Protein Information |
|
|---|---|
| Protein Name | Protein transport protein Sec16A |
| Accession Code | O15027 |
| Gene | SEC16A |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 2357) | |
|
MQPPPQTVPSGMAGPPPAGNPRSVFWASSPYRRRANNNAAVAPTTCPLQPVTDPFAFSRQALQSTPLGSSSKSSPPVLQGPAPAGFSQHPGLLVPHTHARDSSQGPCEPLPGPLTQPRAHASPFSGALTP SAPPGPEMNRSAEVGPSSEPEVQTLPYLPHYIPGVDPETSHGGHPHGNMPGLDRPLSRQNPHDGVVTPAASPSLPQPGLQMPGQWGPVQGGPQPSGQHRSPCPEGPVPSGVPCATSVPHFPTPSILHQGP GHEQHSPLVAPPAALPSDGRDEVSHLQSGSHLANNSDPESTFRQNPRIVNHWASPELRQNPGVKNEHRPASALVNPLARGDSPENRTHHPLGAGAGSGCAPLEADSGASGALAMFFQGGETENEENLSSE KAGLSGQADFDDFCSSPGLGRPPAPTHVGAGSLCQALLPGPSNEAAGDVWGDTASTGVPDASGSQYENVENLEFVQNQEVLPSEPLNLDPSSPSDQFRYGPLPGPAVPRHGAVCHTGAPDATLHTVHPDS VSSSYSSRSHGRLSGSARPQELVGTFIQQEVGKPEDEASGSFFKQIDSSPVGGETDETTVSQNYRGSVSQPSTPSPPKPTGIFQTSANSSFEPVKSHLVGVKPFEADRANVVGEVRETCVRQKQCRPAAA LPDASPGNLEQPPDNMETLCAPQVCPLPLNSTTEAVHMLPHAGAPPLDTVYPAPEKRPSARTQGPVKCESPATTLWAQSELPDFGGNVLLAPAAPALYVCAKPQPPVVQPPEEAMSGQQSRNPSSAAPVQ SRGGIGASENLENPPKMGEEEALQSQASSGYASLLSSPPTESLQNPPVLIAQPDHSYNLAQPINFSVSLSNSHEKNQSWREALVGDRPAVSSWALGGDSGENTSLSGIPTSSVLSLSLPSSVAQSNFPQG SGASEMVSNQPANLLVQPPSQPVPENLVPESQKDRKAGSALPGFANSPAGSTSVVLVPPAHGTLVPDGNKANHSSHQEDTYGALDFTLSRTLENPVNVYNPSHSDSLASQQSVASHPRQSGPGAPNLDRF YQQVTKDAQGQPGLERAQQELVPPQQQASPPQLPKAMFSELSNPESLPAQGQAQNSAQSPASLVLVDAGQQLPPRPPQSSSVSLVSSGSGQAAVPSEQPWPQPVPALAPGPPPQDLAAYYYYRPLYDAYQ PQYSLPYPPEPGAASLYYQDVYSLYEPRYRPYDGAASAYAQNYRYPEPERPSSRASHSSERPPPRQGYPEGYYSSKSGWSSQSDYYASYYSSQYDYGDPGHWDRYHYSARVRDPRTYDRRYWCDAEYDAY RREHSAFGDRPEKRDNNWRYDPRFTGSFDDDPDPHRDPYGEEVDRRSVHSEHSARSLHSAHSLASRRSSLSSHSHQSQIYRSHNVAAGSYEAPLPPGSFHGDFAYGTYRSNFSSGPGFPEYGYPADTVWP AMEQVSSRPTSPEKFSVPHVCARFGPGGQLIKVIPNLPSEGQPALVEVHSMEALLQHTSEQEEMRAFPGPLAKDDTHKVDVINFAQNKAMKCLQNENLIDKESASLLWNFIVLLCRQNGTVVGTDIAELL LRDHRTVWLPGKSPNEANLIDFTNEAVEQVEEEESGEAQLSFLTGGPAAAASSLERETERFRELLLYGRKKDALESAMKNGLWGHALLLASKMDSRTHARVMTRFANSLPINDPLQTVYQLMSGRMPAAS TCCGDEKWGDWRPHLAMVLSNLNNNMDVESRTMATMGDTLASRGLLDAAHFCYLMAQAGFGVYTKKTTKLVLIGSNHSLPFLKFATNEAIQRTEAYEYAQSLGAETCPLPSFQVFKFIYSCRLAEMGLAT QAFHYCEAIAKSILTQPHLYSPVLISQLVQMASQLRLFDPQLKEKPEEESLAAPTWLVHLQQVERQIKEGAGVWHQDGALPQQCPGTPSSEMEQLDRPGLSQPGALGIANPLLAVPAPSPEHSSPSVRLL PSAPQTLPDGPLASPARVPMFPVPLPPGPLEPGPGCVTPGPALGFLEPSGPGLPPGVPPLQERRHLLQEARSPDPGIVPQEAPVGNSLSELSEENFDGKFANLTPSRTVPDSEAPPGWDRADSGPTQPPL SLSPAPETKRPGQAAKKETKEPKKGESWFFRWLPGKKKTEAYLPDDKNKSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSMPKTVQAAPPALPGPPGAPVNMYSRRAAGTRARYVDVLNPSGTQRSEPALA PADFVAPLAPLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKVLSSAASLPGSELPSSRPEGSQGGELSRCSSMSSLSREVSQHFNQAPGDLPAAGGPPSGAMPFYNPAQLAQACATS GSSRLGRIGQRKHLVLN |
|
Description |
||
|---|---|---|
| Endoplasmic reticulum membrane {Experimental EvidencePubMed:17005010, Experimental EvidencePubMed:29300766}; Peripheral membrane protein {Experimental EvidencePubMed:17005010}. Golgi apparatus membrane {Curator Inference}; Peripheral membrane protein {Curator Inference}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:E9QAT4}. Cytoplasm, cytosol {Experimental EvidencePubMed:17428803, Experimental EvidencePubMed:21768384}. Microsome membrane {Experimental EvidencePubMed:17428803}. Note=SAR1A activity is required to maintain SEC16A localization at discrete locations on the ER membrane perhaps by preventing its dissociation (PubMed:17192411). Localizes to endoplasmic reticulum exit sites (ERES), also known as transitional endoplasmic reticulum (tER). MIA3 and LRRK2 are required for its proper localization to ERES (PubMed:25201882, PubMed:28442536, PubMed:19638414, PubMed:17428803, PubMed:22355596). Recruited to microsomal membrane in SAR1-dependent manner (PubMed:17428803). {Experimental EvidencePubMed:17192411, Experimental EvidencePubMed:17428803, ECO:0000269|PubMed:19638414, ECO:0000269|PubMed:22355596, ECO:0000269|PubMed:25201882, ECO:0000269|PubMed:28442536}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Peripheral | UniProt | Curator Inference {ECO:0000305} | Assigned Ontology terms |
| Cellular Component | Cytosol (GO:0005829) Endoplasmic Reticulum Exit Site (GO:0070971) Endoplasmic Reticulum Membrane (GO:0005789) ER To Golgi Transport Vesicle Membrane (GO:0012507) Golgi Membrane (GO:0000139) Organelle Membrane (GO:0031090) Perinuclear Region Of Cytoplasm (GO:0048471) |
|
Description |
|
|---|---|
| Acts as a molecular scaffold that plays a key role in the organization of the endoplasmic reticulum exit sites (ERES), also known as transitional endoplasmic reticulum (tER). SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining an ERES. Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus (PubMed:17192411, PubMed:17005010, PubMed:17428803, PubMed:21768384, PubMed:22355596). Mediates the recruitment of MIA3/TANGO to ERES (PubMed:28442536). Regulates both conventional (ER/Golgi-dependent) and GORASP2-mediated unconventional (ER/Golgi-independent) trafficking of CFTR to cell membrane (PubMed:28067262). Positively regulates the protein stability of E3 ubiquitin-protein ligases RNF152 and RNF183 and the ER localization of RNF183 (PubMed:29300766). Acts as a RAB10 effector in the regulation of insulin-induced SLC2A4/GLUT4 glucose transporter- enriched vesicles delivery to the cell membrane in adipocytes (By similarity). {By SimilarityUniProtKB:E9QAT4, Experimental EvidencePubMed:17005010, Experimental EvidencePubMed:17192411, Experimental EvidencePubMed:17428803, Experimental EvidencePubMed:21768384, Experimental EvidencePubMed:22355596, Experimental EvidencePubMed:28067262, Experimental EvidencePubMed:28442536, Experimental EvidencePubMed:29300766}. | Assigned Ontology terms |
| Biological Process | Autophagy (GO:0006914) COPII Vesicle Coating (GO:0048208) Endoplasmic Reticulum Organization (GO:0007029) Endoplasmic Reticulum To Golgi Vesicle-Mediated Transport (GO:0006888) Golgi Organization (GO:0007030) Obsolete Golgi To Plasma Membrane CFTR Protein Transport (GO:0043000) Protein Exit From Endoplasmic Reticulum (GO:0032527) Protein Localization To Endoplasmic Reticulum Exit Site (GO:0070973) Protein Localization To Plasma Membrane (GO:0072659) Protein Stabilization (GO:0050821) Response To Endoplasmic Reticulum Stress (GO:0034976) Substantia Nigra Development (GO:0021762) |
| Molecular Function | |
Interactions with Nuclear Envelope proteins (14 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| P55735 | Protein SEC13 homolog | EBI-10045785 | 0.35 |
| O95831 | Apoptosis-inducing factor 1, mitochondrial | EBI-16786589 | 0.42 |
| P50613 | Cyclin-dependent kinase 7 | EBI-16790014 | 0.35 |
| Q14203 | Dynactin subunit 1 | EBI-11083608 | 0.35 |
| Q9UPY3 | Endoribonuclease Dicer | EBI-20621391 | 0.35 |
| Q14677 | Clathrin interactor 1 | EBI-11083608 | 0.35 |
| O14976 | Cyclin-G-associated kinase | EBI-11083608 | 0.35 |
| P05783 | Keratin, type I cytoskeletal 18 | EBI-11083608 | 0.35 |
| P48730 | Casein kinase I isoform delta | EBI-28935490 | 0.35 |
| P53671 | LIM domain kinase 2 | EBI-28938453 | 0.35 |
| P02545 | Lamin-A/C | EBI-16795953 | 0.35 |
| Q14244 | Ensconsin | EBI-11083608 | 0.35 |
| P0DTC7 | ORF7a protein | EBI-25510184 | 0.35 |
| Q6P5Z2 | Serine/threonine-protein kinase N3 | EBI-28941754 | 0.35 | Interactions with other proteins (228 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q99759 | Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.11.25) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3) | EBI-362439 | 0.00 |
| D3DR86 | Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (P49/p100), isoform CRA_c | EBI-365389 | 0.00 |
| Q8AZK7 | Epstein-Barr nuclear antigen leader protein (EBNA-LP) (EBV nuclear antigen leader protein) (Epstein-Barr nuclear antigen 5) (EBNA-5) (EBV nuclear antigen 5) | EBI-9632715 | 0.35 |
| P29353 | SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1) | EBI-2615019 | 0.35 |
| P01375 | Tumor necrosis factor (Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-domain 1; C-domain 2; Tumor necrosis factor, soluble form] | EBI-2691312 | 0.00 |
| Q15051 | IQ calmodulin-binding motif-containing protein 1 (Nephrocystin-5) (p53 and DNA damage-regulated IQ motif protein) (PIQ) | EBI-4286917 | 0.35 |
| O95758 | Polypyrimidine tract-binding protein 3 (Regulator of differentiation 1) (Rod1) | EBI-7850130 | 0.35 |
| P48729 | Casein kinase I isoform alpha (CKI-alpha) (EC 2.7.11.1) (CK1) | EBI-6255977 | 0.64 |
| P49674 | Casein kinase I isoform epsilon (CKI-epsilon) (CKIe) (EC 2.7.11.1) | EBI-6256083 | 0.53 |
| Q86VP6 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-21322532 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| Q9UBN7 | Histone deacetylase 6 (HD6) (EC 3.5.1.98) (Tubulin-lysine deacetylase HDAC6) (EC 3.5.1.-) | EBI-6597993 | 0.35 |
| Q9BY41 | Histone deacetylase 8 (HD8) (EC 3.5.1.98) (Protein deacetylase HDAC8) (EC 3.5.1.-) (Protein decrotonylase HDAC8) (EC 3.5.1.-) | EBI-6598094 | 0.35 |
| Q96DB2 | Histone deacetylase 11 (HD11) (EC 3.5.1.98) | EBI-6598272 | 0.35 |
| Q9H4B6 | Protein salvador homolog 1 (45 kDa WW domain protein) (hWW45) | EBI-8798025 | 0.57 |
| O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A (PP6-ARS-A) (Serine/threonine-protein phosphatase 6 regulatory subunit ARS-A) (Ankyrin repeat domain-containing protein 28) (Phosphatase interactor targeting protein hnRNP K) (PITK) | EBI-8798340 | 0.27 |
| O95835 | Serine/threonine-protein kinase LATS1 (EC 2.7.11.1) (Large tumor suppressor homolog 1) (WARTS protein kinase) (h-warts) | EBI-8798552 | 0.27 |
| Q7TSJ6 | Serine/threonine-protein kinase LATS2 (EC 2.7.11.1) (Kinase phosphorylated during mitosis protein) (Large tumor suppressor homolog 2) (Serine/threonine-protein kinase kpm) | EBI-8800022 | 0.27 |
| Q9H6Z9 | Prolyl hydroxylase EGLN3 (EC 1.14.11.-) (Egl nine homolog 3) (EC 1.14.11.29) (HPH-1) (Hypoxia-inducible factor prolyl hydroxylase 3) (HIF-PH3) (HIF-prolyl hydroxylase 3) (HPH-3) (Prolyl hydroxylase domain-containing protein 3) (PHD3) | EBI-12503146 | 0.35 |
| P57078 | Receptor-interacting serine/threonine-protein kinase 4 (EC 2.7.11.1) (Ankyrin repeat domain-containing protein 3) (PKC-delta-interacting protein kinase) | EBI-12503575 | 0.35 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-10045643 | 0.65 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-9996267 | 0.35 |
| Q92731 | Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2) | EBI-9996422 | 0.35 |
| P51617 | Interleukin-1 receptor-associated kinase 1 (IRAK-1) (EC 2.7.11.1) | EBI-10103481 | 0.53 |
| P03179 | Major tegument protein (MTP) (Protein p140) | EBI-11721697 | 0.35 |
| P0CK56 | Uncharacterized protein BDLF4 | EBI-11725466 | 0.35 |
| Q2MG96 | BGLF3.5 protein | EBI-11733890 | 0.35 |
| Q69117 | Tripartite terminase subunit 2 | EBI-11733954 | 0.35 |
| E9QKK1 | Centromere-associated protein E | EBI-10995761 | 0.35 |
| Q91X51 | Golgi reassembly-stacking protein 1 (Golgi peripheral membrane protein p65) (Golgi reassembly-stacking protein of 65 kDa) (GRASP65) | EBI-11015786 | 0.35 |
| Q8VC57 | BTB/POZ domain-containing protein KCTD5 | EBI-11027413 | 0.35 |
| Q92614 | Unconventional myosin-XVIIIa (Molecule associated with JAK3 N-terminus) (MAJN) (Myosin containing a PDZ domain) (Surfactant protein receptor SP-R210) (SP-R210) | EBI-11030093 | 0.35 |
| Q96H55 | Unconventional myosin-XIX (Myosin head domain-containing protein 1) | EBI-11031416 | 0.35 |
| P60710 | Actin, cytoplasmic 1 (Beta-actin) (EC 3.6.4.-) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed] | EBI-11045267 | 0.35 |
| Q9DBR0 | A-kinase anchor protein 8 (AKAP-8) (A-kinase anchor protein 95 kDa) (AKAP 95) | EBI-11047776 | 0.35 |
| Q9D7I8 | Protein FAM83D | EBI-11048266 | 0.35 |
| Q9ERG0 | LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm) (mEPLIN) | EBI-11054044 | 0.35 |
| Q9UHB6 | LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm) | EBI-11058729 | 0.35 |
| Q9D6P8 | Calmodulin-like protein 3 | EBI-11062262 | 0.35 |
| Q9Z2X1 | Heterogeneous nuclear ribonucleoprotein F (hnRNP F) [Cleaved into: Heterogeneous nuclear ribonucleoprotein F, N-terminally processed] | EBI-11066678 | 0.35 |
| Q8K389 | CDK5 regulatory subunit-associated protein 2 (CDK5 activator-binding protein C48) | EBI-11068831 | 0.35 |
| G3X972 | Sec24-related gene family, member C (S. cerevisiae) | EBI-11079358 | 0.35 |
| Q16643 | Drebrin (Developmentally-regulated brain protein) | EBI-11080402 | 0.35 |
| P09497 | Clathrin light chain B (Lcb) | EBI-11081190 | 0.35 |
| Q9NYZ3 | G2 and S phase-expressed protein 1 (GTSE-1) (Protein B99 homolog) | EBI-11081743 | 0.35 |
| Q13492 | Phosphatidylinositol-binding clathrin assembly protein (Clathrin assembly lymphoid myeloid leukemia protein) | EBI-11082344 | 0.35 |
| Q00610 | Clathrin heavy chain 1 (Clathrin heavy chain on chromosome 17) (CLH-17) | EBI-11082478 | 0.35 |
| P50548 | ETS domain-containing transcription factor ERF (Ets2 repressor factor) (PE-2) | EBI-11083608 | 0.35 |
| P61978 | Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (Transformation up-regulated nuclear protein) (TUNP) | EBI-11083608 | 0.35 |
| E9PC66 | Zinc finger protein with KRAB and SCAN domains 1 | EBI-11083608 | 0.35 |
| Q9NX05 | Constitutive coactivator of PPAR-gamma-like protein 2 (Protein FAM120C) (Tumor antigen BJ-HCC-21) | EBI-11083608 | 0.35 |
| P31942 | Heterogeneous nuclear ribonucleoprotein H3 (hnRNP H3) (Heterogeneous nuclear ribonucleoprotein 2H9) (hnRNP 2H9) | EBI-11083608 | 0.35 |
| P52272 | Heterogeneous nuclear ribonucleoprotein M (hnRNP M) | EBI-11083608 | 0.35 |
| Q8N0X7 | Spartin (Spastic paraplegia 20 protein) (Trans-activated by hepatitis C virus core protein 1) | EBI-11083608 | 0.35 |
| Q9ULX6 | A-kinase anchor protein 8-like (AKAP8-like protein) (Helicase A-binding protein 95) (HAP95) (Homologous to AKAP95 protein) (HA95) (Neighbor of A-kinase-anchoring protein 95) (Neighbor of AKAP95) | EBI-11083608 | 0.35 |
| Q92540 | Nonsense-mediated mRNA decay factor SMG7 (SMG-7 homolog) (hSMG-7) | EBI-11083608 | 0.35 |
| O95817 | BAG family molecular chaperone regulator 3 (BAG-3) (Bcl-2-associated athanogene 3) (Bcl-2-binding protein Bis) (Docking protein CAIR-1) | EBI-11083608 | 0.35 |
| O95782 | AP-2 complex subunit alpha-1 (100 kDa coated vesicle protein A) (Adaptor protein complex AP-2 subunit alpha-1) (Adaptor-related protein complex 2 subunit alpha-1) (Alpha-adaptin A) (Alpha1-adaptin) (Clathrin assembly protein complex 2 alpha-A large chain) (Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit) | EBI-11083608 | 0.35 |
| P27708 | CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] | EBI-11083608 | 0.35 |
| P13861 | cAMP-dependent protein kinase type II-alpha regulatory subunit | EBI-11083608 | 0.35 |
| Q9BWF3 | RNA-binding protein 4 (Lark homolog) (hLark) (RNA-binding motif protein 4) (RNA-binding motif protein 4a) | EBI-11083608 | 0.35 |
| P53675 | Clathrin heavy chain 2 (Clathrin heavy chain on chromosome 22) (CLH-22) | EBI-11083608 | 0.35 |
| Q15437 | Protein transport protein Sec23B (hSec23B) (SEC23-related protein B) | EBI-11083608 | 0.35 |
| Q96I24 | Far upstream element-binding protein 3 (FUSE-binding protein 3) | EBI-11083608 | 0.35 |
| Q8TD26 | Chromodomain-helicase-DNA-binding protein 6 (CHD-6) (EC 3.6.4.12) (ATP-dependent helicase CHD6) (Radiation-induced gene B protein) | EBI-11083608 | 0.35 |
| Q8N684 | Cleavage and polyadenylation specificity factor subunit 7 (Cleavage and polyadenylation specificity factor 59 kDa subunit) (CPSF 59 kDa subunit) (Cleavage factor Im complex 59 kDa subunit) (CFIm59) (Pre-mRNA cleavage factor Im 59 kDa subunit) | EBI-11083608 | 0.35 |
| Q32P28 | Prolyl 3-hydroxylase 1 (EC 1.14.11.7) (Growth suppressor 1) (Leucine- and proline-enriched proteoglycan 1) (Leprecan-1) | EBI-11083608 | 0.35 |
| P18206 | Vinculin (Metavinculin) (MV) | EBI-11083608 | 0.35 |
| Q1KMD3 | Heterogeneous nuclear ribonucleoprotein U-like protein 2 (Scaffold-attachment factor A2) (SAF-A2) | EBI-11083608 | 0.35 |
| Q9HAU0 | Pleckstrin homology domain-containing family A member 5 (PH domain-containing family A member 5) (Phosphoinositol 3-phosphate-binding protein 2) (PEPP-2) | EBI-11083608 | 0.35 |
| Q08379 | Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95) | EBI-11083608 | 0.48 |
| Q9NZB2 | Constitutive coactivator of PPAR-gamma-like protein 1 (Oxidative stress-associated Src activator) (Protein FAM120A) | EBI-11083608 | 0.35 |
| P15924 | Desmoplakin (DP) (250/210 kDa paraneoplastic pemphigus antigen) | EBI-11083608 | 0.35 |
| Q5JSZ5 | Protein PRRC2B (HLA-B-associated transcript 2-like 1) (Proline-rich coiled-coil protein 2B) | EBI-11083608 | 0.35 |
| Q9UHV9 | Prefoldin subunit 2 | EBI-11083608 | 0.35 |
| O95487 | Protein transport protein Sec24B (SEC24-related protein B) | EBI-11083608 | 0.35 |
| P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed] | EBI-11083608 | 0.35 |
| F5H365 | Protein transport protein SEC23 | EBI-11083608 | 0.35 |
| Q6ZRV2 | Protein FAM83H | EBI-11083608 | 0.35 |
| Q14134 | Tripartite motif-containing protein 29 (Ataxia telangiectasia group D-associated protein) | EBI-11083608 | 0.35 |
| P42694 | Probable helicase with zinc finger domain (EC 3.6.4.-) (Down-regulated in human cancers protein) | EBI-11083608 | 0.35 |
| O15460 | Prolyl 4-hydroxylase subunit alpha-2 (4-PH alpha-2) (EC 1.14.11.2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2) | EBI-11083608 | 0.35 |
| O95486 | Protein transport protein Sec24A (SEC24-related protein A) | EBI-11083608 | 0.35 |
| Q6UN15 | Pre-mRNA 3'-end-processing factor FIP1 (hFip1) (FIP1-like 1 protein) (Factor interacting with PAP) (Rearranged in hypereosinophilia) | EBI-11083608 | 0.35 |
| Q8N163 | Cell cycle and apoptosis regulator protein 2 (Cell division cycle and apoptosis regulator protein 2) (DBIRD complex subunit KIAA1967) (Deleted in breast cancer gene 1 protein) (DBC-1) (DBC.1) (NET35) (p30 DBC) | EBI-11083608 | 0.35 |
| P09496 | Clathrin light chain A (Lca) | EBI-11083608 | 0.35 |
| Q8WUF5 | RelA-associated inhibitor (Inhibitor of ASPP protein) (Protein iASPP) (NFkB-interacting protein 1) (PPP1R13B-like protein) | EBI-11083608 | 0.35 |
| C9JE98 | Nuclear receptor corepressor 2 | EBI-11083608 | 0.35 |
| Q99959 | Plakophilin-2 | EBI-11083608 | 0.35 |
| Q8IWZ3 | Ankyrin repeat and KH domain-containing protein 1 (HIV-1 Vpr-binding ankyrin repeat protein) (Multiple ankyrin repeats single KH domain) (hMASK) | EBI-11083608 | 0.35 |
| Q96MX6 | Dynein axonemal assembly factor 10 (WD repeat-containing protein 92) (WD repeat-containing protein Monad) | EBI-11083608 | 0.35 |
| Q9UHF7 | Zinc finger transcription factor Trps1 (Tricho-rhino-phalangeal syndrome type I protein) (Zinc finger protein GC79) | EBI-11083608 | 0.35 |
| Q9NRA8 | Eukaryotic translation initiation factor 4E transporter (4E-T) (eIF4E transporter) (Eukaryotic translation initiation factor 4E nuclear import factor 1) | EBI-11083608 | 0.35 |
| Q9NWS0 | PIH1 domain-containing protein 1 (Nucleolar protein 17 homolog) | EBI-11083608 | 0.35 |
| Q86UY5 | Protein FAM83A (Tumor antigen BJ-TSA-9) (Tumor-specific gene expressed in prostate protein) | EBI-11083608 | 0.35 |
| Q14498 | RNA-binding protein 39 (CAPER alpha) (CAPERalpha) (Hepatocellular carcinoma protein 1) (RNA-binding motif protein 39) (RNA-binding region-containing protein 2) (Splicing factor HCC1) | EBI-11083608 | 0.35 |
| P12268 | Inosine-5'-monophosphate dehydrogenase 2 (IMP dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205) (Inosine-5'-monophosphate dehydrogenase type II) (IMP dehydrogenase II) (IMPDH-II) | EBI-11083608 | 0.35 |
| P53992 | Protein transport protein Sec24C (SEC24-related protein C) | EBI-11083608 | 0.35 |
| Q13470 | Non-receptor tyrosine-protein kinase TNK1 (EC 2.7.10.2) (CD38 negative kinase 1) | EBI-11083608 | 0.35 |
| Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 (Ankyrin repeat domain-containing protein 25) (Matrix-remodeling-associated protein 3) (SRC-1-interacting protein) (SIP) (SRC-interacting protein) (SRC1-interacting protein) | EBI-11083608 | 0.35 |
| O15379 | Histone deacetylase 3 (HD3) (EC 3.5.1.98) (Protein deacetylase HDAC3) (EC 3.5.1.-) (Protein deacylase HDAC3) (EC 3.5.1.-) (RPD3-2) (SMAP45) | EBI-11083608 | 0.35 |
| Q9Y2F9 | BTB/POZ domain-containing protein 3 | EBI-11083608 | 0.35 |
| Q5T0W9 | Protein FAM83B | EBI-11083608 | 0.35 |
| Q5T5P2 | Sickle tail protein homolog | EBI-11083608 | 0.35 |
| Q9Y446 | Plakophilin-3 | EBI-11083608 | 0.35 |
| Q14671 | Pumilio homolog 1 (HsPUM) (Pumilio-1) | EBI-11083608 | 0.35 |
| H0YH87 | Ataxin-2 | EBI-11083608 | 0.35 |
| O00443 | Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha (PI3K-C2-alpha) (PtdIns-3-kinase C2 subunit alpha) (EC 2.7.1.137) (EC 2.7.1.153) (EC 2.7.1.154) (Phosphoinositide 3-kinase-C2-alpha) | EBI-11083608 | 0.35 |
| Q96PK6 | RNA-binding protein 14 (Paraspeckle protein 2) (PSP2) (RNA-binding motif protein 14) (RRM-containing coactivator activator/modulator) (Synaptotagmin-interacting protein) (SYT-interacting protein) | EBI-11083608 | 0.35 |
| Q9NSY1 | BMP-2-inducible protein kinase (BIKe) (EC 2.7.11.1) | EBI-11083608 | 0.35 |
| P20839 | Inosine-5'-monophosphate dehydrogenase 1 (IMP dehydrogenase 1) (IMPD 1) (IMPDH 1) (EC 1.1.1.205) (IMPDH-I) | EBI-11083608 | 0.35 |
| Q9C0J8 | pre-mRNA 3' end processing protein WDR33 (WD repeat-containing protein 33) (WD repeat-containing protein of 146 kDa) | EBI-11083608 | 0.35 |
| Q9H4H8 | Protein FAM83D (Spindle protein CHICA) | EBI-11083608 | 0.35 |
| O60763 | General vesicular transport factor p115 (Protein USO1 homolog) (Transcytosis-associated protein) (TAP) (Vesicle-docking protein) | EBI-11083608 | 0.35 |
| P04003 | C4b-binding protein alpha chain (C4bp) (Proline-rich protein) (PRP) | EBI-11083608 | 0.35 |
| Q8N3V7 | Synaptopodin | EBI-11086992 | 0.35 |
| Q15691 | Microtubule-associated protein RP/EB family member 1 (APC-binding protein EB1) (End-binding protein 1) (EB1) | EBI-11091481 | 0.35 |
| Q8VDD5 | Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA) | EBI-11092730 | 0.35 |
| Q9WTI7 | Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb) | EBI-11093786 | 0.35 |
| Q8CAF4 | NHS-like protein 1 | EBI-11096313 | 0.35 |
| P35579 | Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA) | EBI-11098811 | 0.35 |
| Q6ZPU9 | KIF-binding protein (KIF1-binding protein) | EBI-11102340 | 0.35 |
| Q6PJG2 | Mitotic deacetylase-associated SANT domain protein (ELM2 and SANT domain-containing protein 1) | EBI-11106137 | 0.35 |
| P24941 | Cyclin-dependent kinase 2 (EC 2.7.11.22) (Cell division protein kinase 2) (p33 protein kinase) | EBI-11106375 | 0.35 |
| Q96QS3 | Homeobox protein ARX (Aristaless-related homeobox) | EBI-11107478 | 0.35 |
| Q9Z1Z0 | General vesicular transport factor p115 (Protein USO1 homolog) (Transcytosis-associated protein) (TAP) (Vesicle-docking protein) | EBI-11110688 | 0.35 |
| P47755 | F-actin-capping protein subunit alpha-2 (CapZ alpha-2) | EBI-11117728 | 0.35 |
| Q96HQ2 | CDKN2AIP N-terminal-like protein (CDKN2A-interacting protein N-terminal-like protein) | EBI-11125466 | 0.35 |
| P46940 | Ras GTPase-activating-like protein IQGAP1 (p195) | EBI-11132927 | 0.35 |
| P62140 | Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53) | EBI-11142496 | 0.35 |
| P31323 | cAMP-dependent protein kinase type II-beta regulatory subunit | EBI-11146630 | 0.35 |
| Q9HC77 | Centromere protein J (CENP-J) (Centrosomal P4.1-associated protein) (LAG-3-associated protein) (LYST-interacting protein 1) | EBI-11397411 | 0.27 |
| Q6P5F9 | Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog) | EBI-11603310 | 0.35 |
| Q9NZN9 | Aryl-hydrocarbon-interacting protein-like 1 | EBI-12448890 | 0.51 |
| Q9NQH7 | Xaa-Pro aminopeptidase 3 (X-Pro aminopeptidase 3) (EC 3.4.11.9) (Aminopeptidase P3) (APP3) | EBI-12452910 | 0.51 |
| P03431 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) | EBI-12579142 | 0.35 |
| P03428 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-12579909 | 0.35 |
| I6T1Z2 | Non-structural protein 1 (NS1) | EBI-12581941 | 0.35 |
| Q5EP37 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) | EBI-12582596 | 0.35 |
| C5E526 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) | EBI-12584472 | 0.35 |
| C5E527 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-12585279 | 0.35 |
| Q1K9H5 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) | EBI-12588098 | 0.35 |
| B4URF7 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-12588729 | 0.35 |
| O14829 | Serine/threonine-protein phosphatase with EF-hands 1 (PPEF-1) (EC 3.1.3.16) (Protein phosphatase with EF calcium-binding domain) (PPEF) (Serine/threonine-protein phosphatase 7) (PP7) | EBI-14024386 | 0.35 |
| Q9BY84 | Dual specificity protein phosphatase 16 (EC 3.1.3.16) (EC 3.1.3.48) (Mitogen-activated protein kinase phosphatase 7) (MAP kinase phosphatase 7) (MKP-7) | EBI-14027455 | 0.35 |
| P07196 | Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein) | EBI-21716934 | 0.35 |
| Q9BVA0 | Katanin p80 WD40 repeat-containing subunit B1 (Katanin p80 subunit B1) (p80 katanin) | EBI-16421856 | 0.35 |
| Q01968 | Inositol polyphosphate 5-phosphatase OCRL (EC 3.1.3.36) (EC 3.1.3.56) (Inositol polyphosphate 5-phosphatase OCRL-1) (OCRL-1) (Lowe oculocerebrorenal syndrome protein) (Phosphatidylinositol 3,4,5-triphosphate 5-phosphatase) (EC 3.1.3.86) | EBI-16412116 | 0.35 |
| Q96RS6 | NudC domain-containing protein 1 (Chronic myelogenous leukemia tumor antigen 66) (Tumor antigen CML66) | EBI-20723339 | 0.35 |
| Q6ZNJ1 | Neurobeachin-like protein 2 | EBI-16749633 | 0.64 |
| Q96N67 | Dedicator of cytokinesis protein 7 | EBI-16749780 | 0.50 |
| Q08AM6 | Protein VAC14 homolog (Tax1-binding protein 2) | EBI-16749791 | 0.35 |
| Q9NWT8 | Aurora kinase A-interacting protein (AURKA-interacting protein) (28S ribosomal protein S38, mitochondrial) (MRP-S38) (Mitochondrial small ribosomal subunit protein mS38) | EBI-16786806 | 0.27 |
| Q96GD4 | Aurora kinase B (EC 2.7.11.1) (Aurora 1) (Aurora- and IPL1-like midbody-associated protein 1) (AIM-1) (Aurora/IPL1-related kinase 2) (ARK-2) (Aurora-related kinase 2) (STK-1) (Serine/threonine-protein kinase 12) (Serine/threonine-protein kinase 5) (Serine/threonine-protein kinase aurora-B) | EBI-16787973 | 0.57 |
| O15155 | BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18) | EBI-16788067 | 0.42 |
| P27824 | Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) | EBI-16788621 | 0.27 |
| Q96I36 | Cytochrome c oxidase assembly protein COX14 | EBI-16791250 | 0.27 |
| P49841 | Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1) | EBI-16793176 | 0.42 |
| P19367 | Hexokinase-1 (EC 2.7.1.1) (Brain form hexokinase) (Hexokinase type I) (HK I) (Hexokinase-A) | EBI-16794773 | 0.27 |
| O14880 | Microsomal glutathione S-transferase 3 (Microsomal GST-3) (Glutathione peroxidase MGST3) (EC 1.11.1.-) (LTC4 synthase MGST3) (EC 4.4.1.20) (Microsomal glutathione S-transferase III) (Microsomal GST-III) | EBI-16796348 | 0.27 |
| P25786 | Proteasome subunit alpha type-1 (30 kDa prosomal protein) (PROS-30) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome component C2) (Proteasome nu chain) | EBI-16797556 | 0.42 |
| Q9HBL7 | Plasminogen receptor (KT) (Plg-R(KT)) | EBI-16797780 | 0.27 |
| P62491 | Ras-related protein Rab-11A (Rab-11) (EC 3.6.5.2) (YL8) | EBI-16797971 | 0.27 |
| P51151 | Ras-related protein Rab-9A | EBI-16798325 | 0.27 |
| O75880 | Protein SCO1 homolog, mitochondrial | EBI-16799233 | 0.27 |
| O43493 | Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2) | EBI-16800265 | 0.42 |
| Q9NS69 | Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog) | EBI-16802054 | 0.27 |
| P49336 | Cyclin-dependent kinase 8 (EC 2.7.11.22) (EC 2.7.11.23) (Cell division protein kinase 8) (Mediator complex subunit CDK8) (Mediator of RNA polymerase II transcription subunit CDK8) (Protein kinase K35) | EBI-16790691 | 0.35 |
| Q15075 | Early endosome antigen 1 (Endosome-associated protein p162) (Zinc finger FYVE domain-containing protein 2) | EBI-16791749 | 0.35 |
| P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | EBI-16792111 | 0.35 |
| P22087 | rRNA 2'-O-methyltransferase fibrillarin (EC 2.1.1.-) (34 kDa nucleolar scleroderma antigen) (Histone-glutamine methyltransferase) (U6 snRNA 2'-O-methyltransferase fibrillarin) | EBI-16792571 | 0.35 |
| P20339 | Ras-related protein Rab-5A (EC 3.6.5.2) | EBI-16798290 | 0.35 |
| Q71U36 | Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain] | EBI-16799786 | 0.35 |
| P23258 | Tubulin gamma-1 chain (Gamma-1-tubulin) (Gamma-tubulin complex component 1) (GCP-1) | EBI-16800136 | 0.35 |
| P11279 | Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a) | EBI-16795491 | 0.27 |
| O75521 | Enoyl-CoA delta isomerase 2 (EC 5.3.3.8) (DRS-1) (Delta(3),delta(2)-enoyl-CoA isomerase) (D3,D2-enoyl-CoA isomerase) (Diazepam-binding inhibitor-related protein 1) (DBI-related protein 1) (Dodecenoyl-CoA isomerase) (Hepatocellular carcinoma-associated antigen 88) (Peroxisomal 3,2-trans-enoyl-CoA isomerase) (pECI) (Renal carcinoma antigen NY-REN-1) | EBI-16811476 | 0.35 |
| P08559 | Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I) | EBI-20306509 | 0.35 |
| Q12824 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (BRG1-associated factor 47) (BAF47) (Integrase interactor 1 protein) (SNF5 homolog) (hSNF5) | EBI-20623811 | 0.42 |
| Q9Y2H1 | Serine/threonine-protein kinase 38-like (EC 2.7.11.1) (NDR2 protein kinase) (Nuclear Dbf2-related kinase 2) | EBI-20624096 | 0.42 |
| A2A935 | Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1) | EBI-21024514 | 0.35 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| Q9ULK4 | Mediator of RNA polymerase II transcription subunit 23 (Activator-recruited cofactor 130 kDa component) (ARC130) (Cofactor required for Sp1 transcriptional activation subunit 3) (CRSP complex subunit 3) (Mediator complex subunit 23) (Protein sur-2 homolog) (hSur-2) (Transcriptional coactivator CRSP130) (Vitamin D3 receptor-interacting protein complex 130 kDa component) (DRIP130) | EBI-25472850 | 0.35 |
| Q9UQM7 | Calcium/calmodulin-dependent protein kinase type II subunit alpha (CaM kinase II subunit alpha) (CaMK-II subunit alpha) (EC 2.7.11.17) | EBI-25380388 | 0.35 |
| P28482 | Mitogen-activated protein kinase 1 (MAP kinase 1) (MAPK 1) (EC 2.7.11.24) (ERT1) (Extracellular signal-regulated kinase 2) (ERK-2) (MAP kinase isoform p42) (p42-MAPK) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2) | EBI-25381527 | 0.35 |
| Q8N4T4 | Rho guanine nucleotide exchange factor 39 | EBI-25408280 | 0.35 |
| Q7Z5H3 | Rho GTPase-activating protein 22 (Rho-type GTPase-activating protein 22) | EBI-25409874 | 0.35 |
| Q8IZD9 | Dedicator of cytokinesis protein 3 (Modifier of cell adhesion) (Presenilin-binding protein) (PBP) | EBI-25411696 | 0.35 |
| P0DTC8 | ORF8 protein (ORF8) (Non-structural protein 8) (ns8) | EBI-25510273 | 0.35 |
| A0A663DJA2 | Putative ORF10 protein | EBI-25510410 | 0.35 |
| Q13627 | Dual specificity tyrosine-phosphorylation-regulated kinase 1A (EC 2.7.11.23) (EC 2.7.12.1) (Dual specificity YAK1-related kinase) (HP86) (Protein kinase minibrain homolog) (MNBH) (hMNB) | EBI-26367331 | 0.35 |
| P48431 | Transcription factor SOX-2 | EBI-26574571 | 0.35 |
| Q96LU5 | Mitochondrial inner membrane protease subunit 1 (EC 3.4.21.-) (IMP1-like protein) | EBI-27050332 | 0.35 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27109494 | 0.35 |
| P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-27084109 | 0.35 |
| O14733 | Dual specificity mitogen-activated protein kinase kinase 7 (MAP kinase kinase 7) (MAPKK 7) (EC 2.7.12.2) (JNK-activating kinase 2) (MAPK/ERK kinase 7) (MEK 7) (Stress-activated protein kinase kinase 4) (SAPK kinase 4) (SAPKK-4) (SAPKK4) (c-Jun N-terminal kinase kinase 2) (JNK kinase 2) (JNKK 2) | EBI-28930089 | 0.35 |
| P11274 | Breakpoint cluster region protein (EC 2.7.11.1) (Renal carcinoma antigen NY-REN-26) | EBI-28931791 | 0.35 |
| P42680 | Tyrosine-protein kinase Tec (EC 2.7.10.2) | EBI-28935138 | 0.35 |
| Q13418 | Integrin-linked protein kinase (EC 2.7.11.1) (59 kDa serine/threonine-protein kinase) (Beta-integrin-linked kinase) (ILK-1) (ILK-2) (p59ILK) | EBI-28939366 | 0.35 |
| Q14012 | Calcium/calmodulin-dependent protein kinase type 1 (EC 2.7.11.17) (CaM kinase I) (CaM-KI) (CaM kinase I alpha) (CaMKI-alpha) | EBI-28939656 | 0.35 |
| Q15208 | Serine/threonine-protein kinase 38 (EC 2.7.11.1) (NDR1 protein kinase) (Nuclear Dbf2-related kinase 1) | EBI-28941263 | 0.35 |
| Q16654 | [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial (EC 2.7.11.2) (Pyruvate dehydrogenase kinase isoform 4) | EBI-28941523 | 0.35 |
| Q6P3W7 | SCY1-like protein 2 (Coated vesicle-associated kinase of 104 kDa) | EBI-28941741 | 0.35 |
| Q76MJ5 | Serine/threonine-protein kinase/endoribonuclease IRE2 (Endoplasmic reticulum-to-nucleus signaling 2) (Inositol-requiring protein 2) (hIRE2p) (Ire1-beta) (IRE1b) [Includes: Serine/threonine-protein kinase (EC 2.7.11.1); Endoribonuclease (EC 3.1.26.-)] | EBI-28941934 | 0.35 |
| Q8TAS1 | Serine/threonine-protein kinase Kist (EC 2.7.11.1) (Kinase interacting with stathmin) (PAM COOH-terminal interactor protein 2) (P-CIP2) (U2AF homology motif kinase 1) | EBI-28943630 | 0.35 |
| Q8TDX7 | Serine/threonine-protein kinase Nek7 (EC 2.7.11.1) (Never in mitosis A-related kinase 7) (NimA-related protein kinase 7) | EBI-28943744 | 0.35 |
| Q9BUB5 | MAP kinase-interacting serine/threonine-protein kinase 1 (EC 2.7.11.1) (MAP kinase signal-integrating kinase 1) (MAPK signal-integrating kinase 1) (Mnk1) | EBI-28944975 | 0.35 |
| Q9BYP7 | Serine/threonine-protein kinase WNK3 (EC 2.7.11.1) (Protein kinase lysine-deficient 3) (Protein kinase with no lysine 3) | EBI-28946054 | 0.35 |
| Q9NRM7 | Serine/threonine-protein kinase LATS2 (EC 2.7.11.1) (Kinase phosphorylated during mitosis protein) (Large tumor suppressor homolog 2) (Serine/threonine-protein kinase kpm) (Warts-like kinase) | EBI-28946455 | 0.35 |
| Q9NSY0 | Nuclear receptor-binding protein 2 (Transformation-related gene 16 protein) (TRG-16) | EBI-28946547 | 0.35 |
| Q9UJY1 | Heat shock protein beta-8 (HspB8) (Alpha-crystallin C chain) (E2-induced gene 1 protein) (Protein kinase H11) (Small stress protein-like protein HSP22) | EBI-28946841 | 0.35 |
| Q9Y6S9 | Ribosomal protein S6 kinase-like 1 (EC 2.7.11.1) | EBI-28948011 | 0.35 |
| Q92630 | Dual specificity tyrosine-phosphorylation-regulated kinase 2 (EC 2.7.12.1) | EBI-28952196 | 0.27 |
| O00167 | Eyes absent homolog 2 (EC 3.1.3.48) | EBI-27116032 | 0.27 |
| Q15326 | Zinc finger MYND domain-containing protein 11 (Adenovirus 5 E1A-binding protein) (Bone morphogenetic protein receptor-associated molecule 1) (Protein BS69) | EBI-30824425 | 0.44 |
| Q13363 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) | EBI-28997163 | 0.27 |
| Q9BXK1 | Krueppel-like factor 16 (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2) | EBI-29019783 | 0.35 |
| O95600 | Krueppel-like factor 8 (Basic krueppel-like factor 3) (Zinc finger protein 741) | EBI-29020196 | 0.35 |
| P43268 | ETS translocation variant 4 (Adenovirus E1A enhancer-binding protein) (E1A-F) (Polyomavirus enhancer activator 3 homolog) (Protein PEA3) | EBI-29015385 | 0.27 |
| P41212 | Transcription factor ETV6 (ETS translocation variant 6) (ETS-related protein Tel1) (Tel) | EBI-29015445 | 0.27 |
| Q9UIH9 | Krueppel-like factor 15 (Kidney-enriched krueppel-like factor) | EBI-29018016 | 0.27 |
| Q13887 | Krueppel-like factor 5 (Basic transcription element-binding protein 2) (BTE-binding protein 2) (Colon krueppel-like factor) (GC-box-binding protein 2) (Intestinal-enriched krueppel-like factor) (Transcription factor BTEB2) | EBI-29018613 | 0.27 |
| Q99612 | Krueppel-like factor 6 (B-cell-derived protein 1) (Core promoter element-binding protein) (GC-rich sites-binding factor GBF) (Proto-oncogene BCD1) (Suppressor of tumorigenicity 12 protein) (Transcription factor Zf9) | EBI-29018743 | 0.27 |
| Q13886 | Krueppel-like factor 9 (Basic transcription element-binding protein 1) (BTE-binding protein 1) (GC-box-binding protein 1) (Transcription factor BTEB1) | EBI-29018980 | 0.27 |
| Q14934 | Nuclear factor of activated T-cells, cytoplasmic 4 (NF-ATc4) (NFATc4) (T-cell transcription factor NFAT3) (NF-AT3) | EBI-29668679 | 0.27 |
| Q06945 | Transcription factor SOX-4 | EBI-29725484 | 0.27 |
| Q14765 | Signal transducer and activator of transcription 4 | EBI-29763222 | 0.27 |
| P29322 | Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK) | EBI-32721175 | 0.27 |
| Q96ED9 | Protein Hook homolog 2 (h-hook2) (hHK2) | EBI-34575530 | 0.27 |
Database | Links |
| UNIPROT | O15027 A1YCA4 J3KNL6 Q4G0D7 Q5SXP0 Q5SXP1 Q8N347 Q96HP1 |
| Pfam | PF12932 PF12931 |
| OMIM | 612854 |
| DisGeNET | 9919 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory