Ubiquitin carboxyl-terminal hydrolase 20 - Homo sapiens

Ubiquitin carboxyl-terminal hydrolase 20 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Ubiquitin carboxyl-terminal hydrolase 20
Accession Code	Q9Y2K6
Gene	USP20
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 914)
MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADHSTIHAQAKKHNLTVNLTTFR LWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAAL QALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM DQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRA ISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHE GHAKLSSSPPRASPVRMAPSYVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIP GKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSC ERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAG SGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKF NTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALAKRRRIEIDT FIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLY GGGPEIAIRQSVAQPLGPENLHGEQKIEAETRAV

Structure Viewer (PDB: 6KCZ)

Subcellular Location

Description
Cytoplasm, perinuclear region {By Similarity}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {Experimental EvidencePubMed:23486064}. Note=According to PubMed:12865408, it localizes in the endoplasmic reticulum; however the relevance of such result is unclear.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Centrosome (GO:0005813) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Deubiquitinating enzyme involved in beta-2 adrenergic receptor (ADRB2) recycling. Acts as a regulator of G-protein coupled receptor (GPCR) signaling by mediating the deubiquitination beta-2 adrenergic receptor (ADRB2). Plays a central role in ADRB2 recycling and resensitization after prolonged agonist stimulation by constitutively binding ADRB2, mediating deubiquitination of ADRB2 and inhibiting lysosomal trafficking of ADRB2. Upon dissociation, it is probably transferred to the translocated beta-arrestins, possibly leading to beta-arrestins deubiquitination and disengagement from ADRB2. This suggests the existence of a dynamic exchange between the ADRB2 and beta-arrestins. Deubiquitinates DIO2, thereby regulating thyroid hormone regulation. Deubiquitinates HIF1A, leading to stabilize HIF1A and enhance HIF1A-mediated activity. Mediates deubiquitination of both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. {Experimental EvidencePubMed:12056827, Experimental EvidencePubMed:12865408, Experimental EvidencePubMed:15776016, Experimental EvidencePubMed:19424180}.
Assigned Ontology terms

Biological Process	Endocytosis (GO:0006897) Protein Deubiquitination (GO:0016579) Protein K48-Linked Deubiquitination (GO:0071108) Protein K63-Linked Deubiquitination (GO:0070536) Regulation Of G Protein-Coupled Receptor Signaling Pathway (GO:0008277) Ubiquitin-Dependent Protein Catabolic Process (GO:0006511)
Molecular Function	Cysteine-Type Deubiquitinase Activity (GO:0004843) Cysteine-Type Endopeptidase Activity (GO:0004197) G Protein-Coupled Receptor Binding (GO:0001664) Zinc Ion Binding (GO:0008270)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q9P0L0	Vesicle-associated membrane protein-associated protein A	EBI-2512022	0.40
Q96AG4	Leucine-rich repeat-containing protein 59, N-terminally processed	EBI-2512022	0.40
P49790	Nuclear pore complex protein Nup153	EBI-2512022	0.40
Q9UH99	SUN domain-containing protein 2	EBI-2512022	0.40
Interactions with other proteins (52 interactors)

Partner (UniProt)		IntAct	Confidence score
P35249	Replication factor C subunit 4 (Activator 1 37 kDa subunit) (A1 37 kDa subunit) (Activator 1 subunit 4) (Replication factor C 37 kDa subunit) (RF-C 37 kDa subunit) (RFC37)	EBI-2512022	0.40
P35250	Replication factor C subunit 2 (Activator 1 40 kDa subunit) (A1 40 kDa subunit) (Activator 1 subunit 2) (Replication factor C 40 kDa subunit) (RF-C 40 kDa subunit) (RFC40)	EBI-2512022	0.40
O00232	26S proteasome non-ATPase regulatory subunit 12 (26S proteasome regulatory subunit RPN5) (26S proteasome regulatory subunit p55)	EBI-2512022	0.40
O15049	NEDD4-binding protein 3 (N4BP3)	EBI-2512022	0.40
P40938	Replication factor C subunit 3 (Activator 1 38 kDa subunit) (A1 38 kDa subunit) (Activator 1 subunit 3) (Replication factor C 38 kDa subunit) (RF-C 38 kDa subunit) (RFC38)	EBI-2512022	0.40
O75521	Enoyl-CoA delta isomerase 2 (EC 5.3.3.8) (DRS-1) (Delta(3),delta(2)-enoyl-CoA isomerase) (D3,D2-enoyl-CoA isomerase) (Diazepam-binding inhibitor-related protein 1) (DBI-related protein 1) (Dodecenoyl-CoA isomerase) (Hepatocellular carcinoma-associated antigen 88) (Peroxisomal 3,2-trans-enoyl-CoA isomerase) (pECI) (Renal carcinoma antigen NY-REN-1)	EBI-2512022	0.40
Q6IQ21	Zinc finger protein 770	EBI-2512022	0.40
Q96JN8	Neuralized-like protein 4	EBI-2512022	0.40
P62158	Calmodulin-1	EBI-2512022	0.40
Q99666	RANBP2-like and GRIP domain-containing protein 5/6 (Ran-binding protein 2-like 1/2) (RanBP2-like 1/2) (RanBP2L1) (RanBP2L2) (Sperm membrane protein BS-63)	EBI-2512022	0.40
P60228	Eukaryotic translation initiation factor 3 subunit E (eIF3e) (Eukaryotic translation initiation factor 3 subunit 6) (Viral integration site protein INT-6 homolog) (eIF-3 p48)	EBI-2512022	0.40
P22830	Ferrochelatase, mitochondrial (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase)	EBI-2512022	0.40
Q5T9A4	ATPase family AAA domain-containing protein 3B (AAA-TOB3)	EBI-2512022	0.40
Q68DG8	Uncharacterized protein DKFZp781N1423	EBI-2512022	0.40
Q15008	26S proteasome non-ATPase regulatory subunit 6 (26S proteasome regulatory subunit RPN7) (26S proteasome regulatory subunit S10) (Breast cancer-associated protein SGA-113M) (Phosphonoformate immuno-associated protein 4) (Proteasome regulatory particle subunit p44S10) (p42A)	EBI-2512022	0.40
Q15149	Plectin (PCN) (PLTN) (Hemidesmosomal protein 1) (HD1) (Plectin-1)	EBI-2512022	0.40
Q96C24	Synaptotagmin-like protein 4 (Exophilin-2) (Granuphilin)	EBI-2512022	0.40
P53350	Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13)	EBI-2512022	0.40
O75943	Cell cycle checkpoint protein RAD17 (hRad17) (RF-C/activator 1 homolog)	EBI-2512022	0.40
O00231	26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit RPN6) (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5)	EBI-2512022	0.40
O00159	Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb)	EBI-2512022	0.40
P51665	26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit RPN8) (26S proteasome regulatory subunit S12) (Mov34 protein homolog) (Proteasome subunit p40)	EBI-2512022	0.40
O75787	Renin receptor (ATPase H(+)-transporting lysosomal accessory protein 2) (ATPase H(+)-transporting lysosomal-interacting protein 2) (ER-localized type I transmembrane adapter) (Embryonic liver differentiation factor 10) (N14F) (Renin/prorenin receptor) (Vacuolar ATP synthase membrane sector-associated protein M8-9) (ATP6M8-9) (V-ATPase M8.9 subunit) [Cleaved into: Renin receptor N-terminal fragment; Renin receptor C-terminal fragment]	EBI-2512022	0.40
P15374	Ubiquitin carboxyl-terminal hydrolase isozyme L3 (UCH-L3) (EC 3.4.19.12) (Ubiquitin thioesterase L3)	EBI-2512022	0.40
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-2512022	0.40
O95292	Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)	EBI-2512022	0.68
Q99767	Amyloid-beta A4 precursor protein-binding family A member 2 (Adapter protein X11beta) (Neuron-specific X11L protein) (Neuronal Munc18-1-interacting protein 2) (Mint-2)	EBI-2512022	0.56
P11310	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial (MCAD) (EC 1.3.8.7) (Medium chain acyl-CoA dehydrogenase) (MCADH)	EBI-2512022	0.40
Q9UBC5	Unconventional myosin-Ia (Brush border myosin I) (BBM-I) (BBMI) (Myosin I heavy chain) (MIHC)	EBI-2512022	0.40
Q3KQU3	MAP7 domain-containing protein 1 (Arginine/proline-rich coiled-coil domain-containing protein 1) (Proline/arginine-rich coiled-coil domain-containing protein 1)	EBI-2512022	0.40
Q8TD30	Alanine aminotransferase 2 (ALT2) (EC 2.6.1.2) (Glutamate pyruvate transaminase 2) (GPT 2) (Glutamic--alanine transaminase 2) (Glutamic--pyruvic transaminase 2)	EBI-2512022	0.40
Q9BY77	Polymerase delta-interacting protein 3 (46 kDa DNA polymerase delta interaction protein) (p46) (S6K1 Aly/REF-like target) (SKAR)	EBI-2512022	0.40
O95714	E3 ubiquitin-protein ligase HERC2 (EC 2.3.2.26) (HECT domain and RCC1-like domain-containing protein 2) (HECT-type E3 ubiquitin transferase HERC2)	EBI-2512022	0.56
Q99613	Eukaryotic translation initiation factor 3 subunit C (eIF3c) (Eukaryotic translation initiation factor 3 subunit 8) (eIF3 p110)	EBI-2512022	0.40
Q9UK80	Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.4.19.12) (Deubiquitinating enzyme 21) (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21)	EBI-2512177	0.40
O95931	Chromobox protein homolog 7	EBI-3951830	0.64
O43597	Protein sprouty homolog 2 (Spry-2)	EBI-10326535	0.56
P13196	5-aminolevulinate synthase, non-specific, mitochondrial (ALAS-H) (EC 2.3.1.37) (5-aminolevulinic acid synthase 1) (Delta-ALA synthase 1) (Delta-aminolevulinate synthase 1)	EBI-10326545	0.56
P36406	E3 ubiquitin-protein ligase TRIM23 (EC 2.3.2.27) (ADP-ribosylation factor domain-containing protein 1) (GTP-binding protein ARD-1) (RING finger protein 46) (RING-type E3 ubiquitin transferase TRIM23) (Tripartite motif-containing protein 23)	EBI-10326555	0.56
P43364	Melanoma-associated antigen 11 (Cancer/testis antigen 1.11) (CT1.11) (MAGE-11 antigen)	EBI-10326565	0.56
Q53XM7	VAMP (Vesicle-associated membrane protein)-associated protein B and C (VAMP (Vesicle-associated membrane protein)-associated protein B and C, isoform CRA_b) (cDNA FLJ13179 fis, clone NT2RP3003918, highly similar to Vesicle-associated membrane protein-associated protein B/C)	EBI-10326577	0.56
Q7L4P6	BEN domain-containing protein 5	EBI-10326587	0.56
Q8IYA8	Interactor of HORMAD1 protein 1 (Cancer/testis antigen 74) (CT74) (Coiled-coil domain-containing protein 36)	EBI-10326597	0.56
Q8N7W2	BEN domain-containing protein 7	EBI-10326607	0.56
Q969F0	Fetal and adult testis-expressed transcript protein (Cancer/testis antigen 43) (CT43) (Tumor antigen BJ-HCC-2)	EBI-10326619	0.56
Q99750	MyoD family inhibitor (Myogenic repressor I-mf)	EBI-10326629	0.56
P58304	Visual system homeobox 2 (Ceh-10 homeodomain-containing homolog) (Homeobox protein CHX10)	EBI-21789618	0.35
Q96T17	MAP7 domain-containing protein 2	EBI-21796065	0.35
Q9UJU6	Drebrin-like protein (Cervical SH3P7) (Cervical mucin-associated protein) (Drebrin-F) (HPK1-interacting protein of 55 kDa) (HIP-55) (SH3 domain-containing protein 7)	EBI-21796190	0.35
Q96RY5	Protein cramped-like (Cramped chromatin regulator homolog 1) (Hematological and neurological expressed 1-like protein)	EBI-21885721	0.35
Q9NZ08	Endoplasmic reticulum aminopeptidase 1 (EC 3.4.11.-) (ARTS-1) (Adipocyte-derived leucine aminopeptidase) (A-LAP) (Aminopeptidase PILS) (Puromycin-insensitive leucyl-specific aminopeptidase) (PILS-AP) (Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator)	EBI-20900752	0.40
Q9H492	Microtubule-associated proteins 1A/1B light chain 3A (Autophagy-related protein LC3 A) (Autophagy-related ubiquitin-like modifier LC3 A) (MAP1 light chain 3-like protein 1) (MAP1A/MAP1B light chain 3 A) (MAP1A/MAP1B LC3 A) (Microtubule-associated protein 1 light chain 3 alpha)	EBI-30830405	0.44

Cross-References

Database	Links
UNIPROT	Q9Y2K6 Q541F1 Q8IXQ1 Q96LG5 Q9UQN8 Q9UQP0
PDB	6KCZ
Pfam	PF06337 PF00443 PF02148
PROSITE	PS51283 PS00972 PS00973 PS50235 PS50271
OMIM	615143
DisGeNET	10868

Ubiquitin carboxyl-terminal hydrolase 20 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 6KCZ)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Interactions with other proteins (52 interactors)

Cross-References

Database

Links

Description

Description