Protein Information |
|
|---|---|
| Protein Name | Glyceraldehyde-3-phosphate dehydrogenase |
| Accession Code | P04406 |
| Gene | GAPDH |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 335) | |
|
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQER DPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPL AKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGY SNRVVDLMAHMASKE |
|
Structure Viewer (PDB: 6YNF) |
|---|
Description |
||
|---|---|---|
| Cytoplasm, cytosol {Experimental EvidencePubMed:12829261}. Nucleus {By SimilarityUniProtKB:P04797}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:12829261}. Membrane {Experimental EvidencePubMed:12829261}. Cytoplasm, cytoskeleton {By SimilarityUniProtKB:P04797}. Note=Translocates to the nucleus following S-nitrosylation and interaction with SIAH1, which contains a nuclear localization signal (By similarity). Postnuclear and Perinuclear regions (PubMed:12829261). {By SimilarityUniProtKB:P04797, Experimental EvidencePubMed:12829261}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) GAIT Complex (GO:0097452) Intracellular Membrane-Bounded Organelle (GO:0043231) Lipid Droplet (GO:0005811) Membrane (GO:0016020) Microtubule Cytoskeleton (GO:0015630) Nuclear Membrane (GO:0031965) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Ribonucleoprotein Complex (GO:1990904) Vesicle (GO:0031982) |
|
Description |
|
|---|---|
| Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively (PubMed:3170585, PubMed:11724794). Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D- glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate (PubMed:3170585, PubMed:11724794). Modulates the organization and assembly of the cytoskeleton (By similarity). Facilitates the CHP1- dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules (By similarity). Component of the GAIT (gamma interferon-activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes (PubMed:23071094). Upon interferon-gamma treatment assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation (PubMed:23071094). Also plays a role in innate immunity by promoting TNF-induced NF-kappa-B activation and type I interferon production, via interaction with TRAF2 and TRAF3, respectively (PubMed:23332158, PubMed:27387501). Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis (By similarity). Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC (By similarity). {By SimilarityUniProtKB:P04797, Experimental EvidencePubMed:11724794, Experimental EvidencePubMed:23071094, Experimental EvidencePubMed:23332158, Experimental EvidencePubMed:27387501, Experimental EvidencePubMed:3170585}. | Assigned Ontology terms |
| Biological Process | Antimicrobial Humoral Immune Response Mediated By Antimicrobial Peptide (GO:0061844) Cellular Response To Type II Interferon (GO:0071346) Defense Response To Fungus (GO:0050832) Glucose Metabolic Process (GO:0006006) Glycolytic Process (GO:0006096) Killing By Host Of Symbiont Cells (GO:0051873) Killing Of Cells Of Another Organism (GO:0031640) Microtubule Cytoskeleton Organization (GO:0000226) Negative Regulation Of Endopeptidase Activity (GO:0010951) Negative Regulation Of Translation (GO:0017148) Neuron Apoptotic Process (GO:0051402) Peptidyl-Cysteine S-Trans-Nitrosylation (GO:0035606) Positive Regulation Of Cytokine Production (GO:0001819) Positive Regulation Of I-KappaB Kinase/NF-KappaB Signaling (GO:0043123) Positive Regulation Of Type I Interferon Production (GO:0032481) Protein Stabilization (GO:0050821) Regulation Of Macroautophagy (GO:0016241) |
| Molecular Function | Aspartic-Type Endopeptidase Inhibitor Activity (GO:0019828) Disordered Domain Specific Binding (GO:0097718) Glyceraldehyde-3-Phosphate Dehydrogenase (NAD+) (Phosphorylating) Activity (GO:0004365) Identical Protein Binding (GO:0042802) Microtubule Binding (GO:0008017) NAD Binding (GO:0051287) NADP Binding (GO:0050661) Peptidyl-Cysteine S-Nitrosylase Activity (GO:0035605) |
Interactions with Nuclear Envelope proteins (11 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| Q92993 | Histone acetyltransferase KAT5 | EBI-25857246 | 0.56 |
| Q9H0J4 | Glutamine-rich protein 2 | EBI-1078469 | 0.00 |
| P04406 | Self | EBI-7907471 | 0.59 |
| Q9WMX2 | RNA-directed RNA polymerase | EBI-9078245 | 0.37 |
| P57740 | Nuclear pore complex protein Nup107 | EBI-20910640 | 0.40 |
| P0DTD1 | 2'-O-methyltransferase nsp16 | EBI-25509444 | 0.35 |
| P60880 | Synaptosomal-associated protein 25 | EBI-26578093 | 0.35 |
| Q92905 | COP9 signalosome complex subunit 5 | EBI-21325777 | 0.35 |
| Q7L5N1 | COP9 signalosome complex subunit 6 | EBI-21328549 | 0.35 |
| P00533 | Epidermal growth factor receptor | EBI-1188138 | 0.79 |
| P04626 | Receptor tyrosine-protein kinase erbB-2 | EBI-9687897 | 0.55 | Interactions with other proteins (216 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q04864 | Proto-oncogene c-Rel | EBI-360834 | 0.00 |
| Q99759 | Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.11.25) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3) | EBI-362433 | 0.00 |
| Q99558 | Mitogen-activated protein kinase kinase kinase 14 (EC 2.7.11.25) (NF-kappa-beta-inducing kinase) (HsNIK) (Serine/threonine-protein kinase NIK) | EBI-363130 | 0.00 |
| O43353 | Receptor-interacting serine/threonine-protein kinase 2 (EC 2.7.11.1) (CARD-containing interleukin-1 beta-converting enzyme-associated kinase) (CARD-containing IL-1 beta ICE-kinase) (RIP-like-interacting CLARP kinase) (Receptor-interacting protein 2) (RIP-2) (Tyrosine-protein kinase RIPK2) (EC 2.7.10.2) | EBI-363706 | 0.00 |
| Q9UHD2 | Serine/threonine-protein kinase TBK1 (EC 2.7.11.1) (NF-kappa-B-activating kinase) (T2K) (TANK-binding kinase 1) | EBI-7476716 | 0.56 |
| P20333 | Tumor necrosis factor receptor superfamily member 1B (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD antigen CD120b) (Etanercept) [Cleaved into: Tumor necrosis factor receptor superfamily member 1b, membrane form; Tumor necrosis factor-binding protein 2 (TBP-2) (TBPII)] | EBI-364783 | 0.00 |
| Q13077 | TNF receptor-associated factor 1 (Epstein-Barr virus-induced protein 6) | EBI-365002 | 0.00 |
| P60709 | Actin, cytoplasmic 1 (EC 3.6.4.-) (Beta-actin) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed] | EBI-353790 | 0.40 |
| Q13268 | Dehydrogenase/reductase SDR family member 2, mitochondrial (EC 1.1.1.-) (Dicarbonyl reductase HEP27) (Protein D) (Short chain dehydrogenase/reductase family 25C member 1) (Protein SDR25C1) | EBI-354614 | 0.40 |
| P15927 | Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) | EBI-707645 | 0.51 |
| Q9NXU5 | ADP-ribosylation factor-like protein 15 (ADP-ribosylation factor-related protein 2) (ARF-related protein 2) | EBI-728720 | 0.00 |
| Q9BX70 | BTB/POZ domain-containing protein 2 | EBI-728775 | 0.00 |
| Q16363 | Laminin subunit alpha-4 (Laminin-14 subunit alpha) (Laminin-8 subunit alpha) (Laminin-9 subunit alpha) | EBI-729012 | 0.00 |
| Q15102 | Platelet-activating factor acetylhydrolase IB subunit alpha1 (EC 3.1.1.47) (PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH subunit gamma) (PAFAH subunit gamma) | EBI-729096 | 0.00 |
| Q9UN74 | Protocadherin alpha-4 (PCDH-alpha-4) | EBI-729117 | 0.00 |
| O00231 | 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit RPN6) (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5) | EBI-729159 | 0.00 |
| P50453 | Serpin B9 (Cytoplasmic antiproteinase 3) (CAP-3) (CAP3) (Peptidase inhibitor 9) (PI-9) | EBI-729279 | 0.00 |
| P04183 | Thymidine kinase, cytosolic (EC 2.7.1.21) | EBI-7398156 | 0.55 |
| O43504 | Ragulator complex protein LAMTOR5 (Hepatitis B virus X-interacting protein) (HBV X-interacting protein) (HBX-interacting protein) (Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5) | EBI-730105 | 0.00 |
| Q06830 | Peroxiredoxin-1 (EC 1.11.1.24) (Natural killer cell-enhancing factor A) (NKEF-A) (Proliferation-associated gene protein) (PAG) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Thioredoxin-dependent peroxiredoxin 1) | EBI-730582 | 0.00 |
| P08238 | Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84) | EBI-709762 | 0.35 |
| O60861 | Growth arrest-specific protein 7 (GAS-7) | EBI-7720940 | 0.40 |
| O60739 | Eukaryotic translation initiation factor 1b (eIF1b) (Protein translation factor SUI1 homolog GC20) | EBI-1072279 | 0.00 |
| O00141 | Serine/threonine-protein kinase Sgk1 (EC 2.7.11.1) (Serum/glucocorticoid-regulated kinase 1) | EBI-1075257 | 0.00 |
| P10599 | Thioredoxin (Trx) (ATL-derived factor) (ADF) (Surface-associated sulphydryl protein) (SASP) (allergen Hom s Trx) | EBI-25857222 | 0.68 |
| P63104 | 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1) | EBI-7194241 | 0.40 |
| Q27957 | Tubulin polymerization-promoting protein (TPPP) (EC 3.6.5.-) (25 kDa brain-specific protein) (p25-alpha) | EBI-7025783 | 0.27 |
| P01023 | Alpha-2-macroglobulin (Alpha-2-M) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5) | EBI-7183126 | 0.35 |
| Q14653 | Interferon regulatory factor 3 (IRF-3) | EBI-7476716 | 0.35 |
| P32121 | Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3) | EBI-1642567 | 0.35 |
| P42771 | Cyclin-dependent kinase inhibitor 2A (Cyclin-dependent kinase 4 inhibitor A) (CDK4I) (Multiple tumor suppressor 1) (MTS-1) (p16-INK4a) (p16-INK4) (p16INK4A) | EBI-1641665 | 0.35 |
| P48637 | Glutathione synthetase (GSH synthetase) (GSH-S) (EC 6.3.2.3) (Glutathione synthase) | EBI-7830840 | 0.40 |
| P28482 | Mitogen-activated protein kinase 1 (MAP kinase 1) (MAPK 1) (EC 2.7.11.24) (ERT1) (Extracellular signal-regulated kinase 2) (ERK-2) (MAP kinase isoform p42) (p42-MAPK) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) | EBI-2115126 | 0.00 |
| O15264 | Mitogen-activated protein kinase 13 (MAP kinase 13) (MAPK 13) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) (Stress-activated protein kinase 4) | EBI-2255044 | 0.35 |
| Q07820 | Induced myeloid leukemia cell differentiation protein Mcl-1 (Bcl-2-like protein 3) (Bcl2-L-3) (Bcl-2-related protein EAT/mcl1) (mcl1/EAT) | EBI-7173317 | 0.35 |
| P00558 | Phosphoglycerate kinase 1 (EC 2.7.2.3) (Cell migration-inducing gene 10 protein) (Primer recognition protein 2) (PRP 2) | EBI-7907378 | 0.54 |
| Q3KSU8 | Large tegument protein deneddylase (EC 3.4.19.12) (EC 3.4.22.-) | EBI-2622922 | 0.37 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-2877710 | 0.35 |
| Q99459 | Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein) | EBI-7954144 | 0.35 |
| P12004 | Proliferating cell nuclear antigen (PCNA) (Cyclin) | EBI-8302829 | 0.57 |
| Q9H492 | Microtubule-associated proteins 1A/1B light chain 3A (Autophagy-related protein LC3 A) (Autophagy-related ubiquitin-like modifier LC3 A) (MAP1 light chain 3-like protein 1) (MAP1A/MAP1B light chain 3 A) (MAP1A/MAP1B LC3 A) (Microtubule-associated protein 1 light chain 3 alpha) | EBI-3044058 | 0.35 |
| Q9GZQ8 | Microtubule-associated proteins 1A/1B light chain 3B (Autophagy-related protein LC3 B) (Autophagy-related ubiquitin-like modifier LC3 B) (MAP1 light chain 3-like protein 2) (MAP1A/MAP1B light chain 3 B) (MAP1A/MAP1B LC3 B) (Microtubule-associated protein 1 light chain 3 beta) | EBI-3045543 | 0.35 |
| P60520 | Gamma-aminobutyric acid receptor-associated protein-like 2 (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16) (MAP1 light chain 3-related protein) | EBI-3046676 | 0.35 |
| Q9H0R8 | Gamma-aminobutyric acid receptor-associated protein-like 1 (Early estrogen-regulated protein) (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1) | EBI-3048562 | 0.35 |
| O95166 | Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) (MM46) | EBI-3050465 | 0.35 |
| P49768 | Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) [Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)] | EBI-3385373 | 0.37 |
| Q06187 | Tyrosine-protein kinase BTK (EC 2.7.10.2) (Agammaglobulinemia tyrosine kinase) (ATK) (B-cell progenitor kinase) (BPK) (Bruton tyrosine kinase) | EBI-3505275 | 0.35 |
| P43351 | DNA repair protein RAD52 homolog | EBI-3646827 | 0.35 |
| Q96Q15 | Serine/threonine-protein kinase SMG1 (SMG-1) (hSMG-1) (EC 2.7.11.1) (Lambda/iota protein kinase C-interacting protein) (Lambda-interacting protein) (Nonsense mediated mRNA decay-associated PI3K-related kinase SMG1) | EBI-3903995 | 0.35 |
| Q15051 | IQ calmodulin-binding motif-containing protein 1 (Nephrocystin-5) (p53 and DNA damage-regulated IQ motif protein) (PIQ) | EBI-4286917 | 0.35 |
| P04083 | Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) [Cleaved into: Annexin Ac2-26] | EBI-7095327 | 0.37 |
| P20073 | Annexin A7 (Annexin VII) (Annexin-7) (Synexin) | EBI-7098273 | 0.37 |
| P55957 | BH3-interacting domain death agonist (p22 BID) (BID) [Cleaved into: BH3-interacting domain death agonist p15 (p15 BID); BH3-interacting domain death agonist p13 (p13 BID); BH3-interacting domain death agonist p11 (p11 BID)] | EBI-7104540 | 0.37 |
| P24522 | Growth arrest and DNA damage-inducible protein GADD45 alpha (DNA damage-inducible transcript 1 protein) (DDIT-1) | EBI-7152962 | 0.37 |
| P68032 | Actin, alpha cardiac muscle 1 (EC 3.6.4.-) (Alpha-cardiac actin) [Cleaved into: Actin, alpha cardiac muscle 1, intermediate form] | EBI-7157149 | 0.37 |
| P00505 | Aspartate aminotransferase, mitochondrial (mAspAT) (EC 2.6.1.1) (EC 2.6.1.7) (Fatty acid-binding protein) (FABP-1) (Glutamate oxaloacetate transaminase 2) (Kynurenine aminotransferase 4) (Kynurenine aminotransferase IV) (Kynurenine--oxoglutarate transaminase 4) (Kynurenine--oxoglutarate transaminase IV) (Plasma membrane-associated fatty acid-binding protein) (FABPpm) (Transaminase A) | EBI-7157215 | 0.37 |
| Q14469 | Transcription factor HES-1 (Class B basic helix-loop-helix protein 39) (bHLHb39) (Hairy and enhancer of split 1) (Hairy homolog) (Hairy-like protein) (hHL) | EBI-7157494 | 0.37 |
| Q15046 | Lysine--tRNA ligase (EC 2.7.7.-) (EC 6.1.1.6) (Lysyl-tRNA synthetase) (LysRS) | EBI-7157574 | 0.37 |
| Q13952 | Nuclear transcription factor Y subunit gamma (CAAT box DNA-binding protein subunit C) (Nuclear transcription factor Y subunit C) (NF-YC) (Transactivator HSM-1/2) | EBI-7157626 | 0.37 |
| Q99650 | Oncostatin-M-specific receptor subunit beta (Interleukin-31 receptor subunit beta) (IL-31 receptor subunit beta) (IL-31R subunit beta) (IL-31R-beta) (IL-31RB) | EBI-7157758 | 0.37 |
| Q92882 | Osteoclast-stimulating factor 1 | EBI-7157808 | 0.37 |
| P52756 | RNA-binding protein 5 (Protein G15) (Putative tumor suppressor LUCA15) (RNA-binding motif protein 5) (Renal carcinoma antigen NY-REN-9) | EBI-7157858 | 0.37 |
| P62258 | 14-3-3 protein epsilon (14-3-3E) | EBI-7157955 | 0.37 |
| P49841 | Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1) | EBI-7165309 | 0.55 |
| Q9Y6H6 | Potassium voltage-gated channel subfamily E member 3 (MinK-related peptide 2) (Minimum potassium ion channel-related peptide 2) (Potassium channel subunit beta MiRP2) | EBI-7183576 | 0.37 |
| Q16637 | Survival motor neuron protein (Component of gems 1) (Gemin-1) | EBI-7389132 | 0.37 |
| P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | EBI-7391160 | 0.37 |
| P18084 | Integrin beta-5 | EBI-5659917 | 0.00 |
| P15336 | Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response element-binding protein CRE-BP1) | EBI-5529812 | 0.35 |
| P04487 | Accessory factor US11 (Vmw21) | EBI-6157560 | 0.35 |
| P0C1C6 | Protein W | EBI-6158469 | 0.35 |
| P03496 | Non-structural protein 1 (NS1) (NS1A) | EBI-6158649 | 0.35 |
| P19320 | Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106) | EBI-6189915 | 0.35 |
| Q00537 | Cyclin-dependent kinase 17 (EC 2.7.11.22) (Cell division protein kinase 17) (PCTAIRE-motif protein kinase 2) (Serine/threonine-protein kinase PCTAIRE-2) | EBI-6380868 | 0.35 |
| Q13164 | Mitogen-activated protein kinase 7 (MAP kinase 7) (MAPK 7) (EC 2.7.11.24) (Big MAP kinase 1) (BMK-1) (Extracellular signal-regulated kinase 5) (ERK-5) | EBI-6380894 | 0.35 |
| Q86VP6 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-21322532 | 0.35 |
| Q13616 | Cullin-1 (CUL-1) | EBI-21323857 | 0.35 |
| Q13617 | Cullin-2 (CUL-2) | EBI-21327106 | 0.35 |
| Q13620 | Cullin-4B (CUL-4B) | EBI-21327757 | 0.53 |
| Q15843 | NEDD8 (Neddylin) (Neural precursor cell expressed developmentally down-regulated protein 8) (NEDD-8) (Ubiquitin-like protein Nedd8) | EBI-21328206 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| P42858 | Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment] | EBI-9053301 | 0.67 |
| P48147 | Prolyl endopeptidase (PE) (EC 3.4.21.26) (Post-proline cleaving enzyme) | EBI-9550467 | 0.64 |
| Q15303 | Receptor tyrosine-protein kinase erbB-4 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-4) (Tyrosine kinase-type cell surface receptor HER4) (p180erbB4) [Cleaved into: ERBB4 intracellular domain (4ICD) (E4ICD) (s80HER4)] | EBI-9687710 | 0.37 |
| Q60823 | RAC-beta serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase Akt-2) (Protein kinase B beta) (PKB beta) (RAC-PK-beta) | EBI-9702520 | 0.42 |
| Q13043 | Serine/threonine-protein kinase 4 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 1) (MST-1) (STE20-like kinase MST1) (Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit (MST1/N); Serine/threonine-protein kinase 4 18kDa subunit (MST1/C)] | EBI-10049589 | 0.35 |
| P51451 | Tyrosine-protein kinase Blk (EC 2.7.10.2) (B lymphocyte kinase) (p55-Blk) | EBI-10102766 | 0.35 |
| P05109 | Protein S100-A8 (Calgranulin-A) (Calprotectin L1L subunit) (Cystic fibrosis antigen) (CFAG) (Leukocyte L1 complex light chain) (Migration inhibitory factor-related protein 8) (MRP-8) (p8) (S100 calcium-binding protein A8) (Urinary stone protein band A) | EBI-10098112 | 0.65 |
| P35228 | Nitric oxide synthase, inducible (EC 1.14.13.39) (Hepatocyte NOS) (HEP-NOS) (Inducible NO synthase) (Inducible NOS) (iNOS) (NOS type II) (Peptidyl-cysteine S-nitrosylase NOS2) | EBI-10091932 | 0.50 |
| P06702 | Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9) | EBI-10091932 | 0.35 |
| Q00325 | Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3) | EBI-10091892 | 0.35 |
| P62805 | Histone H4 | EBI-10091892 | 0.35 |
| Q96FW1 | Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1) | EBI-10770198 | 0.35 |
| P19838 | Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor KBF1) (EBP-1) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) [Cleaved into: Nuclear factor NF-kappa-B p50 subunit] | EBI-11322719 | 0.35 |
| P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11323169 | 0.35 |
| Q13098 | COP9 signalosome complex subunit 1 (SGN1) (Signalosome subunit 1) (G protein pathway suppressor 1) (GPS-1) (JAB1-containing signalosome subunit 1) (Protein MFH) | EBI-10766278 | 0.35 |
| O35071 | Kinesin-like protein KIF1C | EBI-10996866 | 0.35 |
| P36895 | Bone morphogenetic protein receptor type-1A (BMP type-1A receptor) (BMPR-1A) (EC 2.7.11.30) (Activin receptor-like kinase 3) (ALK-3) (BMP-2/BMP-4 receptor) (Serine/threonine-protein kinase receptor R5) (SKR5) (CD antigen CD292) | EBI-11008521 | 0.35 |
| Q8N2N9 | Ankyrin repeat domain-containing protein 36B (CLL-associated antigen KW-1) | EBI-11053871 | 0.35 |
| Q96G25 | Mediator of RNA polymerase II transcription subunit 8 (Activator-recruited cofactor 32 kDa component) (ARC32) (Mediator complex subunit 8) | EBI-11053871 | 0.35 |
| Q8NG31 | Kinetochore scaffold 1 (ALL1-fused gene from chromosome 15q14 protein) (AF15q14) (Bub-linking kinetochore protein) (Blinkin) (Cancer susceptibility candidate gene 5 protein) (Cancer/testis antigen 29) (CT29) (Kinetochore-null protein 1) (Protein CASC5) (Protein D40/AF15q14) | EBI-11053871 | 0.35 |
| P48039 | Melatonin receptor type 1A (Mel-1A-R) (Mel1a receptor) | EBI-11575898 | 0.37 |
| P54274 | Telomeric repeat-binding factor 1 (NIMA-interacting protein 2) (TTAGGG repeat-binding factor 1) (Telomeric protein Pin2/TRF1) | EBI-11310274 | 0.37 |
| Q9BSI4 | TERF1-interacting nuclear factor 2 (TRF1-interacting nuclear protein 2) | EBI-11310284 | 0.51 |
| Q96AP0 | Adrenocortical dysplasia protein homolog (POT1 and TIN2-interacting protein) | EBI-11310294 | 0.37 |
| Q9NUX5 | Protection of telomeres protein 1 (hPot1) (POT1-like telomere end-binding protein) | EBI-11310304 | 0.37 |
| Q9UBX2 | Double homeobox protein 4 (Double homeobox protein 10) | EBI-11614356 | 0.35 |
| P06929 | Protein E6 | EBI-26506766 | 0.37 |
| P06427 | Protein E6 | EBI-26507442 | 0.37 |
| P24835 | Protein E6 | EBI-26507526 | 0.37 |
| P56945 | Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas) | EBI-15099384 | 0.35 |
| Q6IQ23 | Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7) | EBI-16398399 | 0.35 |
| Q16082 | Heat shock protein beta-2 (HspB2) (DMPK-binding protein) (MKBP) | EBI-15487660 | 0.37 |
| Q9BZE9 | Tether containing UBX domain for GLUT4 (Alveolar soft part sarcoma chromosomal region candidate gene 1 protein) (Alveolar soft part sarcoma locus) (Renal papillary cell carcinoma protein 17) (UBX domain-containing protein 9) | EBI-21690090 | 0.35 |
| O14556 | Glyceraldehyde-3-phosphate dehydrogenase, testis-specific (EC 1.2.1.12) (Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2) (GAPDH-2) (Spermatogenic glyceraldehyde-3-phosphate dehydrogenase) | EBI-21690090 | 0.35 |
| Q15915 | Zinc finger protein ZIC 1 (Zinc finger protein 201) (Zinc finger protein of the cerebellum 1) | EBI-21696712 | 0.35 |
| Q92696 | Geranylgeranyl transferase type-2 subunit alpha (EC 2.5.1.60) (Geranylgeranyl transferase type II subunit alpha) (Rab geranyl-geranyltransferase subunit alpha) (Rab GG transferase alpha) (Rab GGTase alpha) (Rab geranylgeranyltransferase subunit alpha) | EBI-21736347 | 0.35 |
| Q920M9 | E3 ubiquitin-protein ligase SIAH1 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase SIAH1) (Seven in absentia homolog 1) (Siah-1) (Siah-1a) | EBI-15571980 | 0.44 |
| Q7MWG4 | Phosphoserine phosphatase (EC 3.1.3.3) (O-phosphoserine phosphohydrolase) | EBI-15591000 | 0.40 |
| P16749 | mRNA export factor ICP27 homolog | EBI-15833083 | 0.41 |
| P04075 | Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Lung cancer antigen NY-LU-1) (Muscle-type aldolase) | EBI-16426431 | 0.35 |
| P00441 | Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) (Superoxide dismutase 1) (hSod1) | EBI-20303881 | 0.50 |
| P25705 | ATP synthase subunit alpha, mitochondrial (ATP synthase F1 subunit alpha) | EBI-21929063 | 0.35 |
| Q96HJ9 | Protein FMC1 homolog (ATP synthase assembly factor FMC1, mitochondrial) (Formation of mitochondrial complex V assembly factor 1 homolog) | EBI-21929593 | 0.35 |
| Q9Y2Z9 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial (EC 1.14.13.-) (Coenzyme Q10 monooxygenase 6) | EBI-21930056 | 0.35 |
| O00483 | Cytochrome c oxidase subunit NDUFA4 (Complex I-MLRQ) (CI-MLRQ) (NADH-ubiquinone oxidoreductase MLRQ subunit) | EBI-21930681 | 0.35 |
| O75489 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial (EC 7.1.1.2) (Complex I-30kD) (CI-30kD) (NADH-ubiquinone oxidoreductase 30 kDa subunit) | EBI-21931040 | 0.35 |
| Q96FC7 | Phytanoyl-CoA hydroxylase-interacting protein-like | EBI-21931532 | 0.35 |
| Q9H6K4 | Optic atrophy 3 protein | EBI-21931410 | 0.35 |
| Q3MIX3 | Uncharacterized aarF domain-containing protein kinase 5 (EC 2.7.11.-) | EBI-21935154 | 0.35 |
| P0C7P0 | CDGSH iron-sulfur domain-containing protein 3, mitochondrial (MitoNEET-related protein 2) (Miner2) (Mitochondrial inner NEET protein) (MiNT) | EBI-21935930 | 0.35 |
| Q99807 | 5-demethoxyubiquinone hydroxylase, mitochondrial (DMQ hydroxylase) (EC 1.14.99.60) (Timing protein clk-1 homolog) (Ubiquinone biosynthesis monooxygenase COQ7) | EBI-21936186 | 0.35 |
| Q8TB22 | Spermatogenesis-associated protein 20 (Sperm-specific protein 411) (Ssp411) | EBI-21937705 | 0.35 |
| Q9NQH7 | Xaa-Pro aminopeptidase 3 (X-Pro aminopeptidase 3) (EC 3.4.11.9) (Aminopeptidase P3) (APP3) | EBI-21937834 | 0.35 |
| Q9C002 | Normal mucosa of esophagus-specific gene 1 protein (Protein FOAP-11) | EBI-21938261 | 0.35 |
| Q9HAC7 | Succinate--hydroxymethylglutarate CoA-transferase (EC 2.8.3.13) (Dermal papilla-derived protein 13) (SuccinylCoA:glutarate-CoA transferase) | EBI-21938493 | 0.35 |
| O00746 | Nucleoside diphosphate kinase, mitochondrial (NDK) (NDP kinase, mitochondrial) (EC 2.7.4.6) (Nucleoside diphosphate kinase D) (NDPKD) (nm23-H4) | EBI-21940120 | 0.35 |
| Q8N3Z0 | Inactive serine protease 35 | EBI-21940471 | 0.35 |
| Q86U44 | N6-adenosine-methyltransferase catalytic subunit (EC 2.1.1.348) (Methyltransferase-like protein 3) (hMETTL3) (N6-adenosine-methyltransferase 70 kDa subunit) (MT-A70) | EBI-20594935 | 0.35 |
| Q9HCE5 | N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14) | EBI-20595531 | 0.35 |
| Q8TDU9 | Relaxin-3 receptor 2 (RLN3 receptor 2) (G-protein coupled receptor 100) (G-protein coupled receptor GPCR142) (Insulin-like peptide INSL5 receptor) (Relaxin family peptide receptor 4) | EBI-20807086 | 0.37 |
| P02730 | Band 3 anion transport protein (Anion exchange protein 1) (AE 1) (Anion exchanger 1) (Solute carrier family 4 member 1) (CD antigen CD233) | EBI-20795573 | 0.40 |
| P04920 | Anion exchange protein 2 (AE 2) (Anion exchanger 2) (Non-erythroid band 3-like protein) (BND3L) (Solute carrier family 4 member 2) | EBI-20795563 | 0.40 |
| P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | EBI-20799352 | 0.35 |
| Q8NFJ5 | Retinoic acid-induced protein 3 (G-protein coupled receptor family C group 5 member A) (Phorbol ester induced gene 1) (PEIG-1) (Retinoic acid-induced gene 1 protein) (RAIG-1) | EBI-20902056 | 0.40 |
| Q6A163 | Keratin, type I cytoskeletal 39 (Cytokeratin-39) (CK-39) (Keratin-39) (K39) (Type I hair keratin Ka35) | EBI-20904168 | 0.40 |
| O76041 | Nebulette (Actin-binding Z-disk protein) | EBI-20904328 | 0.40 |
| Q03936 | Zinc finger protein 92 (Zinc finger protein HTF12) | EBI-20906200 | 0.40 |
| P04908 | Histone H2A type 1-B/E (Histone H2A.2) (Histone H2A/a) (Histone H2A/m) | EBI-20906576 | 0.40 |
| Q5TZA2 | Rootletin (Ciliary rootlet coiled-coil protein) | EBI-20909272 | 0.40 |
| Q99442 | Translocation protein SEC62 (Translocation protein 1) (TP-1) (hTP-1) | EBI-20911552 | 0.40 |
| O75602 | Sperm-associated antigen 6 (Protein PF16 homolog) (Repro-SA-1) (Sperm flagellar protein) | EBI-20914552 | 0.40 |
| O95425 | Supervillin (Archvillin) (p205/p250) | EBI-20916064 | 0.40 |
| Q5VST9 | Obscurin (EC 2.7.11.1) (Obscurin-RhoGEF) (Obscurin-myosin light chain kinase) (Obscurin-MLCK) | EBI-20920604 | 0.40 |
| Q502W7 | Coiled-coil domain-containing protein 38 | EBI-20925058 | 0.40 |
| P48751 | Anion exchange protein 3 (AE 3) (Anion exchanger 3) (CAE3/BAE3) (Cardiac/brain band 3-like protein) (Neuronal band 3-like protein) (Solute carrier family 4 member 3) | EBI-20926210 | 0.40 |
| Q00535 | Cyclin-dependent kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Cyclin-dependent-like kinase 5) (Serine/threonine-protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit) | EBI-20926978 | 0.40 |
| A1A4G5 | Leukemia NUP98 fusion partner 1 | EBI-20927136 | 0.40 |
| Q69YH5 | Cell division cycle-associated protein 2 (Recruits PP1 onto mitotic chromatin at anaphase protein) (Repo-Man) | EBI-20928976 | 0.40 |
| Q13283 | Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1) | EBI-20929856 | 0.40 |
| Q63HK5 | Teashirt homolog 3 (Zinc finger protein 537) | EBI-20929960 | 0.40 |
| Q5T6S3 | PHD finger protein 19 (Polycomb-like protein 3) (hPCL3) | EBI-20931832 | 0.40 |
| Q6P1J9 | Parafibromin (Cell division cycle protein 73 homolog) (Hyperparathyroidism 2 protein) | EBI-20932880 | 0.40 |
| O95139 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (Complex I-B17) (CI-B17) (NADH-ubiquinone oxidoreductase B17 subunit) | EBI-20934708 | 0.40 |
| O15015 | Zinc finger protein 646 | EBI-20935244 | 0.40 |
| A8MT65 | Zinc finger protein 891 | EBI-20937020 | 0.40 |
| A2A935 | Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1) | EBI-21022882 | 0.35 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| O96013 | Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4) | EBI-26962273 | 0.35 |
| Q5T7N2 | LINE-1 type transposase domain-containing protein 1 (ES cell-associated protein 11) | EBI-20993270 | 0.46 |
| P52292 | Importin subunit alpha-1 (Karyopherin subunit alpha-2) (RAG cohort protein 1) (SRP1-alpha) | EBI-20993846 | 0.35 |
| Q9H9Z2 | Protein lin-28 homolog A (Lin-28A) (Zinc finger CCHC domain-containing protein 1) | EBI-20993846 | 0.35 |
| P13693 | Translationally-controlled tumor protein (TCTP) (Fortilin) (Histamine-releasing factor) (HRF) (p23) | EBI-20992046 | 0.35 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-21360986 | 0.35 |
| O60260 | E3 ubiquitin-protein ligase parkin (Parkin) (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) (Parkinson juvenile disease protein 2) (Parkinson disease protein 2) | EBI-21135687 | 0.35 |
| P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-25416349 | 0.35 |
| Q16526 | Cryptochrome-1 | EBI-21981854 | 0.35 |
| O95292 | Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) | EBI-21993601 | 0.35 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| P69479 | Phosphoprotein (Protein P) (Protein M1) | EBI-25568044 | 0.35 |
| Q9BY14 | Testis-expressed protein 101 (Cell surface receptor NYD-SP8) (Scleroderma-associated autoantigen) (Spermatogenesis-related gene protein) | EBI-25504841 | 0.35 |
| P0DTC3 | ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) | EBI-25510118 | 0.35 |
| P0DTD3 | Putative ORF9c protein (ORF9c) (Uncharacterized protein 14) (ORF14) | EBI-25510342 | 0.35 |
| P17612 | cAMP-dependent protein kinase catalytic subunit alpha (PKA C-alpha) (EC 2.7.11.11) | EBI-25857214 | 0.56 |
| Q9UIJ7 | GTP:AMP phosphotransferase AK3, mitochondrial (EC 2.7.4.10) (Adenylate kinase 3) (AK 3) (Adenylate kinase 3 alpha-like 1) | EBI-25857278 | 0.56 |
| Q8WUY3 | Protein prune homolog 2 (BNIP2 motif-containing molecule at the C-terminal region 1) | EBI-25857270 | 0.56 |
| Q9UHX1 | Poly(U)-binding-splicing factor PUF60 (60 kDa poly(U)-binding-splicing factor) (FUSE-binding protein-interacting repressor) (FBP-interacting repressor) (Ro-binding protein 1) (RoBP1) (Siah-binding protein 1) (Siah-BP1) | EBI-25857262 | 0.56 |
| O00471 | Exocyst complex component 5 (Exocyst complex component Sec10) (hSec10) | EBI-25857254 | 0.56 |
| Q9BPW9 | Dehydrogenase/reductase SDR family member 9 (EC 1.1.1.209) (EC 1.1.1.53) (3-alpha hydroxysteroid dehydrogenase) (3-alpha-HSD) (NADP-dependent retinol dehydrogenase/reductase) (RDH-E2) (RDHL) (Retinol dehydrogenase 15) (EC 1.1.1.105) (Short chain dehydrogenase/reductase family 9C member 4) (Short-chain dehydrogenase/reductase retSDR8) (Tracheobronchial epithelial cell-specific retinol dehydrogenase) (RDH-TBE) | EBI-25857238 | 0.56 |
| O75344 | Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (Inactive PPIase FKBP6) (36 kDa FK506-binding protein) (36 kDa FKBP) (FKBP-36) (FK506-binding protein 6) (FKBP-6) (Immunophilin FKBP36) | EBI-25857230 | 0.56 |
| P06241 | Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn) | EBI-25857206 | 0.56 |
| P35222 | Catenin beta-1 (Beta-catenin) | EBI-25857198 | 0.56 |
| Q14194 | Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin response mediator protein 1) (CRMP-1) (Inactive dihydropyrimidinase) (Unc-33-like phosphoprotein 3) (ULIP-3) | EBI-25857190 | 0.56 |
| Q9UQM7 | Calcium/calmodulin-dependent protein kinase type II subunit alpha (CaM kinase II subunit alpha) (CaMK-II subunit alpha) (EC 2.7.11.17) | EBI-25857182 | 0.56 |
| Q6UY14 | ADAMTS-like protein 4 (ADAMTSL-4) (Thrombospondin repeat-containing protein 1) | EBI-25857286 | 0.56 |
| Q96GZ6 | Solute carrier family 41 member 3 | EBI-25857296 | 0.56 |
| Q8NEA9 | Germ cell-less protein-like 2 (Germ cell-less protein-like 1-like) | EBI-25857304 | 0.56 |
| P05067 | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] | EBI-25936448 | 0.56 |
| Q7Z417 | FMR1-interacting protein NUFIP2 (82 kDa FMRP-interacting protein) (82-FIP) (Cell proliferation-inducing gene 1 protein) (FMRP-interacting protein 2) (Nuclear FMR1-interacting protein 2) | EBI-26513452 | 0.37 |
| Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2) | EBI-26514195 | 0.37 |
| P51531 | Probable global transcription activator SNF2L2 (EC 3.6.4.-) (ATP-dependent helicase SMARCA2) (BRG1-associated factor 190B) (BAF190B) (Protein brahma homolog) (hBRM) (SNF2-alpha) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2) | EBI-26515253 | 0.37 |
| P49815 | Tuberin (Tuberous sclerosis 2 protein) | EBI-26516083 | 0.37 |
| P52298 | Nuclear cap-binding protein subunit 2 (20 kDa nuclear cap-binding protein) (Cell proliferation-inducing gene 55 protein) (NCBP 20 kDa subunit) (CBP20) (NCBP-interacting protein 1) (NIP1) | EBI-26397282 | 0.35 |
| Q09161 | Nuclear cap-binding protein subunit 1 (80 kDa nuclear cap-binding protein) (CBP80) (NCBP 80 kDa subunit) | EBI-26399030 | 0.35 |
| Q8TB24 | Ras and Rab interactor 3 (Ras interaction/interference protein 3) | EBI-26518569 | 0.35 |
| Q5U458 | DnaJ homolog subfamily C member 11 | EBI-26450034 | 0.35 |
| P14240 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (Large structural protein) (Replicase) (Transcriptase) [Includes: cap-snatching endonuclease (EC 3.1.-.-)] | EBI-26968430 | 0.35 |
| Q99608 | Necdin | EBI-26955247 | 0.27 |
| P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | EBI-26871590 | 0.35 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27109494 | 0.35 |
| Q92630 | Dual specificity tyrosine-phosphorylation-regulated kinase 2 (EC 2.7.12.1) | EBI-28952196 | 0.27 |
| P42695 | Condensin-2 complex subunit D3 (Non-SMC condensin II complex subunit D3) (hCAP-D3) | EBI-28951349 | 0.50 |
| P0DTC9 | Nucleoprotein (N) (Nucleocapsid protein) (NC) (Protein N) | EBI-28955760 | 0.35 |
| Q13619 | Cullin-4A (CUL-4A) | EBI-30863570 | 0.35 |
| Q8WV16 | DDB1- and CUL4-associated factor 4 (WD repeat-containing protein 21A) | EBI-30863977 | 0.35 |
| Q05DH4 | FHF complex subunit HOOK interacting protein 1A (FHIP1A) (FTS and Hook-interacting protein like) (FHIP-L) | EBI-34574576 | 0.27 |
Database | Links |
| UNIPROT | P04406 E7EUT4 P00354 Q53X65 |
| PDB | 1U8F 1ZNQ 3GPD 4WNC 4WNI 6ADE 6IQ6 6M61 6YND 6YNE 6YNF 6YNH |
| Pfam | PF02800 PF00044 |
| PROSITE | PS00071 |
| OMIM | 138400 |
| DisGeNET | 2597 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory