Translin-associated protein X - Homo sapiens

Translin-associated protein X (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Translin-associated protein X
Accession Code	Q99598
Gene	TSNAX
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 290)
MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSA PDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDNG KENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVS KKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS

Structure Viewer (PDB: 3PJA)

Subcellular Location

Description
Cytoplasm, perinuclear region. Golgi apparatus {By Similarity}. Nucleus. Note=Accumulate in the Golgi complex of mid- late pachytene spermatocytes (By similarity). Expressed in the cytoplasm in the presence of TSN. {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Endoribonuclease Complex (GO:1902555) Golgi Apparatus (GO:0005794) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Acts in combination with TSN as an endonuclease involved in the activation of the RNA-induced silencing complex (RISC). Possible role in spermatogenesis. {Experimental EvidencePubMed:12036294, Experimental EvidencePubMed:21552258}.
Assigned Ontology terms

Biological Process	Cell Differentiation (GO:0030154) SiRNA Processing (GO:0030422) Spermatogenesis (GO:0007283)
Molecular Function	A2A Adenosine Receptor Binding (GO:0031687) DNA Binding (GO:0003677) Endoribonuclease Activity (GO:0004521) Metal Ion Binding (GO:0046872) Protein-Containing Complex Binding (GO:0044877) RNA Binding (GO:0003723) Sequence-Specific DNA Binding (GO:0043565) Single-Stranded DNA Binding (GO:0003697)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (10 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q99598	Self	EBI-7635031	0.22
P41208	Centrin-2	EBI-11044893	0.35
Q07065	Cytoskeleton-associated protein 4	EBI-3936346	0.37
O75190	DnaJ homolog subfamily B member 6	EBI-25909865	0.56
Q53GS7	mRNA export factor GLE1	EBI-25859066	0.56
Q92993	Histone acetyltransferase KAT5	EBI-25912186	0.56
P07948	Tyrosine-protein kinase Lyn	EBI-11044893	0.35
P35240	Merlin	EBI-25878206	0.56
Q9BVL2	Nucleoporin p58/p45	EBI-25907995	0.56
P01112	GTPase HRas, N-terminally processed	EBI-25868927	0.56
Interactions with other proteins (125 interactors)

Partner (UniProt)		IntAct	Confidence score
Q15631	Translin (EC 3.1.-.-) (Component 3 of promoter of RISC) (C3PO)	EBI-7635091	0.90
O95257	Growth arrest and DNA damage-inducible protein GADD45 gamma (Cytokine-responsive protein CR6) (DNA damage-inducible transcript 2 protein) (DDIT-2)	EBI-753271	0.67
Q96AQ6	Pre-B-cell leukemia transcription factor-interacting protein 1 (Hematopoietic PBX-interacting protein)	EBI-756436	0.37
Q96HT8	MORF4 family-associated protein 1-like 1	EBI-757081	0.37
Q14164	Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i)	EBI-1081213	0.00
Q96GY3	Protein lin-37 homolog (Antolefinin)	EBI-1389981	0.35
Q86SE5	RNA-binding Raly-like protein (hRALYL) (Heterogeneous nuclear ribonucleoprotein C-like 3) (hnRNP core protein C-like 3)	EBI-2320509	0.37
Q09019	Dystrophia myotonica WD repeat-containing protein (Dystrophia myotonica-containing WD repeat motif protein) (Protein 59) (Protein DMR-N9)	EBI-2515767	0.40
Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	EBI-2685764	0.00
Q5NHY7	Fumarate hydratase class II (Fumarase C) (EC 4.2.1.2) (Aerobic fumarase) (Iron-independent fumarase)	EBI-2800088	0.00
Q5NIJ6	Citrate synthase	EBI-2800081	0.00
A0A6L8PNZ7	DUF664 domain-containing protein	EBI-2812187	0.00
A0A6L8PSD4	Glycosyl transferase, group 1 family protein	EBI-2813947	0.00
A0A6L7HFM3	Pyruvate carboxylase (EC 6.4.1.1)	EBI-2819985	0.00
A0A6L7H9A7	UvrABC system protein A (UvrA protein) (Excinuclease ABC subunit A)	EBI-2819971	0.00
A0A6L8PSA0	Putative aminoglycoside 6-adenylyltransferase	EBI-2819978	0.00
A0A2B8HUE3	Organic hydroperoxide resistance protein	EBI-2819964	0.00
P40127	Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase)	EBI-2844107	0.00
Q8CZK5	Biphosphate aldolase (Putative class-II fructose-bisphosphate aldolase)	EBI-2851318	0.00
Q09472	Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-)	EBI-3940497	0.37
Q6P597	Kinesin light chain 3 (KLC2-like) (kinesin light chain 2)	EBI-25263666	0.63
Q8TDH9	Biogenesis of lysosome-related organelles complex 1 subunit 5 (BLOC-1 subunit 5) (Protein Muted homolog)	EBI-10274996	0.72
Q12904	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (Multisynthase complex auxiliary component p43) [Cleaved into: Endothelial monocyte-activating polypeptide 2 (EMAP-2) (Endothelial monocyte-activating polypeptide II) (EMAP-II) (Small inducible cytokine subfamily E member 1)]	EBI-10294455	0.56
Q99081	Transcription factor 12 (TCF-12) (Class B basic helix-loop-helix protein 20) (bHLHb20) (DNA-binding protein HTF4) (E-box-binding protein) (Transcription factor HTF-4)	EBI-10294477	0.56
Q9BRK4	Leucine zipper putative tumor suppressor 2 (hLZTS2) (Protein LAPSER1)	EBI-10294487	0.56
Q9H257	Caspase recruitment domain-containing protein 9 (hCARD9)	EBI-10294499	0.56
P62070	Ras-related protein R-Ras2 (EC 3.6.5.-) (Ras-like protein TC21) (Teratocarcinoma oncogene)	EBI-11044893	0.35
O60506	Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) (Glycine- and tyrosine-rich RNA-binding protein) (GRY-RBP) (NS1-associated protein 1) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein)	EBI-11044893	0.35
P07686	Beta-hexosaminidase subunit beta (EC 3.2.1.52) (Beta-N-acetylhexosaminidase subunit beta) (Hexosaminidase subunit B) (Cervical cancer proto-oncogene 7 protein) (HCC-7) (N-acetyl-beta-glucosaminidase subunit beta) [Cleaved into: Beta-hexosaminidase subunit beta chain B; Beta-hexosaminidase subunit beta chain A]	EBI-11044893	0.35
Q5BKY9	Protein FAM133B	EBI-11044893	0.35
P06241	Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn)	EBI-11044893	0.35
O15427	Monocarboxylate transporter 4 (MCT 4) (Solute carrier family 16 member 3)	EBI-11044893	0.35
O75223	Gamma-glutamylcyclotransferase (EC 4.3.2.9) (Cytochrome c-releasing factor 21)	EBI-11044893	0.35
O00139	Kinesin-like protein KIF2A (Kinesin-2) (hK2)	EBI-11044893	0.35
Q9HBH1	Peptide deformylase, mitochondrial (EC 3.5.1.88) (Polypeptide deformylase)	EBI-11044893	0.35
Q02040	A-kinase anchor protein 17A (AKAP-17A) (721P) (B-lymphocyte antigen) (Protein XE7) (Protein kinase A-anchoring protein 17A) (PRKA17A) (Splicing factor, arginine/serine-rich 17A)	EBI-11044893	0.35
O43929	Origin recognition complex subunit 4	EBI-11044893	0.35
P63167	Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN)	EBI-11044893	0.35
Q5T7B8	Kinesin-like protein KIF24	EBI-11044893	0.35
P14373	Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (RING-type E3 ubiquitin transferase TRIM27) (Ret finger protein) (Tripartite motif-containing protein 27)	EBI-11044893	0.35
Q14165	Malectin	EBI-11044893	0.35
Q15024	Exosome complex component RRP42 (Exosome component 7) (Ribosomal RNA-processing protein 42) (p8)	EBI-11044893	0.35
O95985	DNA topoisomerase 3-beta-1 (EC 5.6.2.1) (DNA topoisomerase III beta-1)	EBI-11044893	0.35
Q9H857	5'-nucleotidase domain-containing protein 2 (EC 3.1.3.-)	EBI-11044893	0.35
P83876	Thioredoxin-like protein 4A (DIM1 protein homolog) (Spliceosomal U5 snRNP-specific 15 kDa protein) (Thioredoxin-like U5 snRNP protein U5-15kD)	EBI-11044893	0.35
Q92817	Envoplakin (210 kDa cornified envelope precursor protein) (210 kDa paraneoplastic pemphigus antigen) (p210)	EBI-11044893	0.35
Q5VYK3	Proteasome adapter and scaffold protein ECM29 (Ecm29 proteasome adapter and scaffold) (Proteasome-associated protein ECM29 homolog)	EBI-11044893	0.35
O60218	Aldo-keto reductase family 1 member B10 (EC 1.1.1.300) (EC 1.1.1.54) (ARL-1) (Aldose reductase-like) (Aldose reductase-related protein) (ARP) (hARP) (Small intestine reductase) (SI reductase)	EBI-11044893	0.35
Q03060	cAMP-responsive element modulator (Inducible cAMP early repressor) (ICER)	EBI-11044893	0.35
Q15058	Kinesin-like protein KIF14	EBI-11044893	0.35
Q15544	Transcription initiation factor TFIID subunit 11 (TFIID subunit p30-beta) (Transcription initiation factor TFIID 28 kDa subunit) (TAF(II)28) (TAFII-28) (TAFII28)	EBI-11044893	0.35
Q96DV4	39S ribosomal protein L38, mitochondrial (L38mt) (MRP-L38) (Mitochondrial large ribosomal subunit protein mL38)	EBI-11044893	0.35
O75947	ATP synthase subunit d, mitochondrial (ATPase subunit d) (ATP synthase peripheral stalk subunit d)	EBI-11044893	0.35
Q2TAY7	WD40 repeat-containing protein SMU1 (Smu-1 suppressor of mec-8 and unc-52 protein homolog) [Cleaved into: WD40 repeat-containing protein SMU1, N-terminally processed]	EBI-11044893	0.35
Q92552	28S ribosomal protein S27, mitochondrial (MRP-S27) (S27mt) (Mitochondrial ribosomal protein S27) (Mitochondrial small ribosomal subunit protein mS27)	EBI-11044893	0.35
Q9BTL3	RNA guanine-N7 methyltransferase activating subunit (Protein FAM103A1) (RNA guanine-7 methyltransferase activating subunit) (RNMT-activating mRNA cap methyltransferase subunit) (RNMT-activating mini protein) (RAM)	EBI-11044893	0.35
Q9BXY0	Protein MAK16 homolog (NNP78) (Protein RBM13)	EBI-11044893	0.35
Q9UBK8	Methionine synthase reductase (MSR) (EC 1.16.1.8) (Aquacobalamin reductase) (AqCbl reductase)	EBI-11044893	0.35
Q9BQ70	Transcription factor 25 (TCF-25) (Nuclear localized protein 1)	EBI-11044893	0.35
O43251	RNA binding protein fox-1 homolog 2 (Fox-1 homolog B) (Hexaribonucleotide-binding protein 2) (RNA-binding motif protein 9) (RNA-binding protein 9) (Repressor of tamoxifen transcriptional activity)	EBI-11044893	0.35
Q06830	Peroxiredoxin-1 (EC 1.11.1.24) (Natural killer cell-enhancing factor A) (NKEF-A) (Proliferation-associated gene protein) (PAG) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Thioredoxin-dependent peroxiredoxin 1)	EBI-11044893	0.35
Q5T280	Putative methyltransferase C9orf114 (EC 2.1.1.-) (Centromere protein 32) (CENP-32) (Kinetochore-associated protein) (SPOUT domain-containing methyltransferase 1)	EBI-11044893	0.35
F8W6N3	Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12)	EBI-11044893	0.35
P23396	40S ribosomal protein S3 (EC 4.2.99.18) (Small ribosomal subunit protein uS3)	EBI-11044893	0.35
O94964	Protein SOGA1 (SOGA family member 1) (Suppressor of glucose by autophagy) (Suppressor of glucose, autophagy-associated protein 1) [Cleaved into: N-terminal form; C-terminal 80 kDa form (80-kDa SOGA fragment)]	EBI-25257469	0.56
P51114	RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p)	EBI-11044893	0.35
Q9NY12	H/ACA ribonucleoprotein complex subunit 1 (Nucleolar protein family A member 1) (snoRNP protein GAR1)	EBI-11044893	0.35
Q16514	Transcription initiation factor TFIID subunit 12 (Transcription initiation factor TFIID 20/15 kDa subunits) (TAFII-20/TAFII-15) (TAFII20/TAFII15)	EBI-11044893	0.35
Q5VTR2	E3 ubiquitin-protein ligase BRE1A (BRE1-A) (hBRE1) (EC 2.3.2.27) (RING finger protein 20) (RING-type E3 ubiquitin transferase BRE1A)	EBI-11044893	0.35
O75400	Pre-mRNA-processing factor 40 homolog A (Fas ligand-associated factor 1) (Formin-binding protein 11) (Formin-binding protein 3) (Huntingtin yeast partner A) (Huntingtin-interacting protein 10) (HIP-10) (Huntingtin-interacting protein A) (Renal carcinoma antigen NY-REN-6)	EBI-11044893	0.35
P62258	14-3-3 protein epsilon (14-3-3E)	EBI-11044893	0.35
P04003	C4b-binding protein alpha chain (C4bp) (Proline-rich protein) (PRP)	EBI-11044893	0.35
Q15029	116 kDa U5 small nuclear ribonucleoprotein component (Elongation factor Tu GTP-binding domain-containing protein 2) (SNU114 homolog) (hSNU114) (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa)	EBI-11044893	0.35
Q69YN4	Protein virilizer homolog	EBI-11044893	0.35
H7C1U3	Coiled-coil and C2 domain-containing protein 1B	EBI-11044893	0.35
O75340	Programmed cell death protein 6 (Apoptosis-linked gene 2 protein homolog) (ALG-2)	EBI-11044893	0.35
Q01081	Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit)	EBI-11044893	0.35
P36896	Activin receptor type-1B (EC 2.7.11.30) (Activin receptor type IB) (ACTR-IB) (Activin receptor-like kinase 4) (ALK-4) (Serine/threonine-protein kinase receptor R2) (SKR2)	EBI-11044893	0.35
Q08378	Golgin subfamily A member 3 (Golgi complex-associated protein of 170 kDa) (GCP170) (Golgin-160)	EBI-11044893	0.35
P17858	ATP-dependent 6-phosphofructokinase, liver type (ATP-PFK) (PFK-L) (EC 2.7.1.11) (6-phosphofructokinase type B) (Phosphofructo-1-kinase isozyme B) (PFK-B) (Phosphohexokinase)	EBI-11044893	0.35
P51116	RNA-binding protein FXR2 (FMR1 autosomal homolog 2)	EBI-11044893	0.35
Q9BZD4	Kinetochore protein Nuf2 (hNuf2) (hNuf2R) (hsNuf2) (Cell division cycle-associated protein 1)	EBI-11044893	0.35
Q6ZU80	Centrosomal protein of 128 kDa (Cep128)	EBI-21647598	0.35
P48606	Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA)	EBI-11532699	0.56
Q96HA8	Protein N-terminal glutamine amidohydrolase (EC 3.5.1.122) (Protein NH2-terminal glutamine deamidase) (N-terminal Gln amidase) (Nt(Q)-amidase) (WDYHV motif-containing protein 1)	EBI-24331255	0.56
Q9UK41	Vacuolar protein sorting-associated protein 28 homolog (H-Vps28) (ESCRT-I complex subunit VPS28)	EBI-24345182	0.56
Q4V328	GRIP1-associated protein 1 (GRASP-1) [Cleaved into: GRASP-1 C-terminal chain (30kDa C-terminus form)]	EBI-24489906	0.56
O95751	Protein LDOC1 (Leucine zipper protein down-regulated in cancer cells)	EBI-24498070	0.56
Q15323	Keratin, type I cuticular Ha1 (Hair keratin, type I Ha1) (Keratin-31) (K31)	EBI-24502549	0.56
Q7Z698	Sprouty-related, EVH1 domain-containing protein 2 (Spred-2)	EBI-24507839	0.56
Q76N32	Centrosomal protein of 68 kDa (Cep68)	EBI-24509377	0.56
P26583	High mobility group protein B2 (High mobility group protein 2) (HMG-2)	EBI-24528704	0.56
Q9NW75	G patch domain-containing protein 2	EBI-24732854	0.56
Q6PIF2	Synaptonemal complex central element protein 2 (Central element synaptonemal complex protein 1)	EBI-24736580	0.56
P40937	Replication factor C subunit 5 (Activator 1 36 kDa subunit) (A1 36 kDa subunit) (Activator 1 subunit 5) (Replication factor C 36 kDa subunit) (RF-C 36 kDa subunit) (RFC36)	EBI-24406909	0.56
Q9Y2V7	Conserved oligomeric Golgi complex subunit 6 (COG complex subunit 6) (Component of oligomeric Golgi complex 6)	EBI-24413259	0.56
O43679	LIM domain-binding protein 2 (LDB-2) (Carboxyl-terminal LIM domain-binding protein 1) (CLIM-1) (LIM domain-binding factor CLIM1)	EBI-24417525	0.67
Q6P1K2	Polyamine-modulated factor 1 (PMF-1)	EBI-24420500	0.67
Q99633	Pre-mRNA-splicing factor 18 (PRP18 homolog) (hPRP18)	EBI-24542654	0.56
Q9BSW7	Synaptotagmin-17 (Protein B/K) (Synaptotagmin XVII) (SytXVII)	EBI-24561089	0.56
Q9NUJ3	T-complex protein 11-like protein 1	EBI-24572508	0.56
Q00994	Protein BEX3 (Brain-expressed X-linked protein 3) (Nerve growth factor receptor-associated protein 1) (Ovarian granulosa cell 13.0 kDa protein HGR74) (p75NTR-associated cell death executor)	EBI-24574129	0.56
Q9Y6C2	EMILIN-1 (Elastin microfibril interface-located protein 1) (Elastin microfibril interfacer 1)	EBI-24745963	0.56
P0C862	Complement C1q and tumor necrosis factor-related protein 9A (Complement C1q and tumor necrosis factor-related protein 9)	EBI-21600656	0.35
Q9Y3F4	Serine-threonine kinase receptor-associated protein (MAP activator with WD repeats) (UNR-interacting protein) (WD-40 repeat protein PT-WD)	EBI-21647598	0.35
Q99666	RANBP2-like and GRIP domain-containing protein 5/6 (Ran-binding protein 2-like 1/2) (RanBP2-like 1/2) (RanBP2L1) (RanBP2L2) (Sperm membrane protein BS-63)	EBI-21647598	0.35
Q92540	Nonsense-mediated mRNA decay factor SMG7 (SMG-7 homolog) (hSMG-7)	EBI-21647598	0.35
O95613	Pericentrin (Kendrin) (Pericentrin-B)	EBI-21647598	0.35
O14715	RANBP2-like and GRIP domain-containing protein 8 (Ran-binding protein 2-like 3) (RanBP2-like 3) (RanBP2L3)	EBI-21647598	0.35
Q8IV20	Purine nucleoside phosphorylase LACC1 (EC 2.4.2.1) (Adenosine deaminase LACC1) (EC 3.5.4.4) (Fatty acid metabolism-immunity nexus) (Guanosine phosphorylase LACC1) (Laccase domain-containing protein 1) (S-methyl-5'-thioadenosine phosphorylase LACC1) (EC 2.4.2.28)	EBI-21810059	0.35
P25205	DNA replication licensing factor MCM3 (EC 3.6.4.12) (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) (RLF subunit beta) (p102)	EBI-21865186	0.35
Q9UKV8	Protein argonaute-2 (Argonaute2) (hAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF-2C 2) (eIF2C 2) (PAZ Piwi domain protein) (PPD) (Protein slicer)	EBI-15925341	0.35
O00499	Myc box-dependent-interacting protein 1 (Amphiphysin II) (Amphiphysin-like protein) (Box-dependent myc-interacting protein 1) (Bridging integrator 1)	EBI-21387969	0.00
P28329	Choline O-acetyltransferase (CHOACTase) (ChAT) (Choline acetylase) (EC 2.3.1.6)	EBI-25837768	0.56
P22607	Fibroblast growth factor receptor 3 (FGFR-3) (EC 2.7.10.1) (CD antigen CD333)	EBI-25853632	0.56
P14136	Glial fibrillary acidic protein (GFAP)	EBI-25857834	0.56
P06396	Gelsolin (AGEL) (Actin-depolymerizing factor) (ADF) (Brevin)	EBI-25863662	0.56
Q16637	Survival motor neuron protein (Component of gems 1) (Gemin-1)	EBI-25891706	0.56
Q9Y649	GW128	EBI-25900825	0.56
P61981	14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed]	EBI-25902060	0.56
P46379	Large proline-rich protein BAG6 (BAG family molecular chaperone regulator 6) (BCL2-associated athanogene 6) (BAG-6) (HLA-B-associated transcript 3) (Protein G3) (Protein Scythe)	EBI-25903723	0.56
O14901	Krueppel-like factor 11 (Transforming growth factor-beta-inducible early growth response protein 2) (TGFB-inducible early growth response protein 2) (TIEG-2)	EBI-25904874	0.56
Q15047	Histone-lysine N-methyltransferase SETDB1 (EC 2.1.1.366) (ERG-associated protein with SET domain) (ESET) (Histone H3-K9 methyltransferase 4) (H3-K9-HMTase 4) (Lysine N-methyltransferase 1E) (SET domain bifurcated 1)	EBI-25909011	0.56
Q8TAP4	LIM domain only protein 3 (LMO-3) (Neuronal-specific transcription factor DAT1) (Rhombotin-3)	EBI-25925906	0.56
Q7Z699	Sprouty-related, EVH1 domain-containing protein 1 (Spred-1) (hSpred1)	EBI-25931052	0.56

Cross-References

Database	Links
UNIPROT	Q99598 B1APC6
PDB	3PJA 3QB5
Pfam	PF01997
OMIM	602964
DisGeNET	7257

Translin-associated protein X (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 3PJA)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (10 interactors)

Interactions with other proteins (125 interactors)

Cross-References

Database

Links

Description

Description