Nuclear pore complex protein Nup93 - Homo sapiens

Nuclear pore complex protein Nup93 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Nuclear pore complex protein Nup93
Accession Code	Q8N1F7
Gene	NUP93
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 819)
MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKASVLLGSRGLDISHISQRLES LSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESMLVEWEQVKQRILHTLLASGEDALDFTQ ESEPSYISDVGPPGRSSLDNIEMAYARQIYIYNEKIVNGHLQPNLVDLCASVAELDDKSISDMWTMVKQMTDVLLTPATD ALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIKLPAPLPGLQDGEVEGHPVWA LIYYCMRCGDLLAASQVVNRAQHQLGEFKTWFQEYMNSKDRRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDVT DNQSEVADKTEDYLWLKLNQVCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLF RMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDS QGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDKFTSDTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLE LMNKLLSPVVPQISAPQSNKERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLV PLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIP YRTSGDTNARLVQMEVLMN

Structure Viewer (PDB: 7PER)

Subcellular Location

Description
Nucleus membrane {By SimilarityUniProtKB:Q66HC5}; Peripheral membrane protein {By SimilarityUniProtKB:Q66HC5}. Nucleus, nuclear pore complex {Experimental EvidencePubMed:12802065, Experimental EvidencePubMed:15229283, Experimental EvidencePubMed:9348540}. Nucleus envelope {ECO:0000269\|PubMed:26878725, Experimental EvidencePubMed:9348540}. Note=Localizes at the nuclear basket and at or near the nuclear entry to the gated channel of the pore. {Experimental EvidencePubMed:9348540}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	By Similarity {ECO:0000250\|UniProtKB:Q66HC5}
Assigned Ontology terms

Cellular Component	Centrosome (GO:0005813) Cytosol (GO:0005829) Membrane (GO:0016020) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Periphery (GO:0034399) Nuclear Pore (GO:0005643)

Biology & Function

Description
Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance (PubMed:9348540). May anchor nucleoporins, but not NUP153 and TPR, to the NPC. During renal development, regulates podocyte migration and proliferation through SMAD4 signaling (PubMed:26878725). {Experimental EvidencePubMed:15229283, Experimental EvidencePubMed:15703211, Experimental EvidencePubMed:26878725, Experimental EvidencePubMed:9348540}.
Assigned Ontology terms

Biological Process	Nuclear Envelope Organization (GO:0006998) Nuclear Pore Complex Assembly (GO:0051292) Nucleocytoplasmic Transport (GO:0006913) Poly(A)+ MRNA Export From Nucleus (GO:0016973) Positive Regulation Of SMAD Protein Signal Transduction (GO:0060391) Protein Import Into Nucleus (GO:0006606) SMAD Protein Signal Transduction (GO:0060395)
Molecular Function	Structural Constituent Of Nuclear Pore (GO:0017056)

Disease associations

Description
Nephrotic syndrome 12 (NPHS12) [MIM:616892]: A form of nephrotic syndrome, a renal disease clinically characterized by severe proteinuria, resulting in complications such as hypoalbuminemia, hyperlipidemia and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form and progress to end-stage renal failure. NPHS12 inheritance is autosomal recessive. {Experimental EvidencePubMed:26878725}. Note=The disease is caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	614351 616892
DisGeNET	9688

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (20 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
A0A142I5B9	RNA-directed RNA polymerase NS5	EBI-20626314	0.35
O43542	DNA repair protein XRCC3	EBI-11129266	0.35
P63279	SUMO-conjugating enzyme UBC9	EBI-11105225	0.35
Q6PFD9	Nuclear pore complex protein Nup96	EBI-10994876	0.35
Q9ERU9	E3 SUMO-protein ligase RanBP2	EBI-10999306	0.35
Q96EE3	Nucleoporin SEH1	EBI-11086798	0.35
Q9NV29	Transmembrane protein 100	EBI-24472902	0.56
Q921C5	Protein bicaudal D homolog 2	EBI-15847893	0.35
Q8WYP5	Protein ELYS	EBI-9050350	0.40
P04626	Receptor tyrosine-protein kinase erbB-2	EBI-32721465	0.27
Q14974	Importin subunit beta-1	EBI-11115566	0.35
Q6ZMQ8	Serine/threonine-protein kinase LMTK1	EBI-32723474	0.27
P0DTC7	ORF7a protein	EBI-25687011	0.35
P57740	Nuclear pore complex protein Nup107	EBI-11160436	0.35
Q8BH74	Nuclear pore complex protein Nup107	EBI-10997196	0.35
P49790	Nuclear pore complex protein Nup153	EBI-11076796	0.35
Q6ZQH8	Nucleoporin NUP188	EBI-2563113	0.56
Q80U93	Nuclear pore complex protein Nup214	EBI-2555228	0.56
Q8NFH5	Nucleoporin NUP35	EBI-11889606	0.37
Q9BVL2	Nucleoporin p58/p45	EBI-11077390	0.35
Interactions with other proteins (87 interactors)

Partner (UniProt)		IntAct	Confidence score
O75365	Protein tyrosine phosphatase type IVA 3 (EC 3.1.3.48) (PRL-R) (Protein-tyrosine phosphatase 4a3) (Protein-tyrosine phosphatase of regenerating liver 3) (PRL-3)	EBI-1059612	0.00
Q9Y5J5	Pleckstrin homology-like domain family A member 3 (TDAG51/Ipl homolog 1)	EBI-1064828	0.00
P49662	Caspase-4 (CASP-4) (EC 3.4.22.57) (ICE and Ced-3 homolog 2) (ICH-2) (ICE(rel)-II) (Mih1) (Protease TX) [Cleaved into: Caspase-4 subunit p10; Caspase-4 subunit p20]	EBI-1066732	0.00
P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	EBI-3893169	0.56
Q9HC98	Serine/threonine-protein kinase Nek6 (EC 2.7.11.1) (Never in mitosis A-related kinase 6) (NimA-related protein kinase 6) (Protein kinase SID6-1512)	EBI-1069660	0.00
Q13418	Integrin-linked protein kinase (EC 2.7.11.1) (59 kDa serine/threonine-protein kinase) (Beta-integrin-linked kinase) (ILK-1) (ILK-2) (p59ILK)	EBI-1070407	0.00
P62330	ADP-ribosylation factor 6 (EC 3.6.5.2)	EBI-1071623	0.00
Q9HAW0	Transcription factor IIIB 50 kDa subunit (TFIIIB50) (hTFIIIB50) (B-related factor 2) (BRF-2) (hBRFU)	EBI-1072446	0.00
O14908	PDZ domain-containing protein GIPC1 (GAIP C-terminus-interacting protein) (RGS-GAIP-interacting protein) (RGS19-interacting protein 1) (Synectin) (Tax interaction protein 2) (TIP-2)	EBI-1073459	0.00
Q9Y478	5'-AMP-activated protein kinase subunit beta-1 (AMPK subunit beta-1) (AMPKb)	EBI-1076145	0.00
Q9BUV8	Respirasome Complex Assembly Factor 1 (Rab5-interacting protein) (RIP5)	EBI-1076761	0.00
Q15714	TSC22 domain family protein 1 (Cerebral protein 2) (Regulatory protein TSC-22) (TGFB-stimulated clone 22 homolog) (Transforming growth factor beta-1-induced transcript 4 protein)	EBI-1078435	0.00
Q99623	Prohibitin-2 (B-cell receptor-associated protein BAP37) (D-prohibitin) (Repressor of estrogen receptor activity)	EBI-1078910	0.00
O00422	Histone deacetylase complex subunit SAP18 (18 kDa Sin3-associated polypeptide) (2HOR0202) (Cell growth-inhibiting gene 38 protein) (Sin3-associated polypeptide p18)	EBI-1079733	0.00
Q96T60	Bifunctional polynucleotide phosphatase/kinase (DNA 5'-kinase/3'-phosphatase) (Polynucleotide kinase-3'-phosphatase) [Includes: Polynucleotide 3'-phosphatase (EC 3.1.3.32) (2'(3')-polynucleotidase); Polynucleotide 5'-hydroxyl-kinase (EC 2.7.1.78)]	EBI-1079805	0.00
Q9Y2Q3	Glutathione S-transferase kappa 1 (EC 2.5.1.18) (GST 13-13) (GST class-kappa) (GSTK1-1) (hGSTK1) (Glutathione S-transferase subunit 13)	EBI-1080109	0.00
O76071	Probable cytosolic iron-sulfur protein assembly protein CIAO1 (WD repeat-containing protein 39)	EBI-1083915	0.00
Q8AZK7	Epstein-Barr nuclear antigen leader protein (EBNA-LP) (EBV nuclear antigen leader protein) (Epstein-Barr nuclear antigen 5) (EBNA-5) (EBV nuclear antigen 5)	EBI-9632715	0.35
Q8IY92	Structure-specific endonuclease subunit SLX4 (BTB/POZ domain-containing protein 12)	EBI-2371551	0.35
Q504Q3	PAN2-PAN3 deadenylation complex catalytic subunit PAN2 (EC 3.1.13.4) (Inactive ubiquitin carboxyl-terminal hydrolase 52) (PAB1P-dependent poly(A)-specific ribonuclease) (Poly(A)-nuclease deadenylation complex subunit 2) (PAN deadenylation complex subunit 2)	EBI-2513052	0.40
P24386	Rab proteins geranylgeranyltransferase component A 1 (Choroideremia protein) (Rab escort protein 1) (REP-1) (TCD protein)	EBI-2515120	0.40
Q9Z0E3	Autoimmune regulator (Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein homolog) (APECED protein homolog)	EBI-2549710	0.35
O43918	Autoimmune regulator (Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein) (APECED protein)	EBI-2550555	0.40
Q99459	Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein)	EBI-7954144	0.35
Q13286	Battenin (Batten disease protein) (Protein CLN3)	EBI-3248480	0.35
O00716	Transcription factor E2F3 (E2F-3)	EBI-7600105	0.35
P0DOE9	Non-structural protein 1 (NS1) (Non-structural protein 1C)	EBI-6138583	0.35
P19320	Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106)	EBI-6189915	0.35
Q77M19	V protein	EBI-6268389	0.35
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
Q9UKV0	Histone deacetylase 9 (HD9) (EC 3.5.1.98) (Histone deacetylase 7B) (HD7) (HD7b) (Histone deacetylase-related protein) (MEF2-interacting transcription repressor MITR)	EBI-6598230	0.35
Q96DB2	Histone deacetylase 11 (HD11) (EC 3.5.1.98)	EBI-6598272	0.35
Q96FW1	Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1)	EBI-10770028	0.35
E9PUA5	Kinesin-like protein	EBI-10999661	0.35
Q8VE37	Regulator of chromosome condensation (Chromosome condensation protein 1)	EBI-11043815	0.35
P63280	SUMO-conjugating enzyme UBC9 (EC 2.3.2.-) (RING-type E3 SUMO transferase UBC9) (SUMO-protein ligase) (Ubiquitin carrier protein 9) (mUBC9) (Ubiquitin carrier protein I) (Ubiquitin-conjugating enzyme E2 I) (Ubiquitin-protein ligase I)	EBI-11044140	0.35
Q07797	Galectin-3-binding protein (Cyp-C-associated protein) (CyCAP) (Lectin galactoside-binding soluble 3-binding protein) (Protein MAMA)	EBI-11108624	0.35
O60733	85/88 kDa calcium-independent phospholipase A2 (CaI-PLA2) (EC 3.1.1.4) (2-lysophosphatidylcholine acylhydrolase) (EC 3.1.1.5) (Group VI phospholipase A2) (GVI PLA2) (Intracellular membrane-associated calcium-independent phospholipase A2 beta) (iPLA2-beta) (Palmitoyl-CoA hydrolase) (EC 3.1.2.2) (Patatin-like phospholipase domain-containing protein 9) (PNPLA9)	EBI-24312432	0.56
Q15777	Metallophosphoesterase MPPED2 (EC 3.1.-.-) (Fetal brain protein 239) (239FB) (Metallophosphoesterase domain-containing protein 2)	EBI-24327809	0.56
Q14982	Opioid-binding protein/cell adhesion molecule (OBCAM) (OPCML) (Opioid-binding cell adhesion molecule) (IgLON family member 1)	EBI-24419380	0.56
O43299	AP-5 complex subunit zeta-1 (Adaptor-related protein complex 5 zeta subunit) (Zeta5)	EBI-24468599	0.56
P06465	Protein E7	EBI-26504492	0.37
P56180	Putative tyrosine-protein phosphatase TPTE (EC 3.1.3.48) (Cancer/testis antigen 44) (CT44) (Transmembrane phosphatase with tensin homology) (Tumor antigen BJ-HCC-5)	EBI-14025693	0.35
Q9NWT8	Aurora kinase A-interacting protein (AURKA-interacting protein) (28S ribosomal protein S38, mitochondrial) (MRP-S38) (Mitochondrial small ribosomal subunit protein mS38)	EBI-16786806	0.27
O15155	BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18)	EBI-16788067	0.27
Q96I36	Cytochrome c oxidase assembly protein COX14	EBI-16791250	0.27
O14880	Microsomal glutathione S-transferase 3 (Microsomal GST-3) (Glutathione peroxidase MGST3) (EC 1.11.1.-) (LTC4 synthase MGST3) (EC 4.4.1.20) (Microsomal glutathione S-transferase III) (Microsomal GST-III)	EBI-16796348	0.27
P62491	Ras-related protein Rab-11A (Rab-11) (EC 3.6.5.2) (YL8)	EBI-16797971	0.27
P51151	Ras-related protein Rab-9A	EBI-16798325	0.27
O75880	Protein SCO1 homolog, mitochondrial	EBI-16799233	0.27
Q71U36	Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain]	EBI-16799705	0.27
O43493	Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2)	EBI-16800265	0.27
Q15388	Mitochondrial import receptor subunit TOM20 homolog (Mitochondrial 20 kDa outer membrane protein) (Outer mitochondrial membrane receptor Tom20)	EBI-16801791	0.27
Q9NS69	Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog)	EBI-16802054	0.27
P36957	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K)	EBI-20305285	0.35
P08559	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I)	EBI-20306509	0.35
P00441	Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) (Superoxide dismutase 1) (hSod1)	EBI-20307497	0.35
A2A935	Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1)	EBI-21022882	0.35
P14404	Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog)	EBI-21026252	0.35
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-21360986	0.35
Q9H1C4	Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1)	EBI-21266770	0.35
Q8N4T4	Rho guanine nucleotide exchange factor 39	EBI-25408280	0.35
Q14CB8	Rho GTPase-activating protein 19 (Rho-type GTPase-activating protein 19)	EBI-25409097	0.35
Q8WUY9	DEP domain-containing protein 1B (HBV X-transactivated gene 8 protein) (HBV XAg-transactivated protein 8)	EBI-25411615	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
Q5EP34	Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2)	EBI-25772822	0.35
P52298	Nuclear cap-binding protein subunit 2 (20 kDa nuclear cap-binding protein) (Cell proliferation-inducing gene 55 protein) (NCBP 20 kDa subunit) (CBP20) (NCBP-interacting protein 1) (NIP1)	EBI-26397631	0.35
P48431	Transcription factor SOX-2	EBI-26574619	0.35
Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	EBI-27110926	0.35
Q8NCK7	Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11)	EBI-27103180	0.35
Q05D32	CTD small phosphatase-like protein 2 (CTDSP-like 2) (EC 3.1.3.-)	EBI-27113232	0.35
Q13283	Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1)	EBI-28955349	0.35
Q8TDD2	Transcription factor Sp7 (Zinc finger protein osterix)	EBI-29000537	0.35
P08047	Transcription factor Sp1	EBI-29385496	0.35
P30530	Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene)	EBI-32719959	0.27
P11362	Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331)	EBI-32721578	0.27
P22607	Fibroblast growth factor receptor 3 (FGFR-3) (EC 2.7.10.1) (CD antigen CD333)	EBI-32721979	0.27
P17948	Vascular endothelial growth factor receptor 1 (VEGFR-1) (EC 2.7.10.1) (Fms-like tyrosine kinase 1) (FLT-1) (Tyrosine-protein kinase FRT) (Tyrosine-protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor)	EBI-32722433	0.27
P36888	Receptor-type tyrosine-protein kinase FLT3 (EC 2.7.10.1) (FL cytokine receptor) (Fetal liver kinase-2) (FLK-2) (Fms-like tyrosine kinase 3) (FLT-3) (Stem cell tyrosine kinase 1) (STK-1) (CD antigen CD135)	EBI-32722567	0.27
P35916	Vascular endothelial growth factor receptor 3 (VEGFR-3) (EC 2.7.10.1) (Fms-like tyrosine kinase 4) (FLT-4) (Tyrosine-protein kinase receptor FLT4)	EBI-32722728	0.27
P35968	Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase insert domain receptor) (KDR) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309)	EBI-32723270	0.27
Q8IWU2	Serine/threonine-protein kinase LMTK2 (EC 2.7.11.1) (Apoptosis-associated tyrosine kinase 2) (Brain-enriched kinase) (hBREK) (CDK5/p35-regulated kinase) (CPRK) (Kinase/phosphatase/inhibitor 2) (Lemur tyrosine kinase 2) (Serine/threonine-protein kinase KPI-2)	EBI-32723604	0.27
Q96Q04	Serine/threonine-protein kinase LMTK3 (EC 2.7.11.1) (Lemur tyrosine kinase 3)	EBI-32723651	0.27
Q12866	Tyrosine-protein kinase Mer (EC 2.7.10.1) (Proto-oncogene c-Mer) (Receptor tyrosine kinase MerTK)	EBI-32723870	0.27
Q01973	Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Neurotrophic tyrosine kinase, receptor-related 1)	EBI-32725295	0.27
P08922	Proto-oncogene tyrosine-protein kinase ROS (EC 2.7.10.1) (Proto-oncogene c-Ros) (Proto-oncogene c-Ros-1) (Receptor tyrosine kinase c-ros oncogene 1) (c-Ros receptor tyrosine kinase)	EBI-32731758	0.27
Q02763	Angiopoietin-1 receptor (EC 2.7.10.1) (Endothelial tyrosine kinase) (Tunica interna endothelial cell kinase) (Tyrosine kinase with Ig and EGF homology domains-2) (Tyrosine-protein kinase receptor TEK) (Tyrosine-protein kinase receptor TIE-2) (hTIE2) (p140 TEK) (CD antigen CD202b)	EBI-32732012	0.35

Cross-References

Database	Links
UNIPROT	Q8N1F7 B3KPQ8 Q14705
PDB	5IJN 5IJO 7PER
Pfam	PF04097
OMIM	614351 616892
DisGeNET	9688

Nuclear pore complex protein Nup93 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 7PER)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (20 interactors)

Interactions with other proteins (87 interactors)

Cross-References

Database

Links

Description

Description