E1B protein, small T-antigen - Human adenovirus 5

E1B protein, small T-antigen (Human adenovirus 5)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	E1B protein, small T-antigen
Accession Code	P03246
Gene	E1BS
Organism	Human adenovirus 5 (Taxonomy: 28285)
Part of Reference Proteome?	No
Sequence (Length: 176)
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHK NRLLLLSSVRPAIIPTEEQQQQQEEARRRRQEQSPWNPRAGLDPRE

Subcellular Location

Description
Host cell membrane. Host nucleus envelope. Host nucleus lamina. Note=Associated with the plasma and nuclear membranes, and with the insoluble nuclear lamina.
Position in the Nuclear Envelope
Location	Location ID	Description
Host Nuclear Envelope	SL-0415	The host nuclear envelope is a membrane system which surrounds the host nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the host nuclear intermembrane space. Note: This location is defined for viral proteins that appear in the Nuclear Envelope of infected host cells
Host Nuclear Lamina	SL-0416	The host nuclear lamina is a meshwork of intermediate filament proteins called lamins and lamin-binding proteins that are embedded in the host inner nuclear membrane. Note: This location is defined for viral proteins that appear in the nuclear lamina of infected host cells
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Host Cell Nuclear Lamina (GO:0044203) Host Cell Plasma Membrane (GO:0020002) Membrane (GO:0016020)

Biology & Function

Description
Putative adenovirus Bcl-2 homolog that inhibits apoptosis induced by TNF or FAS pathways, as well as p53-mediated apoptosis. Without E1B 19K function, virus production is compromised because of premature death of host cell. Interacts with Bax protein in cell lysates.
Assigned Ontology terms

Biological Process	Suppression By Virus Of Host Apoptotic Process (GO:0019050)
Molecular Function

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (10 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O15173	Membrane-associated progesterone receptor component 2	EBI-11722343	0.35
P62834	Ras-related protein Rap-1A	EBI-11722343	0.35
Q9NZM1	Myoferlin	EBI-11722343	0.35
Q9P0L0	Vesicle-associated membrane protein-associated protein A	EBI-11722343	0.35
Q9BTV4	Transmembrane protein 43	EBI-11722343	0.35
Q99523	Sortilin	EBI-11722343	0.35
P06703	Protein S100-A6	EBI-11722343	0.35
P50479	PDZ and LIM domain protein 4	EBI-11722343	0.35
P50402	Emerin	EBI-11722343	0.35
Q96KC8	DnaJ homolog subfamily C member 1	EBI-11722343	0.35
Interactions with other proteins (85 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9H2V7	Protein spinster homolog 1 (HSpin1) (Spinster-like protein 1)	EBI-11722343	0.35
P35813	Protein phosphatase 1A (EC 3.1.3.16) (Protein phosphatase 2C isoform alpha) (PP2C-alpha) (Protein phosphatase IA)	EBI-11722343	0.35
O95297	Myelin protein zero-like protein 1 (Protein zero-related)	EBI-11722343	0.35
P50281	Matrix metalloproteinase-14 (MMP-14) (EC 3.4.24.80) (MMP-X1) (Membrane-type matrix metalloproteinase 1) (MT-MMP 1) (MTMMP1) (Membrane-type-1 matrix metalloproteinase) (MT1-MMP) (MT1MMP)	EBI-11722343	0.35
O75695	Protein XRP2	EBI-11722343	0.35
Q9Y6C9	Mitochondrial carrier homolog 2 (Met-induced mitochondrial protein)	EBI-11722343	0.35
Q9BQB6	Vitamin K epoxide reductase complex subunit 1 (EC 1.17.4.4) (Vitamin K1 2,3-epoxide reductase subunit 1)	EBI-11722343	0.35
Q96IX5	ATP synthase membrane subunit K, mitochondrial (ATP synthase membrane subunit DAPIT, mitochondrial) (Diabetes-associated protein in insulin-sensitive tissues) (HCV F-transactivated protein 2) (Up-regulated during skeletal muscle growth protein 5)	EBI-11722343	0.35
O14773	Tripeptidyl-peptidase 1 (TPP-1) (EC 3.4.14.9) (Cell growth-inhibiting gene 1 protein) (Lysosomal pepstatin-insensitive protease) (LPIC) (Tripeptidyl aminopeptidase) (Tripeptidyl-peptidase I) (TPP-I)	EBI-11722343	0.35
Q96JJ7	Protein disulfide-isomerase TMX3 (EC 5.3.4.1) (Thioredoxin domain-containing protein 10) (Thioredoxin-related transmembrane protein 3)	EBI-11722343	0.35
P42166	Lamina-associated polypeptide 2, isoform alpha (Thymopoietin isoform alpha) (TP alpha) (Thymopoietin-related peptide isoform alpha) (TPRP isoform alpha) [Cleaved into: Thymopoietin (TP) (Splenin); Thymopentin (TP5)]	EBI-11722343	0.35
Q8N4L2	Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase (Type 2 PtdIns-4,5-P2 4-Ptase) (EC 3.1.3.78) (PtdIns-4,5-P2 4-Ptase II) (Transmembrane protein 55A)	EBI-11722343	0.35
Q9NV96	Cell cycle control protein 50A (P4-ATPase flippase complex beta subunit TMEM30A) (Transmembrane protein 30A)	EBI-11722343	0.35
Q9HC07	Transmembrane protein 165 (Transmembrane protein PT27) (Transmembrane protein TPARL)	EBI-11722343	0.35
O15533	Tapasin (TPN) (TPSN) (NGS-17) (TAP-associated protein) (TAP-binding protein)	EBI-11722343	0.35
P46977	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A (Oligosaccharyl transferase subunit STT3A) (STT3-A) (EC 2.4.99.18) (B5) (Integral membrane protein 1) (Transmembrane protein TMC)	EBI-11722343	0.35
Q13586	Stromal interaction molecule 1	EBI-11722343	0.35
Q9Y5M8	Signal recognition particle receptor subunit beta (SR-beta) (Protein APMCF1)	EBI-11722343	0.35
P08240	Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)	EBI-11722343	0.35
Q9Y6N5	Sulfide:quinone oxidoreductase, mitochondrial (SQOR) (EC 1.8.5.8) (Sulfide dehydrogenase-like) (Sulfide quinone oxidoreductase)	EBI-11722343	0.35
Q15599	Na(+)/H(+) exchange regulatory cofactor NHE-RF2 (NHERF-2) (NHE3 kinase A regulatory protein E3KARP) (SRY-interacting protein 1) (SIP-1) (Sodium-hydrogen exchanger regulatory factor 2) (Solute carrier family 9 isoform A3 regulatory factor 2) (Tyrosine kinase activator protein 1) (TKA-1)	EBI-11722343	0.35
P11166	Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1, erythrocyte/brain) (GLUT-1) (HepG2 glucose transporter)	EBI-11722343	0.35
P60468	Protein transport protein Sec61 subunit beta	EBI-11722343	0.35
O75396	Vesicle-trafficking protein SEC22b (ER-Golgi SNARE of 24 kDa) (ERS-24) (ERS24) (SEC22 vesicle-trafficking protein homolog B) (SEC22 vesicle-trafficking protein-like 1)	EBI-11722343	0.35
P31040	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (EC 1.3.5.1) (Flavoprotein subunit of complex II) (Fp)	EBI-11722343	0.35
Q14108	Lysosome membrane protein 2 (85 kDa lysosomal membrane sialoglycoprotein) (LGP85) (CD36 antigen-like 2) (Lysosome membrane protein II) (LIMP II) (Scavenger receptor class B member 2) (CD antigen CD36)	EBI-11722343	0.35
Q969E2	Secretory carrier-associated membrane protein 4 (Secretory carrier membrane protein 4)	EBI-11722343	0.35
Q9NTJ5	Phosphatidylinositol-3-phosphatase SAC1 (EC 3.1.3.64) (Phosphatidylinositol-4-phosphate phosphatase) (Suppressor of actin mutations 1-like protein)	EBI-11722343	0.35
Q9NQC3	Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5)	EBI-11722343	0.35
Q14699	Raftlin (Cell migration-inducing gene 2 protein) (Raft-linking protein)	EBI-11722343	0.35
Q9HBH5	Retinol dehydrogenase 14 (EC 1.1.1.300) (Alcohol dehydrogenase PAN2) (Short chain dehydrogenase/reductase family 7C member 4)	EBI-11722343	0.35
P51148	Ras-related protein Rab-5C (EC 3.6.5.2) (L1880) (RAB5L)	EBI-11722343	0.35
Q9BZG1	Ras-related protein Rab-34 (Ras-related protein Rab-39) (Ras-related protein Rah)	EBI-11722343	0.35
Q9NP72	Ras-related protein Rab-18	EBI-11722343	0.35
P53801	Pituitary tumor-transforming gene 1 protein-interacting protein (Pituitary tumor-transforming gene protein-binding factor) (PBF) (PTTG-binding factor)	EBI-11722343	0.35
Q13308	Inactive tyrosine-protein kinase 7 (Colon carcinoma kinase 4) (CCK-4) (Protein-tyrosine kinase 7) (Pseudo tyrosine kinase receptor 7) (Tyrosine-protein kinase-like 7)	EBI-11722343	0.35
Q9HCU5	Prolactin regulatory element-binding protein (Mammalian guanine nucleotide exchange factor mSec12)	EBI-11722343	0.35
O60831	PRA1 family protein 2	EBI-11722343	0.35
O75688	Protein phosphatase 1B (EC 3.1.3.16) (Protein phosphatase 2C isoform beta) (PP2C-beta)	EBI-11722343	0.35
O00264	Membrane-associated progesterone receptor component 1 (mPR) (Dap1) (IZA)	EBI-11722343	0.35
P09619	Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2.7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) (CD140 antigen-like family member B) (Platelet-derived growth factor receptor 1) (PDGFR-1) (CD antigen CD140b)	EBI-11722343	0.35
Q96AQ6	Pre-B-cell leukemia transcription factor-interacting protein 1 (Hematopoietic PBX-interacting protein)	EBI-11722343	0.35
Q9Y639	Neuroplastin (Stromal cell-derived receptor 1) (SDR-1)	EBI-11722343	0.35
O00483	Cytochrome c oxidase subunit NDUFA4 (Complex I-MLRQ) (CI-MLRQ) (NADH-ubiquinone oxidoreductase MLRQ subunit)	EBI-11722343	0.35
Q6PIU2	Neutral cholesterol ester hydrolase 1 (NCEH) (EC 3.1.1.-) (Acetylalkylglycerol acetylhydrolase) (2-acetyl MAGE hydrolase) (EC 3.1.1.71) (Arylacetamide deacetylase-like 1)	EBI-11722343	0.35
Q9BRK3	Matrix remodeling-associated protein 8 (Limitrin)	EBI-11722343	0.35
Q13724	Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106) (Processing A-glucosidase I)	EBI-11722343	0.35
Q14165	Malectin	EBI-11722343	0.35
Q96N66	Lysophospholipid acyltransferase 7 (LPLAT 7) (EC 2.3.1.-) (1-acylglycerophosphatidylinositol O-acyltransferase) (Bladder and breast carcinoma-overexpressed gene 1 protein) (Leukocyte receptor cluster member 4) (Lysophosphatidylinositol acyltransferase) (LPIAT) (Lyso-PI acyltransferase) (Membrane-bound O-acyltransferase domain-containing protein 7) (O-acyltransferase domain-containing protein 7) (h-mboa-7)	EBI-11722343	0.35
P29966	Myristoylated alanine-rich C-kinase substrate (MARCKS) (Protein kinase C substrate, 80 kDa protein, light chain) (80K-L protein) (PKCSL)	EBI-11722343	0.35
Q6IAA8	Ragulator complex protein LAMTOR1 (Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1) (Lipid raft adaptor protein p18) (Protein associated with DRMs and endosomes) (p27Kip1-releasing factor from RhoA) (p27RF-Rho)	EBI-11722343	0.35
P05556	Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29)	EBI-11722343	0.35
P26006	Integrin alpha-3 (CD49 antigen-like family member C) (FRP-2) (Galactoprotein B3) (GAPB3) (VLA-3 subunit alpha) (CD antigen CD49c) [Cleaved into: Integrin alpha-3 heavy chain; Integrin alpha-3 light chain]	EBI-11722343	0.35
Q16891	MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89)	EBI-11722343	0.35
Q70UQ0	Inhibitor of nuclear factor kappa-B kinase-interacting protein (I kappa-B kinase-interacting protein) (IKBKB-interacting protein) (IKK-interacting protein)	EBI-11722343	0.35
P11717	Cation-independent mannose-6-phosphate receptor (CI Man-6-P receptor) (CI-MPR) (M6PR) (300 kDa mannose 6-phosphate receptor) (MPR 300) (Insulin-like growth factor 2 receptor) (Insulin-like growth factor II receptor) (IGF-II receptor) (M6P/IGF2 receptor) (M6P/IGF2R) (CD antigen CD222)	EBI-11722343	0.35
Q8TED1	Probable glutathione peroxidase 8 (GPx-8) (GSHPx-8) (EC 1.11.1.9)	EBI-11722343	0.35
P59768	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 (G gamma-I)	EBI-11722343	0.35
P62873	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 (Transducin beta chain 1)	EBI-11722343	0.35
Q9H4G4	Golgi-associated plant pathogenesis-related protein 1 (GAPR-1) (Golgi-associated PR-1 protein) (Glioma pathogenesis-related protein 2) (GliPR 2)	EBI-11722343	0.35
P48060	Glioma pathogenesis-related protein 1 (GliPR 1) (Protein RTVP-1)	EBI-11722343	0.35
P17302	Gap junction alpha-1 protein (Connexin-43) (Cx43) (Gap junction 43 kDa heart protein)	EBI-11722343	0.35
P25445	Tumor necrosis factor receptor superfamily member 6 (Apo-1 antigen) (Apoptosis-mediating surface antigen FAS) (FASLG receptor) (CD antigen CD95)	EBI-11722343	0.35
A0FGR8	Extended synaptotagmin-2 (E-Syt2) (Chr2Syt)	EBI-11722343	0.35
Q969X5	Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ER-Golgi intermediate compartment 32 kDa protein) (ERGIC-32)	EBI-11722343	0.35
P17813	Endoglin (CD antigen CD105)	EBI-11722343	0.35
A4FU69	EF-hand calcium-binding domain-containing protein 5	EBI-11722343	0.35
O00273	DNA fragmentation factor subunit alpha (DNA fragmentation factor 45 kDa subunit) (DFF-45) (Inhibitor of CAD) (ICAD)	EBI-11722343	0.35
P39656	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit (DDOST 48 kDa subunit) (Oligosaccharyl transferase 48 kDa subunit)	EBI-11722343	0.35
Q16527	Cysteine and glycine-rich protein 2 (Cysteine-rich protein 2) (CRP2) (LIM domain only protein 5) (LMO-5) (Smooth muscle cell LIM protein) (SmLIM)	EBI-11722343	0.35
Q1MSJ5	Centrosome and spindle pole-associated protein 1	EBI-11722343	0.35
Q6UVK1	Chondroitin sulfate proteoglycan 4 (Chondroitin sulfate proteoglycan NG2) (Melanoma chondroitin sulfate proteoglycan) (Melanoma-associated chondroitin sulfate proteoglycan)	EBI-11722343	0.35
P09543	2',3'-cyclic-nucleotide 3'-phosphodiesterase (CNP) (CNPase) (EC 3.1.4.37)	EBI-11722343	0.35
Q9H5V8	CUB domain-containing protein 1 (Membrane glycoprotein gp140) (Subtractive immunization M plus HEp3-associated 135 kDa protein) (SIMA135) (Transmembrane and associated with src kinases) (CD antigen CD318)	EBI-11722343	0.35
P16070	CD44 antigen (CDw44) (Epican) (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Heparan sulfate proteoglycan) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44)	EBI-11722343	0.35
Q9BWT7	Caspase recruitment domain-containing protein 10 (CARD-containing MAGUK protein 3) (Carma 3)	EBI-11722343	0.35
P35613	Basigin (5F7) (Collagenase stimulatory factor) (Extracellular matrix metalloproteinase inducer) (EMMPRIN) (Hepatoma-associated antigen) (HAb18G) (Leukocyte activation antigen M6) (OK blood group antigen) (Tumor cell-derived collagenase stimulatory factor) (TCSF) (CD antigen CD147)	EBI-11722343	0.35
Q07812	Apoptosis regulator BAX (Bcl-2-like protein 4) (Bcl2-L-4)	EBI-11722343	0.35
Q16611	Bcl-2 homologous antagonist/killer (Apoptosis regulator BAK) (Bcl-2-like protein 7) (Bcl2-L-7)	EBI-11722343	0.35
P16615	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) (SR Ca(2+)-ATPase 2) (EC 7.2.2.10) (Calcium pump 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase)	EBI-11722343	0.35
P05023	Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1)	EBI-11722343	0.35
Q8IZ07	Ankyrin repeat domain-containing protein 13A (Protein KE03)	EBI-11722343	0.35
Q8N2K0	Lysophosphatidylserine lipase ABHD12 (EC 3.1.-.-) (2-arachidonoylglycerol hydrolase ABHD12) (Abhydrolase domain-containing protein 12) (hABHD12) (Monoacylglycerol lipase ABHD12) (EC 3.1.1.23) (Oxidized phosphatidylserine lipase ABHD12) (EC 3.1.-.-)	EBI-11722343	0.35
P80404	4-aminobutyrate aminotransferase, mitochondrial (EC 2.6.1.19) ((S)-3-amino-2-methylpropionate transaminase) (EC 2.6.1.22) (GABA aminotransferase) (GABA-AT) (Gamma-amino-N-butyrate transaminase) (GABA transaminase) (GABA-T) (L-AIBAT)	EBI-11722343	0.35
Q13323	Bcl-2-interacting killer (Apoptosis inducer NBK) (BIP1) (BP4)	EBI-11735775	0.37

Cross-References

Database	Links
UNIPROT	P03246
Pfam	PF01691
PROSITE	PS50062

E1B protein, small T-antigen (Human adenovirus 5)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (10 interactors)

Interactions with other proteins (85 interactors)

Cross-References

Database

Links

Description

Description