Prostaglandin E synthase 2 truncated form - Homo sapiens

Prostaglandin E synthase 2 truncated form (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Prostaglandin E synthase 2 truncated form
Accession Code	Q9H7Z7
Gene	PTGES2
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 377)
MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLGAAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVV EVNPVRRAEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQPLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPNVYRTPTEALAS FDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQPWYLRVERAITEASPAH

Subcellular Location

Description
Golgi apparatus membrane {Experimental EvidencePubMed:12835322}; Single-pass membrane protein {Sequence Analysis}. [Prostaglandin E synthase 2 truncated form]: Cytoplasm, perinuclear region {Experimental EvidencePubMed:12835322}. Note=Synthesized as a Golgi membrane-bound protein, which is further cleaved into the predominant soluble truncated form. The truncated form is cytoplasmic and is enriched in the perinuclear region. {Experimental EvidencePubMed:12835322}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Azurophil Granule Lumen (GO:0035578) Cytosol (GO:0005829) Extracellular Region (GO:0005576) Golgi Membrane (GO:0000139) Mitochondrion (GO:0005739) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Isomerase that catalyzes the conversion of PGH2 into the more stable prostaglandin E2 (PGE2) (in vitro) (PubMed:12804604, PubMed:18198127, PubMed:17585783). The biological function and the GSH- dependent property of PTGES2 is still under debate (PubMed:18198127, PubMed:17585783). In vivo, PTGES2 could form a complex with GSH and heme and would not participate in PGE2 synthesis but would catalyze the degradation of prostaglandin E2 H2 (PGH2) to 12(S)-hydroxy- 5(Z),8(E),10(E)-heptadecatrienoic acid (HHT) and malondialdehyde (MDA) (PubMed:17585783) (By similarity). {By SimilarityUniProtKB:Q9N0A4, Experimental EvidencePubMed:12804604, Experimental EvidencePubMed:17585783, Experimental EvidencePubMed:18198127}.
Assigned Ontology terms

Biological Process	Cyclooxygenase Pathway (GO:0019371) Lipid Metabolic Process (GO:0006629) Positive Regulation Of DNA-Templated Transcription (GO:0045893) Secretion (GO:0046903)
Molecular Function	12-Hydroxyheptadecatrienoic Acid Synthase Activity (GO:0036134) DNA Binding (GO:0003677) Glutathione Binding (GO:0043295) Heme Binding (GO:0020037) Lyase Activity (GO:0016829) Prostaglandin-E Synthase Activity (GO:0050220)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
K9N7C7	2'-O-methyltransferase	EBI-26374966	0.35
P0C6X7	2'-O-methyltransferase nsp16	EBI-26377188	0.35
P0DTD1	2'-O-methyltransferase nsp16	EBI-25491011	0.53
Interactions with other proteins (25 interactors)

Partner (UniProt)		IntAct	Confidence score
Q01780	Exosome component 10 (EC 3.1.13.-) (Autoantigen PM/Scl 2) (P100 polymyositis-scleroderma overlap syndrome-associated autoantigen) (Polymyositis/scleroderma autoantigen 100 kDa) (PM/Scl-100) (Polymyositis/scleroderma autoantigen 2)	EBI-373752	0.00
P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	EBI-1237540	0.35
P16104	Histone H2AX (H2a/x) (Histone H2A.X)	EBI-2564373	0.35
Q5NFN4	UvrABC system protein B (Protein UvrB) (Excinuclease ABC subunit B)	EBI-2803788	0.00
P0DOE9	Non-structural protein 1 (NS1) (Non-structural protein 1C)	EBI-6138583	0.35
P42858	Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment]	EBI-6452059	0.40
Q5VU69	Cilia- and flagella-associated protein 141	EBI-10308949	0.56
Q8IWL3	Iron-sulfur cluster co-chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial]	EBI-13943458	0.35
Q13296	Mammaglobin-A (Mammaglobin-1) (Secretoglobin family 2A member 2)	EBI-21513670	0.35
P61421	V-type proton ATPase subunit d 1 (V-ATPase subunit d 1) (32 kDa accessory protein) (V-ATPase 40 kDa accessory protein) (V-ATPase AC39 subunit) (p39) (Vacuolar proton pump subunit d 1)	EBI-21518921	0.35
P80370	Protein delta homolog 1 (DLK-1) (pG2) [Cleaved into: Fetal antigen 1 (FA1)]	EBI-21555448	0.35
Q07954	Prolow-density lipoprotein receptor-related protein 1 (LRP-1) (Alpha-2-macroglobulin receptor) (A2MR) (Apolipoprotein E receptor) (APOER) (CD antigen CD91) [Cleaved into: Low-density lipoprotein receptor-related protein 1 85 kDa subunit (LRP-85); Low-density lipoprotein receptor-related protein 1 515 kDa subunit (LRP-515); Low-density lipoprotein receptor-related protein 1 intracellular domain (LRPICD)]	EBI-21684279	0.35
O14949	Cytochrome b-c1 complex subunit 8 (Complex III subunit 8) (Complex III subunit VIII) (Ubiquinol-cytochrome c reductase complex 9.5 kDa protein) (Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C)	EBI-21689809	0.35
O60518	Ran-binding protein 6 (RanBP6)	EBI-21713634	0.35
Q9UG63	ATP-binding cassette sub-family F member 2 (Iron-inhibited ABC transporter 2)	EBI-21764870	0.35
Q8N140	EP300-interacting inhibitor of differentiation 3 (EID-3) (E1A-like inhibitor of differentiation 3) (EID-1-like inhibitor of differentiation 3) (Non-structural maintenance of chromosomes element 4 homolog B) (NS4EB) (Non-SMC element 4 homolog B)	EBI-21773860	0.35
E9PK12	Protein fuzzy homolog	EBI-21841096	0.35
Q0VDI3	Transmembrane protein 267	EBI-21891210	0.35
Q6UWI4	Protein shisa-2 homolog (Transmembrane protein 46)	EBI-21898440	0.35
O75208	Ubiquinone biosynthesis protein COQ9, mitochondrial	EBI-21930142	0.35
O00483	Cytochrome c oxidase subunit NDUFA4 (Complex I-MLRQ) (CI-MLRQ) (NADH-ubiquinone oxidoreductase MLRQ subunit)	EBI-21930681	0.35
Q9C002	Normal mucosa of esophagus-specific gene 1 protein (Protein FOAP-11)	EBI-21935327	0.35
P07550	Beta-2 adrenergic receptor (Beta-2 adrenoreceptor) (Beta-2 adrenoceptor)	EBI-20801899	0.37
A0A0H3LG06	ESAT-6-like protein	EBI-25401076	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35

Cross-References

Database	Links
UNIPROT	Q9H7Z7 Q53EW9 Q5SYV6 Q96GI0 Q96GL2
Pfam	PF13417
PROSITE	PS00195 PS51354 PS50405
OMIM	608152
DisGeNET	80142

Prostaglandin E synthase 2 truncated form (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Interactions with other proteins (25 interactors)

Cross-References

Database

Links

Description

Description