Cytoskeleton-associated protein 4 - Homo sapiens

Cytoskeleton-associated protein 4 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Cytoskeleton-associated protein 4
Accession Code	Q07065
Gene	CKAP4
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 602)
MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGKGGHRGGGGGGGKSSSSSSASAAAAAAAASSSASCSRRLGRALNFLFYLALVAAAAFSGWCVHHV LEEVQQVRRSHQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQHKQDLTEKAVKQGESEVSRISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQK RSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKED GGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQ AARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV

Subcellular Location

Description
Endoplasmic reticulum membrane {Experimental EvidencePubMed:18296695, Experimental EvidencePubMed:19144824}; Single-pass type II membrane protein. Cell membrane {Experimental EvidencePubMed:18296695, Experimental EvidencePubMed:19144824}; Single-pass type II membrane protein. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Note=Translocates to the perinuclear region upon APF-stimulation.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Azurophil Granule Membrane (GO:0035577) Cytoskeleton (GO:0005856) Endoplasmic Reticulum (GO:0005783) Endoplasmic Reticulum Lumen (GO:0005788) Endoplasmic Reticulum Membrane (GO:0005789) Extracellular Exosome (GO:0070062) Lamellar Body (GO:0042599) Lipid Droplet (GO:0005811) Membrane (GO:0016020) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Rough Endoplasmic Reticulum (GO:0005791) Specific Granule Membrane (GO:0035579)

Biology & Function

Description
Mediates the anchoring of the endoplasmic reticulum to microtubules. {Experimental EvidencePubMed:15703217}. High-affinity epithelial cell surface receptor for the FZD8- related low molecular weight sialoglycopeptide APF/antiproliferative factor. Mediates the APF antiproliferative signaling within cells. {Experimental EvidencePubMed:17030514, Experimental EvidencePubMed:19144824}.
Assigned Ontology terms

Biological Process
Molecular Function	RNA Binding (GO:0003723)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (13 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
A0A142I5B9	RNA-directed RNA polymerase NS5	EBI-20626314	0.35
O43542	DNA repair protein XRCC3	EBI-11129266	0.35
O76050	E3 ubiquitin-protein ligase NEURL1	EBI-20901648	0.40
P00533	Epidermal growth factor receptor	EBI-702075	0.35
P01112	GTPase HRas, N-terminally processed	EBI-27045317	0.27
Q99598	Translin-associated protein X	EBI-3936346	0.37
Q14764	Major vault protein	EBI-3936356	0.37
Q07065	Self	EBI-3942157	0.37
Q92905	COP9 signalosome complex subunit 5	EBI-21325777	0.35
Q9P0L0	Vesicle-associated membrane protein-associated protein A	EBI-11120309	0.35
Q99IB8	RNA-directed RNA polymerase	EBI-11613941	0.35
P00519	Tyrosine-protein kinase ABL1	EBI-10101379	0.35
Q9D8B3	Charged multivesicular body protein 4b	EBI-11052854	0.35
Interactions with other proteins (143 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9H1I8	Activating signal cointegrator 1 complex subunit 2 (ASC-1 complex subunit p100) (Trip4 complex subunit p100)	EBI-733925	0.00
P49407	Beta-arrestin-1 (Arrestin beta-1) (Non-visual arrestin-2)	EBI-1642094	0.35
Q70EL3	Inactive ubiquitin carboxyl-terminal hydrolase 50 (Inactive ubiquitin-specific peptidase 50)	EBI-2512984	0.40
P40692	DNA mismatch repair protein Mlh1 (MutL protein homolog 1)	EBI-2932395	0.37
Q8IYT8	Serine/threonine-protein kinase ULK2 (EC 2.7.11.1) (Unc-51-like kinase 2)	EBI-2984710	0.35
P60520	Gamma-aminobutyric acid receptor-associated protein-like 2 (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16) (MAP1 light chain 3-related protein)	EBI-3046676	0.35
P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	EBI-3893169	0.35
P18848	Cyclic AMP-dependent transcription factor ATF-4 (cAMP-dependent transcription factor ATF-4) (Activating transcription factor 4) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (Tax-responsive enhancer element-binding protein 67) (TaxREB67)	EBI-3927782	0.37
P17568	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (Cell adhesion protein SQM1) (Complex I-B18) (CI-B18) (NADH-ubiquinone oxidoreductase B18 subunit)	EBI-3936336	0.37
Q9Y3C0	WASH complex subunit 3 (Coiled-coil domain-containing protein 53)	EBI-3942167	0.37
P81172	Hepcidin (Liver-expressed antimicrobial peptide 1) (LEAP-1) (Putative liver tumor regressor) (PLTR) [Cleaved into: Hepcidin-25 (Hepc25); Hepcidin-20 (Hepc20)]	EBI-3942177	0.37
Q6I9Y2	THO complex subunit 7 homolog (Functional spliceosome-associated protein 24) (fSAP24) (Ngg1-interacting factor 3-like protein 1-binding protein 1) (NIF3L1-binding protein 1) (hTREX30)	EBI-3942193	0.37
P04578	Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]	EBI-6174316	0.46
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
P63208	S-phase kinase-associated protein 1 (Cyclin-A/CDK2-associated protein p19) (p19A) (Organ of Corti protein 2) (OCP-2) (Organ of Corti protein II) (OCP-II) (RNA polymerase II elongation factor-like protein) (SIII) (Transcription elongation factor B polypeptide 1-like) (p19skp1)	EBI-8835658	0.35
O75807	Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog)	EBI-9976880	0.35
O60307	Microtubule-associated serine/threonine-protein kinase 3 (EC 2.7.11.1)	EBI-10103761	0.35
Q96FW1	Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1)	EBI-10770198	0.35
P05412	Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39)	EBI-11323169	0.35
P36895	Bone morphogenetic protein receptor type-1A (BMP type-1A receptor) (BMPR-1A) (EC 2.7.11.30) (Activin receptor-like kinase 3) (ALK-3) (BMP-2/BMP-4 receptor) (Serine/threonine-protein kinase receptor R5) (SKR5) (CD antigen CD292)	EBI-11008521	0.35
P35278	Ras-related protein Rab-5C (EC 3.6.5.2)	EBI-11012136	0.35
Q3UJU9	Regulator of microtubule dynamics protein 3 (RMD-3) (mRMD-3) (Protein FAM82A2) (Protein FAM82C)	EBI-11021410	0.35
O75787	Renin receptor (ATPase H(+)-transporting lysosomal accessory protein 2) (ATPase H(+)-transporting lysosomal-interacting protein 2) (ER-localized type I transmembrane adapter) (Embryonic liver differentiation factor 10) (N14F) (Renin/prorenin receptor) (Vacuolar ATP synthase membrane sector-associated protein M8-9) (ATP6M8-9) (V-ATPase M8.9 subunit) [Cleaved into: Renin receptor N-terminal fragment; Renin receptor C-terminal fragment]	EBI-11037152	0.35
P51148	Ras-related protein Rab-5C (EC 3.6.5.2) (L1880) (RAB5L)	EBI-11046231	0.35
P51149	Ras-related protein Rab-7a (EC 3.6.5.2)	EBI-11050319	0.35
Q16513	Serine/threonine-protein kinase N2 (EC 2.7.11.13) (PKN gamma) (Protein kinase C-like 2) (Protein-kinase C-related kinase 2)	EBI-11070511	0.35
F8VQC7	Kinectin	EBI-11104527	0.35
Q9R0Q3	Transmembrane emp24 domain-containing protein 2 (COPI-coated vesicle membrane protein p24) (Membrane protein p24A) (Sid 394) (p24 family protein beta-1) (p24beta1)	EBI-11111571	0.35
P09450	Transcription factor JunB (MyD21) (Transcription factor AP-1 subunit JunB)	EBI-11127973	0.35
Q15006	ER membrane protein complex subunit 2 (Tetratricopeptide repeat protein 35) (TPR repeat protein 35)	EBI-11130215	0.35
Q8N4V1	ER membrane protein complex subunit 5 (Membrane magnesium transporter 1) (Transmembrane protein 32)	EBI-11130635	0.35
O00400	Acetyl-coenzyme A transporter 1 (AT-1) (Acetyl-CoA transporter 1) (Solute carrier family 33 member 1)	EBI-11135399	0.35
Q5T3F8	CSC1-like protein 2 (Transmembrane protein 63B)	EBI-11155257	0.35
Q9Y3E0	Vesicle transport protein GOT1B (Germ cell tumor 2) (Golgi transport 1 homolog B) (Putative NF-kappa-B-activating protein 470) (hGOT1a)	EBI-11161387	0.35
Q2MV58	Tectonic-1	EBI-11366929	0.27
Q5HYA8	Meckelin (Meckel syndrome type 3 protein) (Transmembrane protein 67)	EBI-11367583	0.27
Q6NUS6	Tectonic-3	EBI-11368748	0.27
Q86UK5	Limbin (Ellis-van Creveld syndrome protein 2) (EVC2)	EBI-11372136	0.27
Q86X19	Transmembrane protein 17	EBI-11372615	0.27
Q96GX1	Tectonic-2	EBI-11375285	0.27
Q96Q45	Transmembrane protein 237 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein)	EBI-11377173	0.27
Q9P0N5	Transmembrane protein 216	EBI-11378021	0.27
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-16398399	0.35
Q13503	Mediator of RNA polymerase II transcription subunit 21 (Mediator complex subunit 21) (RNA polymerase II holoenzyme component SRB7) (RNAPII complex component SRB7) (hSrb7)	EBI-21501670	0.35
P30825	High affinity cationic amino acid transporter 1 (CAT-1) (CAT1) (Ecotropic retroviral leukemia receptor homolog) (Ecotropic retrovirus receptor homolog) (Solute carrier family 7 member 1) (System Y+ basic amino acid transporter)	EBI-21505748	0.35
Q92633	Lysophosphatidic acid receptor 1 (LPA receptor 1) (LPA-1) (Lysophosphatidic acid receptor Edg-2)	EBI-21508694	0.35
Q9H8X2	Inositol-pentakisphosphate 2-kinase (EC 2.7.1.158) (IPK1 homolog) (Inositol-1,3,4,5,6-pentakisphosphate 2-kinase) (Ins(1,3,4,5,6)P5 2-kinase) (InsP5 2-kinase)	EBI-21509881	0.35
Q16581	C3a anaphylatoxin chemotactic receptor (C3AR) (C3a-R)	EBI-21515265	0.35
Q6P5W5	Zinc transporter ZIP4 (Solute carrier family 39 member 4) (Zrt- and Irt-like protein 4) (ZIP-4)	EBI-21515976	0.35
Q9UGM1	Neuronal acetylcholine receptor subunit alpha-9 (Nicotinic acetylcholine receptor subunit alpha-9) (NACHR alpha-9)	EBI-21517134	0.35
A2A2Y4	FERM domain-containing protein 3 (Band 4.1-like protein 4O) (Ovary type protein 4.1) (4.1O)	EBI-21527504	0.35
O75326	Semaphorin-7A (CDw108) (JMH blood group antigen) (John-Milton-Hargen human blood group Ag) (Semaphorin-K1) (Sema K1) (Semaphorin-L) (Sema L) (CD antigen CD108)	EBI-21558128	0.35
O95274	Ly6/PLAUR domain-containing protein 3 (GPI-anchored metastasis-associated protein C4.4A homolog) (Matrigel-induced gene C4 protein) (MIG-C4)	EBI-21607810	0.35
Q99689	Fasciculation and elongation protein zeta-1 (Zygin I) (Zygin-1)	EBI-21638763	0.35
O94766	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 (EC 2.4.1.135) (Beta-1,3-glucuronyltransferase 3) (Glucuronosyltransferase I) (GlcAT-I) (UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase) (GlcUAT-I)	EBI-21668731	0.35
Q99871	HAUS augmin-like complex subunit 7 (26S proteasome-associated UCH37-interacting protein 1) (UCHL5-interacting protein) (X-linked protein STS1769)	EBI-21670231	0.35
Q9NVF7	F-box only protein 28	EBI-21671334	0.35
Q7LGA3	Heparan sulfate 2-O-sulfotransferase 1 (2-O-sulfotransferase) (2OST) (EC 2.8.2.-)	EBI-21675787	0.35
Q16322	Potassium voltage-gated channel subfamily A member 10 (Voltage-gated potassium channel subunit Kv1.8)	EBI-21690666	0.35
P49796	Regulator of G-protein signaling 3 (RGP3) (RGS3)	EBI-21716735	0.35
Q86Y78	Ly6/PLAUR domain-containing protein 6	EBI-21717654	0.35
O14763	Tumor necrosis factor receptor superfamily member 10B (Death receptor 5) (TNF-related apoptosis-inducing ligand receptor 2) (TRAIL receptor 2) (TRAIL-R2) (CD antigen CD262)	EBI-21722795	0.35
Q8WWF3	Serine-rich single-pass membrane protein 1	EBI-21811588	0.35
P08842	Steryl-sulfatase (EC 3.1.6.2) (Arylsulfatase C) (ASC) (Estrone sulfatase) (Steroid sulfatase) (Steryl-sulfate sulfohydrolase)	EBI-21852400	0.35
P51888	Prolargin (Proline-arginine-rich end leucine-rich repeat protein)	EBI-21852864	0.35
Q9Y6Z7	Collectin-10 (Collectin liver protein 1) (CL-L1) (Collectin-34) (CL-34)	EBI-21859525	0.35
Q9BZR6	Reticulon-4 receptor (Nogo receptor) (NgR) (Nogo-66 receptor)	EBI-21865956	0.35
Q5BJH7	Protein YIF1B (YIP1-interacting factor homolog B)	EBI-21881931	0.35
P50876	E3 ubiquitin-protein ligase RNF144A (EC 2.3.2.31) (RING finger protein 144A) (UbcM4-interacting protein 4) (Ubiquitin-conjugating enzyme 7-interacting protein 4)	EBI-21881918	0.40
O60858	E3 ubiquitin-protein ligase TRIM13 (EC 2.3.2.27) (B-cell chronic lymphocytic leukemia tumor suppressor Leu5) (Leukemia-associated protein 5) (Putative tumor suppressor RFP2) (RING finger protein 77) (RING-type E3 ubiquitin transferase TRIM13) (Ret finger protein 2) (Tripartite motif-containing protein 13)	EBI-21881893	0.35
O15155	BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18)	EBI-16788067	0.27
P27824	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	EBI-16788621	0.42
Q96I36	Cytochrome c oxidase assembly protein COX14	EBI-16791250	0.27
P13073	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Cytochrome c oxidase polypeptide IV) (Cytochrome c oxidase subunit IV isoform 1) (COX IV-1)	EBI-16791533	0.27
P11279	Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a)	EBI-16794808	0.27
Q9HBL7	Plasminogen receptor (KT) (Plg-R(KT))	EBI-16797780	0.27
P51151	Ras-related protein Rab-9A	EBI-16798325	0.27
Q9NS69	Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog)	EBI-16802054	0.27
O43493	Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2)	EBI-16800982	0.42
P36957	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K)	EBI-20305285	0.35
P08559	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I)	EBI-20306509	0.35
P31040	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (EC 1.3.5.1) (Flavoprotein subunit of complex II) (Fp)	EBI-20306992	0.35
Q9UKU6	Thyrotropin-releasing hormone-degrading ectoenzyme (TRH-DE) (TRH-degrading ectoenzyme) (EC 3.4.19.6) (Pyroglutamyl-peptidase II) (PAP-II) (TRH-specific aminopeptidase) (Thyroliberinase)	EBI-20901800	0.40
Q8WXX0	Dynein axonemal heavy chain 7 (Axonemal beta dynein heavy chain 7) (Ciliary dynein heavy chain 7) (Dynein heavy chain-like protein 2) (hDHC2)	EBI-20901792	0.40
P04275	von Willebrand factor (vWF) [Cleaved into: von Willebrand antigen 2 (von Willebrand antigen II)]	EBI-20903352	0.40
P29475	Nitric oxide synthase, brain (EC 1.14.13.39) (Constitutive NOS) (NC-NOS) (NOS type I) (Neuronal NOS) (N-NOS) (nNOS) (Peptidyl-cysteine S-nitrosylase NOS1) (bNOS)	EBI-20905832	0.40
Q6NUK1	Calcium-binding mitochondrial carrier protein SCaMC-1 (Mitochondrial ATP-Mg/Pi carrier protein 1) (Mitochondrial Ca(2+)-dependent solute carrier protein 1) (Small calcium-binding mitochondrial carrier protein 1) (Solute carrier family 25 member 24)	EBI-20909712	0.40
Q8IVJ8	APRG1 tumor suppressor candidate (AP20 region protein 1)	EBI-20910272	0.40
Q96NB3	Zinc finger protein 830 (Coiled-coil domain-containing protein 16)	EBI-20910632	0.40
P21675	Transcription initiation factor TFIID subunit 1 (EC 2.3.1.48) (EC 2.7.11.1) (Cell cycle gene 1 protein) (TBP-associated factor 250 kDa) (p250) (Transcription initiation factor TFIID 250 kDa subunit) (TAF(II)250) (TAFII-250) (TAFII250)	EBI-20917908	0.40
P16403	Histone H1.2 (Histone H1c) (Histone H1d) (Histone H1s-1)	EBI-20926338	0.40
A6NNW6	Enolase 4 (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase)	EBI-20932560	0.40
Q9ULG1	Chromatin-remodeling ATPase INO80 (hINO80) (EC 3.6.4.-) (DNA helicase-related INO80 complex homolog 1) (DNA helicase-related protein INO80) (INO80 complex subunit A)	EBI-20935724	0.40
A2A935	Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1)	EBI-21022882	0.35
P14404	Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog)	EBI-21026252	0.35
P62079	Tetraspanin-5 (Tspan-5) (Tetraspan NET-4) (Transmembrane 4 superfamily member 9)	EBI-20977847	0.35
O95858	Tetraspanin-15 (Tspan-15) (Tetraspan NET-7) (Transmembrane 4 superfamily member 15)	EBI-20977902	0.35
Q15077	P2Y purinoceptor 6 (P2Y6)	EBI-21262943	0.35
Q9H1C4	Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1)	EBI-21266770	0.35
P25100	Alpha-1D adrenergic receptor (Alpha-1A adrenergic receptor) (Alpha-1D adrenoreceptor) (Alpha-1D adrenoceptor) (Alpha-adrenergic receptor 1a)	EBI-21277437	0.35
Q00059	Transcription factor A, mitochondrial (mtTFA) (Mitochondrial transcription factor 1) (MtTF1) (Transcription factor 6) (TCF-6) (Transcription factor 6-like 2)	EBI-21980665	0.35
O84793	Leader (60) peptide-periplasmic	EBI-22302936	0.35
Q640N3	Rho GTPase-activating protein 30 (Rho-type GTPase-activating protein 30)	EBI-25409042	0.35
Q5FWK3	Rho GTPase-activating protein 1 (Rho-type GTPase-activating protein 1)	EBI-25409394	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
P23497	Nuclear autoantigen Sp-100 (Nuclear dot-associated Sp100 protein) (Speckled 100 kDa)	EBI-25485215	0.35
Q9C0B5	Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375)	EBI-25636144	0.35
P0DTD8	ORF7b protein (ORF7b) (Accessory protein 7b)	EBI-25687199	0.35
Q7TFA1	Protein non-structural 7b (ns7b) (Accessory protein 7b)	EBI-25688644	0.35
P02452	Collagen alpha-1(I) chain (Alpha-1 type I collagen)	EBI-26366205	0.35
Q53F19	Nuclear cap-binding protein subunit 3 (Protein ELG)	EBI-26396827	0.35
P52298	Nuclear cap-binding protein subunit 2 (20 kDa nuclear cap-binding protein) (Cell proliferation-inducing gene 55 protein) (NCBP 20 kDa subunit) (CBP20) (NCBP-interacting protein 1) (NIP1)	EBI-26398473	0.35
Q9NRI5	Disrupted in schizophrenia 1 protein	EBI-26610886	0.35
Q8NDZ4	Divergent protein kinase domain 2A (Deleted in autism protein 1) (Golgi Protein of 49 kDa) (GoPro49) (Hypoxia and AKT-induced stem cell factor) (HASF)	EBI-26597064	0.35
P01116	GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]	EBI-27041844	0.27
P01111	GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)	EBI-27042293	0.27
Q13363	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-)	EBI-27044482	0.35
A0A0H3NFP4	SPI-2 type III secretion system effector SifA (Type III secretion system effector protein-necessary for Sif formation and maintaining the SCV. Has GAP activity)	EBI-27055788	0.27
A0A0H3NG92	Type III secretion system effector protein-regulates and maintains the SCV (Type III secretion systems effector SseF)	EBI-27055968	0.27
A0A0H3NF08	SPI-2 type III secretion system effector PipB2 (Type III secretion system effector protein, Contributes to Sif formation)	EBI-27055973	0.27
A0A0H3NB75	Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV)	EBI-27055983	0.27
P35226	Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51)	EBI-27108918	0.35
Q99592	Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171)	EBI-27093179	0.35
Q92630	Dual specificity tyrosine-phosphorylation-regulated kinase 2 (EC 2.7.12.1)	EBI-28952196	0.27
Q8NCK7	Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11)	EBI-27105115	0.35
P56180	Putative tyrosine-protein phosphatase TPTE (EC 3.1.3.48) (Cancer/testis antigen 44) (CT44) (Transmembrane phosphatase with tensin homology) (Tumor antigen BJ-HCC-5)	EBI-27116883	0.27
P0DTC4	Envelope small membrane protein (E) (sM protein)	EBI-28955127	0.35
P08069	Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain]	EBI-32718669	0.35
P08922	Proto-oncogene tyrosine-protein kinase ROS (EC 2.7.10.1) (Proto-oncogene c-Ros) (Proto-oncogene c-Ros-1) (Receptor tyrosine kinase c-ros oncogene 1) (c-Ros receptor tyrosine kinase)	EBI-32719572	0.35
Q5JZY3	Ephrin type-A receptor 10 (EC 2.7.10.1)	EBI-32720634	0.27
P29322	Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK)	EBI-32721175	0.27
P54760	Ephrin type-B receptor 4 (EC 2.7.10.1) (Hepatoma transmembrane kinase) (Tyrosine-protein kinase TYRO11)	EBI-32721396	0.27
P21860	Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3)	EBI-32721529	0.27
P06213	Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta]	EBI-32723092	0.27
P14616	Insulin receptor-related protein (IRR) (EC 2.7.10.1) (IR-related receptor) [Cleaved into: Insulin receptor-related protein alpha chain; Insulin receptor-related protein beta chain]	EBI-32723232	0.27
O15146	Muscle, skeletal receptor tyrosine-protein kinase (EC 2.7.10.1) (Muscle-specific tyrosine-protein kinase receptor) (MuSK) (Muscle-specific kinase receptor)	EBI-32724025	0.27
P04629	High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (p140-TrkA)	EBI-32724282	0.27
P16234	Platelet-derived growth factor receptor alpha (PDGF-R-alpha) (PDGFR-alpha) (EC 2.7.10.1) (Alpha platelet-derived growth factor receptor) (Alpha-type platelet-derived growth factor receptor) (CD140 antigen-like family member A) (CD140a antigen) (Platelet-derived growth factor alpha receptor) (Platelet-derived growth factor receptor 2) (PDGFR-2) (CD antigen CD140a)	EBI-32724889	0.27
P09619	Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2.7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) (CD140 antigen-like family member B) (Platelet-derived growth factor receptor 1) (PDGFR-1) (CD antigen CD140b)	EBI-32724964	0.27
P07949	Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment]	EBI-32725031	0.27
Q04912	Macrophage-stimulating protein receptor (MSP receptor) (EC 2.7.10.1) (CDw136) (Protein-tyrosine kinase 8) (p185-Ron) (CD antigen CD136) [Cleaved into: Macrophage-stimulating protein receptor alpha chain; Macrophage-stimulating protein receptor beta chain]	EBI-32725158	0.27
Q6J9G0	Tyrosine-protein kinase STYK1 (EC 2.7.10.2) (Novel oncogene with kinase domain) (Protein PK-unique) (Serine/threonine/tyrosine kinase 1)	EBI-32731895	0.27
Q8TCJ2	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B (Oligosaccharyl transferase subunit STT3B) (STT3-B) (EC 2.4.99.18) (Source of immunodominant MHC-associated peptides homolog)	EBI-32732289	0.27

Cross-References

Database	Links
UNIPROT	Q07065 Q504S5 Q53ES6
OMIM	618595
DisGeNET	10970

Cytoskeleton-associated protein 4 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (13 interactors)

Interactions with other proteins (143 interactors)

Cross-References

Database

Links

Description

Description