDa) (Ser/Arg-related nuclear matrix protein of 300 kDa) (Splicing coactivator subunit SRm300) (Tax-responsive enhancer element-binding protein 803) (TaxREB803) | EBI-16813719 | 0.35 |
Q9H4B7 | Tubulin beta-1 chain | EBI-16813719 | 0.35 |
Q9BWF3 | RNA-binding protein 4 (Lark homolog) (hLark) (RNA-binding motif protein 4) (RNA-binding motif protein 4a) | EBI-16813719 | 0.35 |
Q9BVA1 | Tubulin beta-2B chain | EBI-16813719 | 0.35 |
Q9BU76 | Multiple myeloma tumor-associated protein 2 (hMMTAG2) | EBI-16813719 | 0.35 |
Q9BPZ3 | Polyadenylate-binding protein-interacting protein 2 (PABP-interacting protein 2) (PAIP-2) (Poly(A)-binding protein-interacting protein 2) | EBI-16813719 | 0.35 |
Q99700 | Ataxin-2 (Spinocerebellar ataxia type 2 protein) (Trinucleotide repeat-containing gene 13 protein) | EBI-16813719 | 0.35 |
Q96MR6 | Cilia- and flagella-associated protein 57 (WD repeat-containing protein 65) | EBI-16813719 | 0.35 |
Q96EK7 | Constitutive coactivator of peroxisome proliferator-activated receptor gamma (Constitutive coactivator of PPAR-gamma) (Constitutive coactivator of PPARG) (PPARG constitutive coactivator 1) (PGCC1) (Protein FAM120B) | EBI-16813719 | 0.35 |
Q92925 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 (60 kDa BRG-1/Brm-associated factor subunit B) (BRG1-associated factor 60B) (BAF60B) | EBI-16813719 | 0.35 |
Q92784 | Zinc finger protein DPF3 (BRG1-associated factor 45C) (BAF45C) (Zinc finger protein cer-d4) | EBI-16813719 | 0.35 |
Q92734 | Protein TFG (TRK-fused gene protein) | EBI-16813719 | 0.35 |
Q8WUZ0 | B-cell CLL/lymphoma 7 protein family member C | EBI-16813719 | 0.35 |
Q8NFD5 | AT-rich interactive domain-containing protein 1B (ARID domain-containing protein 1B) (BRG1-associated factor 250b) (BAF250B) (BRG1-binding protein hELD/OSA1) (Osa homolog 2) (hOsa2) (p250R) | EBI-16813719 | 0.35 |
Q8N5F7 | NF-kappa-B-activating protein | EBI-16813719 | 0.35 |
Q6PKG0 | La-related protein 1 (La ribonucleoprotein domain family member 1) | EBI-16813719 | 0.35 |
Q4VC05 | B-cell CLL/lymphoma 7 protein family member A | EBI-16813719 | 0.35 |
Q15020 | Squamous cell carcinoma antigen recognized by T-cells 3 (SART-3) (Tat-interacting protein of 110 kDa) (Tip110) (p110 nuclear RNA-binding protein) | EBI-16813719 | 0.35 |
Q13838 | Spliceosome RNA helicase DDX39B (EC 3.6.4.13) (56 kDa U2AF65-associated protein) (ATP-dependent RNA helicase p47) (DEAD box protein UAP56) (HLA-B-associated transcript 1 protein) | EBI-16813719 | 0.35 |
Q13283 | Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1) | EBI-16813719 | 0.35 |
Q13243 | Serine/arginine-rich splicing factor 5 (Delayed-early protein HRS) (Pre-mRNA-splicing factor SRP40) (Splicing factor, arginine/serine-rich 5) | EBI-16813719 | 0.35 |
Q12926 | ELAV-like protein 2 (ELAV-like neuronal protein 1) (Hu-antigen B) (HuB) (Nervous system-specific RNA-binding protein Hel-N1) | EBI-16813719 | 0.35 |
Q07955 | Serine/arginine-rich splicing factor 1 (Alternative-splicing factor 1) (ASF-1) (Splicing factor, arginine/serine-rich 1) (pre-mRNA-splicing factor SF2, P33 subunit) | EBI-16813719 | 0.35 |
P82664 | 28S ribosomal protein S10, mitochondrial (MRP-S10) (S10mt) (Mitochondrial small ribosomal subunit protein uS10m) | EBI-16813719 | 0.35 |
P51531 | Probable global transcription activator SNF2L2 (EC 3.6.4.-) (ATP-dependent helicase SMARCA2) (BRG1-associated factor 190B) (BAF190B) (Protein brahma homolog) (hBRM) (SNF2-alpha) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2) | EBI-16813719 | 0.35 |
P51532 | Transcription activator BRG1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA4) (BRG1-associated factor 190A) (BAF190A) (Mitotic growth and transcription activator) (Protein BRG-1) (Protein brahma homolog 1) (SNF2-beta) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4) | EBI-16813719 | 0.35 |
Q9BQE3 | Tubulin alpha-1C chain (EC 3.6.5.-) (Alpha-tubulin 6) (Tubulin alpha-6 chain) [Cleaved into: Detyrosinated tubulin alpha-1C chain] | EBI-16814752 | 0.53 |
Q7L014 | Probable ATP-dependent RNA helicase DDX46 (EC 3.6.4.13) (DEAD box protein 46) (PRP5 homolog) | EBI-16814752 | 0.35 |
Q13772 | Nuclear receptor coactivator 4 (NCoA-4) (Androgen receptor coactivator 70 kDa protein) (70 kDa AR-activator) (70 kDa androgen receptor coactivator) (Androgen receptor-associated protein of 70 kDa) (Ret-activating protein ELE1) | EBI-16814752 | 0.35 |
P48668 | Keratin, type II cytoskeletal 6C (Cytokeratin-6C) (CK-6C) (Cytokeratin-6E) (CK-6E) (Keratin K6h) (Keratin-6C) (K6C) (Type-II keratin Kb12) | EBI-16814752 | 0.35 |
Q969F8 | KiSS-1 receptor (KiSS-1R) (G-protein coupled receptor 54) (G-protein coupled receptor OT7T175) (hOT7T175) (Hypogonadotropin-1) (Kisspeptins receptor) (Metastin receptor) | EBI-21282024 | 0.40 |
Q71UM5 | 40S ribosomal protein S27-like (Small ribosomal subunit protein eS27-like) | EBI-25479285 | 0.35 |
P50502 | Hsc70-interacting protein (Hip) (Aging-associated protein 2) (Progesterone receptor-associated p48 protein) (Protein FAM10A1) (Putative tumor suppressor ST13) (Renal carcinoma antigen NY-REN-33) (Suppression of tumorigenicity 13 protein) | EBI-25479285 | 0.35 |
Q9Y6H1 | Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 (Aging-associated gene 10 protein) (HCV NS2 trans-regulated protein) (NS2TP) | EBI-25479285 | 0.35 |
P40763 | Signal transducer and activator of transcription 3 (Acute-phase response factor) | EBI-25485488 | 0.40 |
Q59H18 | Serine/threonine-protein kinase TNNI3K (EC 2.7.11.1) (Cardiac ankyrin repeat kinase) (Cardiac troponin I-interacting kinase) (TNNI3-interacting kinase) | EBI-28941654 | 0.35 |
Database | Links |
UNIPROT | Q9NWT6 D3DR69 Q5W147 Q969Q7 Q9NPV5 |
PDB | 1H2K 1H2L 1H2M 1H2N 1IZ3 1MZE 1MZF 1YCI 2CGN 2CGO 2ILM 2W0X 2WA3 2WA4 2XUM 2Y0I 2YC0 2YDE 3D8C 3KCX 3KCY 3OD4 3P3N 3P3P 4AI8 4B7E 4B7K 4BIO 4JAA 4NR1 4Z1V 4Z2W 5JWK 5JWL 5JWP 5OP6 5OP8 5OPC 6H9J 6HA6 6HC8 6HKP 6HL5 6HL6 6RUJ 7A1J 7A1K 7A1L 7A1M 7A1N 7A1O 7A1P 7A1Q 7A1S |
Pfam | PF13621 |
PROSITE | PS51184 |
OMIM | 606615 |
DisGeNET | 55662 |