Protein Information |
|
|---|---|
| Protein Name | RNA transcription, translation and transport factor protein |
| Accession Code | Q9Y224 |
| Gene | RTRAF |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 244) | |
|
MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAI DWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILV QERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLG KVGR |
|
Structure Viewer (PDB: 7P3A) |
|---|
Description |
||
|---|---|---|
| Nucleus {Experimental EvidencePubMed:15147888, Experimental EvidencePubMed:24608264}. Cytoplasm, cytosol {Experimental EvidencePubMed:15147888, Experimental EvidencePubMed:24608264}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:15147888}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {Experimental EvidencePubMed:15147888}. Note=May localize at the centrosome during mitosis (PubMed:15147888). Shuttles between the cytosol and the nucleus: enters into the nucleus in case of active transcription while it accumulates in cytosol when transcription level is low (PubMed:24608264). {Experimental EvidencePubMed:15147888, Experimental EvidencePubMed:24608264}. Nucleus {ECO:0000269|PubMed:26864902}. Cytoplasm {ECO:0000269|PubMed:26864902}. Note=(Microbial infection) Following influenza A virus (IAV) infection, included in influenza A virions via its association with packaged viral ribonucleoproteins (vRNP) in the nucleus and cytoplasm (PubMed:21900157, PubMed:26864902). {ECO:0000269|PubMed:21900157, ECO:0000269|PubMed:26864902}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Centrosome (GO:0005813) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Mitotic Spindle (GO:0072686) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) TRNA-Splicing Ligase Complex (GO:0072669) |
|
Description |
|
|---|---|
| RNA-binding protein involved in modulation of mRNA transcription by Polymerase II (PubMed:16950395). Component of the tRNA-splicing ligase complex and is required for tRNA ligation (PubMed:24870230). May be required for RNA transport (PubMed:24608264). {Experimental EvidencePubMed:16950395, Experimental EvidencePubMed:24608264, Experimental EvidencePubMed:24870230}. (Microbial infection) In case of infection by influenza virus A (IVA), is involved in viral replication (PubMed:21900157). {Experimental EvidencePubMed:21900157}. | Assigned Ontology terms |
| Biological Process | Negative Regulation Of Protein Kinase Activity (GO:0006469) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) RNA Transport (GO:0050658) TRNA Splicing, Via Endonucleolytic Cleavage And Ligation (GO:0006388) |
| Molecular Function | Identical Protein Binding (GO:0042802) RNA Binding (GO:0003723) RNA Polymerase II Complex Binding (GO:0000993) |
Interactions with Nuclear Envelope proteins (4 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| Q9Y224 | Self | EBI-1164152 | 0.73 |
| Q92905 | COP9 signalosome complex subunit 5 | EBI-21325777 | 0.35 |
| O75190 | DnaJ homolog subfamily B member 6 | EBI-26615064 | 0.35 |
| P59595 | Nucleoprotein | EBI-27129966 | 0.35 | Interactions with other proteins (87 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P63104 | 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1) | EBI-7195640 | 0.40 |
| Q9NRI5 | Disrupted in schizophrenia 1 protein | EBI-1105474 | 0.00 |
| Q8N4C6 | Ninein (hNinein) (Glycogen synthase kinase 3 beta-interacting protein) (GSK3B-interacting protein) | EBI-1164109 | 0.56 |
| A0A2B6C7W6 | Universal stress protein | EBI-2811250 | 0.00 |
| A0A3Q0PRD7 | Toxic anion resistance protein | EBI-2817447 | 0.00 |
| Q81VT8 | DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta) | EBI-2817440 | 0.00 |
| A0A6L8P1C8 | DNA-binding protein | EBI-2836006 | 0.00 |
| P60520 | Gamma-aminobutyric acid receptor-associated protein-like 2 (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16) (MAP1 light chain 3-related protein) | EBI-3046676 | 0.35 |
| P31343 | Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2) | EBI-5452624 | 0.58 |
| P24928 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase II subunit A) (DNA-directed RNA polymerase III largest subunit) (RNA-directed RNA polymerase II subunit RPB1) (EC 2.7.7.48) | EBI-6050476 | 0.40 |
| Q1K9H5 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) | EBI-6050645 | 0.35 |
| B4URF7 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-6050645 | 0.43 |
| Q1I2B2 | Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2) | EBI-6050645 | 0.35 |
| P98078 | Disabled homolog 2 (Adaptor molecule disabled-2) (Differentially expressed in ovarian carcinoma 2) (DOC-2) (Mitogen-responsive phosphoprotein) | EBI-6100356 | 0.35 |
| O56264 | Non-structural protein 1 (NS1) (NS1A) | EBI-6157161 | 0.35 |
| P12792 | Non-structural protein NS-S | EBI-6159029 | 0.35 |
| D1LN35 | Non-structural protein 1 (NS1) | EBI-6159328 | 0.35 |
| P02751 | Fibronectin (FN) (Cold-insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl-Y1; Ugl-Y2; Ugl-Y3] | EBI-6285956 | 0.35 |
| Q86VP6 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-21322532 | 0.35 |
| Q13616 | Cullin-1 (CUL-1) | EBI-21323857 | 0.35 |
| Q96GG9 | DCN1-like protein 1 (DCNL1) (DCUN1 domain-containing protein 1) (Defective in cullin neddylation protein 1-like protein 1) (Squamous cell carcinoma-related oncogene) | EBI-21325177 | 0.35 |
| Q13617 | Cullin-2 (CUL-2) | EBI-21327106 | 0.35 |
| Q13620 | Cullin-4B (CUL-4B) | EBI-21327757 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| Q93034 | Cullin-5 (CUL-5) (Vasopressin-activated calcium-mobilizing receptor 1) (VACM-1) | EBI-21331078 | 0.35 |
| Q8NCA5 | Protein FAM98A | EBI-10269246 | 0.81 |
| O60307 | Microtubule-associated serine/threonine-protein kinase 3 (EC 2.7.11.1) | EBI-10103761 | 0.35 |
| P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11323169 | 0.35 |
| Q6ZWV7 | 60S ribosomal protein L35 | EBI-10997876 | 0.35 |
| Q96FV9 | THO complex subunit 1 (Tho1) (Nuclear matrix protein p84) (p84N5) (hTREX84) | EBI-11034504 | 0.35 |
| P27635 | 60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM) | EBI-11035646 | 0.35 |
| Q8R050 | Eukaryotic peptide chain release factor GTP-binding subunit ERF3A (Eukaryotic peptide chain release factor subunit 3a) (eRF3a) (G1 to S phase transition protein 1 homolog) | EBI-11056816 | 0.35 |
| Q99PL5 | Ribosome-binding protein 1 (Ribosome receptor protein) (RRp) (mRRp) | EBI-11066888 | 0.35 |
| O00567 | Nucleolar protein 56 (Nucleolar protein 5A) | EBI-11069711 | 0.35 |
| P43243 | Matrin-3 | EBI-11071398 | 0.35 |
| Q16643 | Drebrin (Developmentally-regulated brain protein) | EBI-11080402 | 0.35 |
| Q00839 | Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (GRIP120) (Nuclear p120 ribonucleoprotein) (Scaffold-attachment factor A) (SAF-A) (p120) (pp120) | EBI-11088773 | 0.35 |
| P25206 | DNA replication licensing factor MCM3 (EC 3.6.4.12) (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) | EBI-11097548 | 0.35 |
| Q8CCJ3 | E3 UFM1-protein ligase 1 (EC 2.3.2.-) (E3 UFM1-protein transferase 1) (Multiple alpha-helix protein located at ER) (Regulator of C53/LZAP and DDRGK1) | EBI-11104920 | 0.35 |
| Q67020 | Protein PA-X | EBI-11514481 | 0.57 |
| P03433 | Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2) | EBI-11514611 | 0.37 |
| Q9UIG4 | Psoriasis susceptibility 1 candidate gene 2 protein (Protein SPR1) | EBI-24776957 | 0.56 |
| Q194T2 | Non-structural protein 1 (NS1) | EBI-12587457 | 0.35 |
| P46531 | Neurogenic locus notch homolog protein 1 (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) [Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD)] | EBI-13915571 | 0.35 |
| Q6ZNJ1 | Neurobeachin-like protein 2 | EBI-16749633 | 0.35 |
| Q7KZN9 | Cytochrome c oxidase assembly protein COX15 homolog | EBI-20304305 | 0.35 |
| P09622 | Dihydrolipoyl dehydrogenase, mitochondrial (EC 1.8.1.4) (Dihydrolipoamide dehydrogenase) (Glycine cleavage system L protein) | EBI-20304669 | 0.35 |
| O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | EBI-20305770 | 0.35 |
| P00441 | Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) (Superoxide dismutase 1) (hSod1) | EBI-20307497 | 0.35 |
| Q9Y2H1 | Serine/threonine-protein kinase 38-like (EC 2.7.11.1) (NDR2 protein kinase) (Nuclear Dbf2-related kinase 2) | EBI-20624829 | 0.27 |
| P51957 | Serine/threonine-protein kinase Nek4 (EC 2.7.11.1) (Never in mitosis A-related kinase 4) (NimA-related protein kinase 4) (Serine/threonine-protein kinase 2) (Serine/threonine-protein kinase NRK2) | EBI-20721387 | 0.35 |
| P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | EBI-20798291 | 0.35 |
| Q9BVC5 | Ashwin | EBI-20916280 | 0.40 |
| Q52LJ0 | Protein FAM98B | EBI-20924042 | 0.56 |
| Q92499 | ATP-dependent RNA helicase DDX1 (EC 3.6.4.13) (DEAD box protein 1) (DEAD box protein retinoblastoma) (DBP-RB) | EBI-20924034 | 0.64 |
| A2A935 | Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1) | EBI-21022882 | 0.35 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| O96013 | Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4) | EBI-26962273 | 0.35 |
| Q9Y586 | Protein mab-21-like 2 | EBI-21261050 | 0.35 |
| Q9Y3I0 | RNA-splicing ligase RtcB homolog (EC 6.5.1.8) (3'-phosphate/5'-hydroxy nucleic acid ligase) | EBI-21264222 | 0.68 |
| P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | EBI-21208916 | 0.35 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-21301141 | 0.35 |
| A0A024R136 | Rac GTPase activating protein 1, isoform CRA_a | EBI-25411916 | 0.35 |
| A0A0H3L6J6 | Lipoprotein | EBI-25401190 | 0.35 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| P15884 | Transcription factor 4 (TCF-4) (Class B basic helix-loop-helix protein 19) (bHLHb19) (Immunoglobulin transcription factor 2) (ITF-2) (SL3-3 enhancer factor 2) (SEF-2) | EBI-26615064 | 0.35 |
| Q9BWW4 | Single-stranded DNA-binding protein 3 (Sequence-specific single-stranded-DNA-binding protein) | EBI-26615064 | 0.35 |
| Q9NQ29 | Putative RNA-binding protein Luc7-like 1 (Putative SR protein LUC7B1) (SR+89) | EBI-26615064 | 0.35 |
| Q9H1R3 | Myosin light chain kinase 2, skeletal/cardiac muscle (MLCK2) (EC 2.7.11.18) | EBI-26615064 | 0.35 |
| P28288 | ATP-binding cassette sub-family D member 3 (EC 3.1.2.-) (EC 7.6.2.-) (70 kDa peroxisomal membrane protein) (PMP70) | EBI-26615064 | 0.35 |
| Q92804 | TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) | EBI-26615064 | 0.35 |
| P51572 | B-cell receptor-associated protein 31 (BCR-associated protein 31) (Bap31) (6C6-AG tumor-associated antigen) (Protein CDM) (p28) | EBI-26615064 | 0.35 |
| Q9NVH1 | DnaJ homolog subfamily C member 11 | EBI-26615064 | 0.35 |
| Q08378 | Golgin subfamily A member 3 (Golgi complex-associated protein of 170 kDa) (GCP170) (Golgin-160) | EBI-26615064 | 0.35 |
| Q17RN3 | Protein FAM98C | EBI-26615064 | 0.35 |
| P62979 | Ubiquitin-40S ribosomal protein S27a (Ubiquitin carboxyl extension protein 80) [Cleaved into: Ubiquitin; 40S ribosomal protein S27a (Small ribosomal subunit protein eS31)] | EBI-26615064 | 0.35 |
| Q9H0W5 | Coiled-coil domain-containing protein 8 | EBI-26615064 | 0.35 |
| P0DTC9 | Nucleoprotein (N) (Nucleocapsid protein) (NC) (Protein N) | EBI-26994159 | 0.53 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27108918 | 0.35 |
| Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | EBI-27111302 | 0.35 |
| Q99592 | Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171) | EBI-27093179 | 0.35 |
| Q9BVS4 | Serine/threonine-protein kinase RIO2 (EC 2.7.11.1) (RIO kinase 2) | EBI-28944998 | 0.35 |
| P15130 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | EBI-27131516 | 0.35 |
| Q0ZME3 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | EBI-27131755 | 0.35 |
| Q6Q1R8 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | EBI-27132003 | 0.35 |
| K9N4V7 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | EBI-27132270 | 0.35 |
| P33469 | Nucleoprotein (Nucleocapsid protein) (NC) (Protein N) | EBI-27132272 | 0.35 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory