Protein Information |
|
---|---|
Protein Name | ORF7a protein |
Accession Code | P0DTC7 |
Gene | 7a |
Organism | Severe acute respiratory syndrome coronavirus 2 (Taxonomy: 2697049) |
Part of Reference Proteome? | Yes |
Sequence (Length: 121) | |
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRAR SVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE |
Structure Viewer (PDB: 6W37) |
---|
Description |
||
---|---|---|
Host cytoplasm, host perinuclear region {Experimental EvidencePubMed:33930332}. Virion {By SimilarityUniProtKB:P59635}. Host endoplasmic reticulum membrane {By SimilarityUniProtKB:P59635}; Single-pass membrane protein {By SimilarityUniProtKB:P59635}. Host endoplasmic reticulum-Golgi intermediate compartment membrane {By SimilarityUniProtKB:P59635}; Single-pass type I membrane protein {By SimilarityUniProtKB:P59635}. Host Golgi apparatus membrane {By SimilarityUniProtKB:P59635}; Single-pass membrane protein {By SimilarityUniProtKB:P59635}. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Host Perinuclear Region | SL-0382 | The host perinuclear region is the host cytoplasmic region just around the host nucleus. Note: This location is defined for viral proteins that appear in the perinuclear region of infected host cells | Membrane Topology |
Topology | Source | Annotation Type |
Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms |
Cellular Component | Host Cell Endoplasmic Reticulum Membrane (GO:0044167) Host Cell Endoplasmic Reticulum-Golgi Intermediate Compartment Membrane (GO:0044173) Host Cell Golgi Membrane (GO:0044178) Host Cell Perinuclear Region Of Cytoplasm (GO:0044220) Virion Membrane (GO:0055036) |
Description |
|
---|---|
Plays a role as antagonist of host tetherin (BST2), disrupting its antiviral effect. Acts by binding to BST2 and sequestering it to perinuclear region, thereby preventing its antiviral function at cell membrane. {Experimental EvidencePubMed:33930332}. | Assigned Ontology terms |
Biological Process | Modulation By Virus Of Host G0/G1 Transition Checkpoint (GO:0039646) Suppression By Virus Of Host Tetherin Activity (GO:0039587) Suppression By Virus Of Host Type I Interferon-Mediated Signaling Pathway (GO:0039502) |
Molecular Function |
Interactions with Nuclear Envelope proteins (11 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
O15027 | Protein transport protein Sec16A | EBI-25510184 | 0.35 |
P0DTD1 | 2'-O-methyltransferase nsp16 | EBI-25508859 | 0.62 |
Q8N1F7 | Nuclear pore complex protein Nup93 | EBI-25687011 | 0.35 |
Q5SRE5 | Nucleoporin NUP188 | EBI-25687011 | 0.35 |
P0DTC7 | Self | EBI-27121790 | 0.37 |
Q9Y6D6 | Brefeldin A-inhibited guanine nucleotide-exchange protein 1 | EBI-25687011 | 0.35 |
Q6NUT2 | Probable C-mannosyltransferase DPY19L2 | EBI-26495729 | 0.35 |
P50402 | Emerin | EBI-25510184 | 0.35 |
Q8N201 | Integrator complex subunit 1 | EBI-25687011 | 0.35 |
Q9H0H0 | Integrator complex subunit 2 | EBI-25687011 | 0.35 |
Q6P9B9 | Integrator complex subunit 5 | EBI-25687011 | 0.35 | Interactions with other proteins (104 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
Q9NU22 | Midasin (Dynein-related AAA-ATPase MDN1) (MIDAS-containing protein) | EBI-25491332 | 0.64 |
Q7Z4Q2 | HEAT repeat-containing protein 3 | EBI-25491332 | 0.53 |
P30153 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (Medium tumor antigen-associated 61 kDa protein) (PP2A subunit A isoform PR65-alpha) (PP2A subunit A isoform R1-alpha) | EBI-25510184 | 0.35 |
P06576 | ATP synthase subunit beta, mitochondrial (EC 7.1.2.2) (ATP synthase F1 subunit beta) | EBI-25510184 | 0.35 |
P40939 | Trifunctional enzyme subunit alpha, mitochondrial (78 kDa gastrin-binding protein) (Monolysocardiolipin acyltransferase) (EC 2.3.1.-) (TP-alpha) [Includes: Long-chain enoyl-CoA hydratase (EC 4.2.1.17); Long chain 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.211)] | EBI-25510184 | 0.35 |
Q8IXB1 | DnaJ homolog subfamily C member 10 (EC 1.8.4.-) (Endoplasmic reticulum DNA J domain-containing protein 5) (ER-resident protein ERdj5) (ERdj5) (Macrothioredoxin) (MTHr) | EBI-25510184 | 0.35 |
Q9UHI6 | Probable ATP-dependent RNA helicase DDX20 (EC 3.6.1.15) (EC 3.6.4.13) (Component of gems 3) (DEAD box protein 20) (DEAD box protein DP 103) (Gemin-3) | EBI-25510184 | 0.35 |
O95816 | BAG family molecular chaperone regulator 2 (BAG-2) (Bcl-2-associated athanogene 2) | EBI-25510184 | 0.35 |
P53007 | Tricarboxylate transport protein, mitochondrial (Citrate transport protein) (CTP) (Mitochondrial citrate carrier) (CIC) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein) | EBI-25510184 | 0.35 |
Q96EY1 | DnaJ homolog subfamily A member 3, mitochondrial (DnaJ protein Tid-1) (hTid-1) (Hepatocellular carcinoma-associated antigen 57) (Tumorous imaginal discs protein Tid56 homolog) | EBI-25510184 | 0.35 |
O43852 | Calumenin (Crocalbin) (IEF SSP 9302) | EBI-25510184 | 0.35 |
Q9H936 | Mitochondrial glutamate carrier 1 (GC-1) (Glutamate/H(+) symporter 1) (Solute carrier family 25 member 22) | EBI-25510184 | 0.35 |
P62195 | 26S proteasome regulatory subunit 8 (26S proteasome AAA-ATPase subunit RPT6) (Proteasome 26S subunit ATPase 5) (Proteasome subunit p45) (Thyroid hormone receptor-interacting protein 1) (TRIP1) (p45/SUG) | EBI-25510184 | 0.35 |
P30876 | DNA-directed RNA polymerase II subunit RPB2 (EC 2.7.7.6) (DNA-directed RNA polymerase II 140 kDa polypeptide) (DNA-directed RNA polymerase II subunit B) (RNA polymerase II subunit 2) (RNA polymerase II subunit B2) | EBI-25510184 | 0.35 |
Q99615 | DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) | EBI-25510184 | 0.35 |
P55786 | Puromycin-sensitive aminopeptidase (PSA) (EC 3.4.11.14) (Cytosol alanyl aminopeptidase) (AAP-S) | EBI-25510184 | 0.35 |
P57678 | Gem-associated protein 4 (Gemin-4) (Component of gems 4) (p97) | EBI-25510184 | 0.35 |
Q00325 | Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3) | EBI-25510184 | 0.35 |
O75746 | Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial (Araceli hiperlarga) (Aralar) (Aralar1) (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) | EBI-25510184 | 0.35 |
P34932 | Heat shock 70 kDa protein 4 (HSP70RY) (Heat shock 70-related protein APG-2) | EBI-25510184 | 0.35 |
Q15008 | 26S proteasome non-ATPase regulatory subunit 6 (26S proteasome regulatory subunit RPN7) (26S proteasome regulatory subunit S10) (Breast cancer-associated protein SGA-113M) (Phosphonoformate immuno-associated protein 4) (Proteasome regulatory particle subunit p44S10) (p42A) | EBI-25510184 | 0.35 |
Q9UNM6 | 26S proteasome non-ATPase regulatory subunit 13 (26S proteasome regulatory subunit RPN9) (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5) | EBI-25510184 | 0.35 |
O95071 | E3 ubiquitin-protein ligase UBR5 (EC 2.3.2.26) (E3 ubiquitin-protein ligase, HECT domain-containing 1) (HECT-type E3 ubiquitin transferase UBR5) (Hyperplastic discs protein homolog) (hHYD) (Progestin-induced protein) | EBI-25510184 | 0.35 |
O60884 | DnaJ homolog subfamily A member 2 (Cell cycle progression restoration gene 3 protein) (Dnj3) (Dj3) (HIRA-interacting protein 4) (Renal carcinoma antigen NY-REN-14) | EBI-25510184 | 0.35 |
P62191 | 26S proteasome regulatory subunit 4 (P26s4) (26S proteasome AAA-ATPase subunit RPT2) (Proteasome 26S subunit ATPase 1) | EBI-25510184 | 0.35 |
P05023 | Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1) | EBI-25510184 | 0.35 |
P51665 | 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit RPN8) (26S proteasome regulatory subunit S12) (Mov34 protein homolog) (Proteasome subunit p40) | EBI-25510184 | 0.35 |
P53618 | Coatomer subunit beta (Beta-coat protein) (Beta-COP) | EBI-25510184 | 0.35 |
Q9NZ01 | Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Synaptic glycoprotein SC2) (Trans-2,3-enoyl-CoA reductase) (TER) | EBI-25510184 | 0.35 |
P35998 | 26S proteasome regulatory subunit 7 (26S proteasome AAA-ATPase subunit RPT1) (Proteasome 26S subunit ATPase 2) | EBI-25510184 | 0.35 |
Q13200 | 26S proteasome non-ATPase regulatory subunit 2 (26S proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Protein 55.11) (Tumor necrosis factor type 1 receptor-associated protein 2) | EBI-25510184 | 0.35 |
P53621 | Coatomer subunit alpha (Alpha-coat protein) (Alpha-COP) (HEP-COP) (HEPCOP) [Cleaved into: Xenin (Xenopsin-related peptide); Proxenin] | EBI-25510184 | 0.35 |
Q5H9R7 | Serine/threonine-protein phosphatase 6 regulatory subunit 3 (SAPS domain family member 3) (Sporulation-induced transcript 4-associated protein SAPL) | EBI-25510184 | 0.35 |
P16615 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) (SR Ca(2+)-ATPase 2) (EC 7.2.2.10) (Calcium pump 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase) | EBI-25510184 | 0.35 |
Q99460 | 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit RPN2) (26S proteasome regulatory subunit S1) (26S proteasome subunit p112) | EBI-25510184 | 0.35 |
O43592 | Exportin-T (Exportin(tRNA)) (tRNA exportin) | EBI-25510184 | 0.53 |
Q9NXS2 | Glutaminyl-peptide cyclotransferase-like protein (EC 2.3.2.5) (Golgi-resident glutaminyl-peptide cyclotransferase) (isoQC) (gQC) | EBI-25510184 | 0.35 |
P46379 | Large proline-rich protein BAG6 (BAG family molecular chaperone regulator 6) (BCL2-associated athanogene 6) (BAG-6) (HLA-B-associated transcript 3) (Protein G3) (Protein Scythe) | EBI-25510184 | 0.35 |
Q16891 | MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89) | EBI-25510184 | 0.35 |
O95347 | Structural maintenance of chromosomes protein 2 (SMC protein 2) (SMC-2) (Chromosome-associated protein E) (hCAP-E) (XCAP-E homolog) | EBI-25510184 | 0.35 |
P35606 | Coatomer subunit beta' (Beta'-coat protein) (Beta'-COP) (p102) | EBI-25510184 | 0.35 |
Q9UBF2 | Coatomer subunit gamma-2 (Gamma-2-coat protein) (Gamma-2-COP) | EBI-25510184 | 0.35 |
Q9P035 | Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 (EC 4.2.1.134) (3-hydroxyacyl-CoA dehydratase 3) (HACD3) (Butyrate-induced protein 1) (B-ind1) (hB-ind1) (Protein-tyrosine phosphatase-like A domain-containing protein 1) | EBI-25510184 | 0.35 |
O14980 | Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog) | EBI-25510184 | 0.35 |
Q96CS3 | FAS-associated factor 2 (Protein ETEA) (UBX domain-containing protein 3B) (UBX domain-containing protein 8) | EBI-25510184 | 0.35 |
O60784 | Target of Myb1 membrane trafficking protein (Target of Myb protein 1) | EBI-26495729 | 0.35 |
Q9Y5K5 | Ubiquitin carboxyl-terminal hydrolase isozyme L5 (UCH-L5) (EC 3.4.19.12) (Ubiquitin C-terminal hydrolase UCH37) (Ubiquitin thioesterase L5) | EBI-26495729 | 0.35 |
Q13535 | Serine/threonine-protein kinase ATR (EC 2.7.11.1) (Ataxia telangiectasia and Rad3-related protein) (FRAP-related protein 1) | EBI-26495729 | 0.53 |
Q9Y385 | Ubiquitin-conjugating enzyme E2 J1 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme J1) (Non-canonical ubiquitin-conjugating enzyme 1) (NCUBE-1) (Yeast ubiquitin-conjugating enzyme UBC6 homolog E) (HsUBC6e) | EBI-26495729 | 0.35 |
Q13586 | Stromal interaction molecule 1 | EBI-26495729 | 0.35 |
P14314 | Glucosidase 2 subunit beta (80K-H protein) (Glucosidase II subunit beta) (Protein kinase C substrate 60.1 kDa protein heavy chain) (PKCSH) | EBI-26495729 | 0.35 |
P42858 | Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment] | EBI-26495729 | 0.35 |
P48741 | Putative heat shock 70 kDa protein 7 (Heat shock 70 kDa protein B) | EBI-26495729 | 0.35 |
Q13315 | Serine-protein kinase ATM (EC 2.7.11.1) (Ataxia telangiectasia mutated) (A-T mutated) | EBI-25687011 | 0.35 |
Q9Y617 | Phosphoserine aminotransferase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) (PSAT) | EBI-25687011 | 0.35 |
Q9UI26 | Importin-11 (Imp11) (Ran-binding protein 11) (RanBP11) | EBI-25687011 | 0.35 |
Q9UI09 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 (13 kDa differentiation-associated protein) (Complex I-B17.2) (CI-B17.2) (CIB17.2) (NADH-ubiquinone oxidoreductase subunit B17.2) | EBI-25687011 | 0.35 |
Q9NVI1 | Fanconi anemia group I protein (Protein FACI) | EBI-25687011 | 0.35 |
Q9HD20 | Endoplasmic reticulum transmembrane helix translocase (EC 7.4.2.-) (Endoplasmic reticulum P5A-ATPase) | EBI-25687011 | 0.35 |
Q9HAV4 | Exportin-5 (Exp5) (Ran-binding protein 21) | EBI-25687011 | 0.35 |
Q9H9P8 | L-2-hydroxyglutarate dehydrogenase, mitochondrial (EC 1.1.99.2) (Duranin) | EBI-25687011 | 0.35 |
Q9H7D0 | Dedicator of cytokinesis protein 5 | EBI-25687011 | 0.35 |
Q9H6E5 | Speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) (EC 2.7.7.19) (RNA-binding motif protein 21) (RNA-binding protein 21) (U6 snRNA-specific terminal uridylyltransferase 1) (U6-TUTase) (EC 2.7.7.52) | EBI-25687011 | 0.35 |
Q9H0V1 | Transmembrane protein 168 | EBI-25687011 | 0.35 |
Q9BXW9 | Fanconi anemia group D2 protein (Protein FACD2) | EBI-25687011 | 0.35 |
Q9BSE5 | Agmatinase, mitochondrial (EC 3.5.3.11) (Agmatine ureohydrolase) (AUH) | EBI-25687011 | 0.35 |
Q96JJ3 | Engulfment and cell motility protein 2 (Protein ced-12 homolog A) (hCed-12A) | EBI-25687011 | 0.35 |
Q96JB2 | Conserved oligomeric Golgi complex subunit 3 (COG complex subunit 3) (Component of oligomeric Golgi complex 3) (Vesicle-docking protein SEC34 homolog) (p94) | EBI-25687011 | 0.35 |
Q96HW7 | Integrator complex subunit 4 (Int4) | EBI-25687011 | 0.35 |
Q96CB8 | Integrator complex subunit 12 (Int12) (PHD finger protein 22) | EBI-25687011 | 0.35 |
Q8WTW3 | Conserved oligomeric Golgi complex subunit 1 (COG complex subunit 1) (Component of oligomeric Golgi complex 1) | EBI-25687011 | 0.35 |
Q8TB37 | Iron-sulfur protein NUBPL (IND1 homolog) (Nucleotide-binding protein-like) (huInd1) | EBI-25687011 | 0.35 |
Q8NCM8 | Cytoplasmic dynein 2 heavy chain 1 (Cytoplasmic dynein 2 heavy chain) (Dynein cytoplasmic heavy chain 2) (Dynein heavy chain 11) (hDHC11) (Dynein heavy chain isotype 1B) | EBI-25687011 | 0.35 |
Q8N9R8 | Protein SCAI (Suppressor of cancer cell invasion protein) | EBI-25687011 | 0.35 |
Q8N1F8 | Serine/threonine-protein kinase 11-interacting protein (LKB1-interacting protein 1) | EBI-25687011 | 0.35 |
Q86XI2 | Condensin-2 complex subunit G2 (Chromosome-associated protein G2) (CAP-G2) (hCAP-G2) (Leucine zipper protein 5) (Non-SMC condensin II complex subunit G2) | EBI-25687011 | 0.35 |
Q86UT6 | NLR family member X1 (Caterpiller protein 11.3) (CLR11.3) (Nucleotide-binding oligomerization domain protein 5) (Nucleotide-binding oligomerization domain protein 9) | EBI-25687011 | 0.35 |
Q75QN2 | Integrator complex subunit 8 (Int8) (Protein kaonashi-1) | EBI-25687011 | 0.35 |
Q70CQ2 | Ubiquitin carboxyl-terminal hydrolase 34 (EC 3.4.19.12) (Deubiquitinating enzyme 34) (Ubiquitin thioesterase 34) (Ubiquitin-specific-processing protease 34) | EBI-25687011 | 0.35 |
Q6YHU6 | Thyroid adenoma-associated protein (Gene inducing thyroid adenomas protein) | EBI-25687011 | 0.35 |
Q6P3X3 | Tetratricopeptide repeat protein 27 (TPR repeat protein 27) | EBI-25687011 | 0.35 |
Q63HN8 | E3 ubiquitin-protein ligase RNF213 (EC 2.3.2.27) (EC 3.6.4.-) (ALK lymphoma oligomerization partner on chromosome 17) (E3 ubiquitin-lipopolysaccharide ligase RNF213) (EC 2.3.2.-) (Mysterin) (RING finger protein 213) | EBI-25687011 | 0.35 |
Q5UIP0 | Telomere-associated protein RIF1 (Rap1-interacting factor 1 homolog) | EBI-25687011 | 0.35 |
Q53R41 | FAST kinase domain-containing protein 1, mitochondrial | EBI-25687011 | 0.35 |
Q29RF7 | Sister chromatid cohesion protein PDS5 homolog A (Cell proliferation-inducing gene 54 protein) (Sister chromatid cohesion protein 112) (SCC-112) | EBI-25687011 | 0.35 |
Q15386 | Ubiquitin-protein ligase E3C (EC 2.3.2.26) (HECT-type ubiquitin transferase E3C) (Homologous to E6AP carboxyl terminus homologous protein 2) (HectH2) (RTA-associated ubiquitin ligase) (RAUL) | EBI-25687011 | 0.35 |
Q14746 | Conserved oligomeric Golgi complex subunit 2 (COG complex subunit 2) (Component of oligomeric Golgi complex 2) (Low density lipoprotein receptor defect C-complementing protein) | EBI-25687011 | 0.35 |
Q01813 | ATP-dependent 6-phosphofructokinase, platelet type (ATP-PFK) (PFK-P) (EC 2.7.1.11) (6-phosphofructokinase type C) (Phosphofructo-1-kinase isozyme C) (PFK-C) (Phosphohexokinase) | EBI-25687011 | 0.35 |
P83436 | Conserved oligomeric Golgi complex subunit 7 (COG complex subunit 7) (Component of oligomeric Golgi complex 7) | EBI-25687011 | 0.35 |
P42695 | Condensin-2 complex subunit D3 (Non-SMC condensin II complex subunit D3) (hCAP-D3) | EBI-25687011 | 0.35 |
P21359 | Neurofibromin (Neurofibromatosis-related protein NF-1) [Cleaved into: Neurofibromin truncated] | EBI-25687011 | 0.35 |
P11498 | Pyruvate carboxylase, mitochondrial (EC 6.4.1.1) (Pyruvic carboxylase) (PCB) | EBI-25687011 | 0.35 |
P04181 | Ornithine aminotransferase, mitochondrial (EC 2.6.1.13) (Ornithine delta-aminotransferase) (Ornithine--oxo-acid aminotransferase) [Cleaved into: Ornithine aminotransferase, hepatic form; Ornithine aminotransferase, renal form] | EBI-25687011 | 0.35 |
O95759 | TBC1 domain family member 8 (AD 3) (Vascular Rab-GAP/TBC-containing protein) | EBI-25687011 | 0.35 |
O94822 | E3 ubiquitin-protein ligase listerin (EC 2.3.2.27) (RING finger protein 160) (RING-type E3 ubiquitin transferase listerin) (Zinc finger protein 294) | EBI-25687011 | 0.35 |
O75063 | Glycosaminoglycan xylosylkinase (EC 2.7.1.-) (Xylose kinase) | EBI-25687011 | 0.35 |
O60518 | Ran-binding protein 6 (RanBP6) | EBI-25687011 | 0.35 |
O43156 | TELO2-interacting protein 1 homolog (Protein SMG10) | EBI-25687011 | 0.35 |
O14981 | TATA-binding protein-associated factor 172 (EC 3.6.4.-) (ATP-dependent helicase BTAF1) (B-TFIID transcription factor-associated 170 kDa subunit) (TAF(II)170) (TBP-associated factor 172) (TAF-172) | EBI-25687011 | 0.35 |
P0DTC5 | Membrane protein (M) (E1 glycoprotein) (Matrix glycoprotein) (Membrane glycoprotein) | EBI-27121890 | 0.37 |
P0DTD8 | ORF7b protein (ORF7b) (Accessory protein 7b) | EBI-27121899 | 0.37 |
P43353 | Aldehyde dehydrogenase family 3 member B1 (EC 1.2.1.28) (EC 1.2.1.5) (EC 1.2.1.7) (Aldehyde dehydrogenase 7) | EBI-27127130 | 0.40 |
P31639 | Sodium/glucose cotransporter 2 (Na(+)/glucose cotransporter 2) (Low affinity sodium-glucose cotransporter) (Solute carrier family 5 member 2) | EBI-27128324 | 0.27 |
Q10589 | Bone marrow stromal antigen 2 (BST-2) (HM1.24 antigen) (Tetherin) (CD antigen CD317) | EBI-28948095 | 0.40 |