Protein Information |
|
---|---|
Protein Name | Exportin-1 |
Accession Code | P30822 |
Gene | CRM1 |
Organism | Saccharomyces cerevisiae S288C (Taxonomy: 559292) |
Part of Reference Proteome? | Yes |
Sequence (Length: 1084) | |
MEGILDFSNDLDIALLDQVVSTFYQGSGVQQKQAQEILTKFQDNPDAWQKADQILQFSTNPQSKFIALSILDKLITRKWK LLPNDHRIGIRNFVVGMIISMCQDDEVFKTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSSSVNVCENNMIVLK LLSEEVFDFSAEQMTQAKALHLKNSMSKEFEQIFKLCFQVLEQGSSSSLIVATLESLLRYLHWIPYRYIYETNILELLST KFMTSPDTRAITLKCLTEVSNLKIPQDNDLIKRQTVLFFQNTLQQIATSVMPVTADLKATYANANGNDQSFLQDLAMFLT TYLARNRALLESDESLRELLLNAHQYLIQLSKIEERELFKTTLDYWHNLVADLFYEVQRLPATEMSPLIQLSVGSQAIST GSGALNPEYMKRFPLKKHIYEEICSQLRLVIIENMVRPEEVLVVENDEGEIVREFVKESDTIQLYKSEREVLVYLTHLNV IDTEEIMISKLARQIDGSEWSWHNINTLSWAIGSISGTMSEDTEKRFVVTVIKDLLDLTVKKRGKDNKAVVASDIMYVVG QYPRFLKAHWNFLRTVILKLFEFMHETHEGVQDMACDTFIKIVQKCKYHFVIQQPRESEPFIQTIIRDIQKTTADLQPQQ VHTFYKACGIIISEERSVAERNRLLSDLMQLPNMAWDTIVEQSTANPTLLLDSETVKIIANIIKTNVAVCTSMGADFYPQ LGHIYYNMLQLYRAVSSMISAQVAAEGLIATKTPKVRGLRTIKKEILKLVETYISKARNLDDVVKVLVEPLLNAVLEDYM NNVPDARDAEVLNCMTTVVEKVGHMIPQGVILILQSVFECTLDMINKDFTEYPEHRVEFYKLLKVINEKSFAAFLELPPA AFKLFVDAICWAFKHNNRDVEVNGLQIALDLVKNIERMGNVPFANEFHKNYFFIFVSETFFVLTDSDHKSGFSKQALLLM KLISLVYDNKISVPLYQEAEVPQGTSNQVYLSQYLANMLSNAFPHLTSEQIASFLSALTKQYKDLVVFKGTLRDFLVQIK EVGGDPTDYLFAEDKENALMEQNRLEREKAAKIGGLLKPSELDD |
Structure Viewer (PDB: 6X2U) |
---|
Description |
||
---|---|---|
Nucleus {Experimental EvidencePubMed:14562095}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:14562095}. Note=Localized in the nucleus and at its periphery. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
Topology | Source | Annotation Type |
Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
Cellular Component | Cytoplasm (GO:0005737) Kinetochore (GO:0000776) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Spindle Pole Body (GO:0005816) |
Description |
|
---|---|
Receptor for the leucine-rich nuclear export signal (NES). | Assigned Ontology terms |
Biological Process | MRNA Export From Nucleus (GO:0006406) Nuclear Export (GO:0051168) Protein Export From Nucleus (GO:0006611) Protein Localization To Kinetochore (GO:0034501) Ribosomal Large Subunit Export From Nucleus (GO:0000055) Ribosomal Small Subunit Export From Nucleus (GO:0000056) |
Molecular Function | Nuclear Export Signal Receptor Activity (GO:0005049) Nuclear Import Signal Receptor Activity (GO:0061608) Small GTPase Binding (GO:0031267) U1 SnRNA Binding (GO:0030619) U2 SnRNA Binding (GO:0030620) U4 SnRNA Binding (GO:0030621) U5 SnRNA Binding (GO:0030623) U6 SnRNA Binding (GO:0017070) |
Interactions with Nuclear Envelope proteins (15 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
P22147 | 5'-3' exoribonuclease 1 | EBI-11611503 | 0.35 |
Q04839 | mRNA transport factor GFD1 | EBI-11611503 | 0.35 |
P12683 | 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 | EBI-786893 | 0.35 |
P12684 | 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 | EBI-787291 | 0.35 |
P20484 | Protein MAK11 | EBI-11611503 | 0.35 |
P25491 | Mitochondrial protein import protein MAS5 | EBI-3663255 | 0.35 |
P40457 | Protein MLP2 | EBI-11611503 | 0.35 |
Q02630 | Nucleoporin NUP116/NSP116 | EBI-2346716 | 0.37 |
P52593 | Nucleoporin NUP188 | EBI-809801 | 0.35 |
P32336 | Protein NUD1 | EBI-11611503 | 0.35 |
P32567 | Phosphatidic acid phosphohydrolase 1 | EBI-11611503 | 0.35 |
Q03760 | Pre-mRNA leakage protein 39 | EBI-11611503 | 0.35 |
P14906 | Protein translocation protein SEC63 | EBI-3665470 | 0.35 |
P06782 | Carbon catabolite-derepressing protein kinase | EBI-11611503 | 0.35 |
P39015 | Suppressor protein STM1 | EBI-11611503 | 0.35 | Interactions with other proteins (745 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
P36013 | NAD-dependent malic enzyme, mitochondrial (NAD-ME) (EC 1.1.1.38) | EBI-785404 | 0.35 |
P38085 | Valine/tyrosine/tryptophan amino-acid permease 1 (Tyrosine and tryptophan amino acid transporter 1) | EBI-785720 | 0.35 |
P21147 | Acyl-CoA desaturase 1 (EC 1.14.19.1) (Delta 9 fatty acid desaturase) (Fatty acid desaturase 1) (Stearoyl-CoA desaturase 1) | EBI-786767 | 0.35 |
P23641 | Mitochondrial phosphate carrier protein (Mitochondrial import receptor) (Phosphate transport protein) (PTP) (mPic 1) (p32) [Cleaved into: Mitochondrial phosphate carrier protein, N-terminally processed] | EBI-787315 | 0.35 |
P28496 | Ceramide synthase LAC1 (Very-long-chain ceramide synthase LAC1) (EC 2.3.1.297) | EBI-793629 | 0.35 |
Q07804 | Sterol esterase 1 (EC 3.1.1.13) (Steryl ester hydrolase 1) | EBI-797939 | 0.35 |
P33417 | Intrastrand cross-link recognition protein (Structure-specific recognition protein) (SSRP) | EBI-798248 | 0.35 |
P38707 | Asparagine--tRNA ligase, cytoplasmic (EC 6.1.1.22) (Asparaginyl-tRNA synthetase) (AsnRS) | EBI-798527 | 0.35 |
P38703 | Ceramide synthase LAG1 (Longevity assurance factor 1) (Longevity assurance gene 1 protein) (Longevity assurance protein 1) (Very-long-chain ceramide synthase LAG1) (EC 2.3.1.297) | EBI-799064 | 0.35 |
P0CI39 | Pheromone alpha factor receptor | EBI-803823 | 0.35 |
P32454 | Aminopeptidase 2, mitochondrial (AP-II) (Aminopeptidase II) (EC 3.4.11.-) (YscII) | EBI-805324 | 0.35 |
P40970 | Serine palmitoyltransferase 2 (SPT 2) (EC 2.3.1.50) (Long chain base biosynthesis protein 2) | EBI-805812 | 0.35 |
P13663 | Aspartate-semialdehyde dehydrogenase (ASA dehydrogenase) (ASADH) (EC 1.2.1.11) (Aspartate-beta-semialdehyde dehydrogenase) | EBI-808333 | 0.35 |
Q03529 | Ceramide very long chain fatty acid hydroxylase SCS7 (Ceramide VLCFA hydroxylase SCS7) (4-hydroxysphinganine ceramide fatty acyl 2-hydroxylase SCS7) (EC 1.14.18.6) (Dihydroceramide fatty acyl 2-hydroxylase SCS7) (EC 1.14.18.7) (Sphingolipid alpha-hydroxylase) (Suppressor of calcium sensitivity 7) | EBI-810338 | 0.35 |
P11745 | Ran GTPase-activating protein 1 (Protein involved in RNA production/processing) | EBI-810584 | 0.53 |
P02994 | Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A) | EBI-810584 | 0.35 |
P11484 | Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb) | EBI-810584 | 0.64 |
P10592 | Heat shock protein SSA2 | EBI-810584 | 0.53 |
P10659 | S-adenosylmethionine synthase 1 (AdoMet synthase 1) (EC 2.5.1.6) (Methionine adenosyltransferase 1) (MAT 1) | EBI-810584 | 0.35 |
Q01939 | 26S proteasome regulatory subunit 8 homolog (Protein CIM3) (Protein SUG1) (Tat-binding protein TBY1) | EBI-810584 | 0.35 |
P33299 | 26S proteasome regulatory subunit 7 homolog (Protein CIM5) (Tat-binding homolog 3) | EBI-810584 | 0.35 |
P41940 | Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1-phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP-hexose pyrophosphorylase) | EBI-810584 | 0.35 |
P40495 | Homoisocitrate dehydrogenase, mitochondrial (HIcDH) (EC 1.1.1.87) | EBI-810584 | 0.35 |
P15108 | ATP-dependent molecular chaperone HSC82 (82 kDa heat shock cognate protein) (Heat shock protein Hsp90 constitutive isoform) | EBI-810584 | 0.35 |
P33892 | eIF-2-alpha kinase activator GCN1 (General control non-derepressible protein 1) (Translational activator GCN1) | EBI-810584 | 0.44 |
P00549 | Pyruvate kinase 1 (PK 1) (EC 2.7.1.40) (cell division cycle protein 19) | EBI-810584 | 0.35 |
P16140 | V-type proton ATPase subunit B (V-ATPase subunit B) (V-ATPase 57 kDa subunit) (Vacuolar proton pump subunit B) | EBI-810584 | 0.35 |
P07259 | Protein URA2 [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] | EBI-810584 | 0.35 |
P02557 | Tubulin beta chain (Beta-tubulin) | EBI-810584 | 0.35 |
P09733 | Tubulin alpha-1 chain (EC 3.6.5.-) | EBI-810584 | 0.35 |
P10081 | ATP-dependent RNA helicase eIF4A (EC 3.6.4.13) (Eukaryotic initiation factor 4A) (eIF-4A) (Stimulator factor I 37 kDa component) (Translation initiation factor 1/2) (p37) | EBI-810584 | 0.35 |
P38737 | Proteasome component ECM29 (Extracellular mutant protein 29) | EBI-814203 | 0.27 |
Q00955 | Acetyl-CoA carboxylase (ACC) (EC 6.4.1.2) (Fatty acid synthetase 3) (mRNA transport-defective protein 7) [Includes: Biotin carboxylase (EC 6.3.4.14)] | EBI-814773 | 0.27 |
P18239 | ADP,ATP carrier protein 2 (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) (Petite colonies protein 9) | EBI-816585 | 0.27 |
P39722 | Mitochondrial Rho GTPase 1 (EC 3.6.5.-) (GTPase EF-hand protein of mitochondria 1) | EBI-818561 | 0.27 |
P60010 | Actin (EC 3.6.4.-) | EBI-820657 | 0.27 |
P0CG63 | Polyubiquitin [Cleaved into: Ubiquitin] | EBI-7480760 | 0.44 |
P53323 | EKC/KEOPS complex subunit BUD32 (EC 3.6.-.-) (Atypical serine/threonine protein kinase BUD32) (EC 2.7.11.1) (Bud site selection protein 32) (Low-dye-binding protein 14) (piD261) | EBI-1200876 | 0.55 |
P43603 | LAS seventeen-binding protein 3 (LAS17-binding protein 3) | EBI-7423488 | 0.55 |
P32793 | Protein YSC84 (LAS seventeen-binding protein 4) (LAS17-binding protein 4) | EBI-7439447 | 0.55 |
P61925 | cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor, muscle/brain isoform) | EBI-7979681 | 0.52 |
P32835 | GTP-binding nuclear protein GSP1/CNR1 (Chromosome stability protein 17) (GTPase Ran homolog) (Genetic suppressor of PRP20-1) | EBI-7979786 | 0.52 |
P10591 | Heat shock protein SSA1 (Heat shock protein YG100) | EBI-3668753 | 0.35 |
P40150 | Ribosome-associated molecular chaperone SSB2 (EC 3.6.4.10) (Heat shock protein SSB2) (Hsp70 chaperone Ssb) | EBI-3720598 | 0.53 |
P39079 | T-complex protein 1 subunit zeta (TCP-1-zeta) (CCT-zeta) | EBI-3739915 | 0.35 |
P39076 | T-complex protein 1 subunit beta (TCP-1-beta) (CCT-beta) | EBI-3741043 | 0.35 |
P33416 | Heat shock protein 78, mitochondrial | EBI-3744083 | 0.35 |
Q12329 | Heat shock protein 42 (42 kDa heat shock protein) | EBI-3750567 | 0.35 |
P02829 | ATP-dependent molecular chaperone HSP82 (82 kDa heat shock protein) (Heat shock protein Hsp90 heat-inducible isoform) | EBI-3811023 | 0.35 |
P39523 | Uncharacterized protein YMR124W | EBI-9976090 | 0.53 |
P0CX83 | 60S ribosomal protein L19-B (L23) (Large ribosomal subunit protein eL19) (RP15L) (RP33) (YL14) | EBI-11611503 | 0.35 |
P0CX36 | 40S ribosomal protein S4-B (RP5) (S7) (Small ribosomal subunit protein eS4-B) (YS6) | EBI-11611503 | 0.35 |
P0CX54 | 60S ribosomal protein L12-B (L15) (Large ribosomal subunit protein uL11-B) (YL23) | EBI-11611503 | 0.35 |
P0CX38 | 40S ribosomal protein S6-B (RP9) (S10) (Small ribosomal subunit protein eS6-B) (YS4) | EBI-11611503 | 0.35 |
P0CX48 | 40S ribosomal protein S11-B (RP41) (S18) (Small ribosomal subunit protein uS17-B) (YS12) | EBI-11611503 | 0.35 |
P0CX46 | 60S ribosomal protein L2-B (L5) (Large ribosomal subunit protein uL2-B) (RP8) (YL6) | EBI-11611503 | 0.35 |
Q05937 | Zinc finger protein STP3 | EBI-11611503 | 0.35 |
P0CX56 | 40S ribosomal protein S18-B (Small ribosomal subunit protein uS13-B) | EBI-11611503 | 0.35 |
P0CX32 | 40S ribosomal protein S24-B (RP50) (Small ribosomal subunit protein eS24-B) | EBI-11611503 | 0.35 |
P0CX40 | 40S ribosomal protein S8-B (RP19) (S14) (Small ribosomal subunit protein eS8-B) (YS9) | EBI-11611503 | 0.35 |
Q06543 | GPN-loop GTPase 3 (EC 3.6.5.-) | EBI-11611503 | 0.35 |
P40059 | Transcriptional regulatory protein DOT6 (Disrupter of telomere silencing protein 6) (PAC-binding factor 2) | EBI-11611503 | 0.35 |
Q12049 | Protein THP3 (THO-related protein 3) | EBI-11611503 | 0.35 |
Q12129 | Nonsense-mediated decay protein 4 | EBI-11611503 | 0.35 |
Q06188 | PWWP domain-containing protein YLR455W | EBI-11611503 | 0.35 |
P38985 | Signal recognition particle subunit SRP14 (Signal recognition particle 14 kDa protein homolog) | EBI-11611503 | 0.35 |
Q12291 | 25S rRNA (uridine(2843)-N(3))-methyltransferase (EC 2.1.1.312) (Base methyltransferase of 25S RNA 6) | EBI-11611503 | 0.35 |
P27351 | AP-2 complex subunit beta (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Clathrin assembly protein large beta chain) | EBI-11611503 | 0.35 |
P38042 | Anaphase-promoting complex subunit CDC27 (Anaphase-promoting complex subunit 3) (Cell division control protein 27) | EBI-11611503 | 0.35 |
P04449 | 60S ribosomal protein L24-A (L30) (Large ribosomal subunit protein eL24-A) (RP29) (YL21) | EBI-11611503 | 0.35 |
P38629 | Replication factor C subunit 3 (Replication factor C3) (Activator 1 40 kDa subunit) | EBI-11611503 | 0.35 |
P30619 | Protein transport protein SEC1 | EBI-11611503 | 0.35 |
P23201 | Protein SPA2 | EBI-11611503 | 0.35 |
Q12224 | Transcription factor RLM1 | EBI-11611503 | 0.35 |
P26785 | 60S ribosomal protein L16-B (L21) (Large ribosomal subunit protein uL13-B) (RP23) (YL15) | EBI-11611503 | 0.35 |
Q12196 | Serine/threonine-protein kinase RIO1 (EC 2.7.11.1) (EC 3.6.3.-) (Ribosomal RNA-processing protein 10) | EBI-11611503 | 0.35 |
P47064 | AP-3 complex subunit sigma (AP-3 complex sigma3A subunit) (Adaptor-related protein complex 3 subunit sigma) (Clathrin-associated/assembly/adaptor protein, small 3) (Sigma-adaptin 3A) (Sigma3-adaptin) | EBI-11611503 | 0.35 |
P12754 | Translation initiation factor eIF-2B subunit delta (GCD complex subunit GCD2) (Guanine nucleotide exchange factor subunit GCD2) (eIF-2B GDP-GTP exchange factor subunit delta) | EBI-11611503 | 0.35 |
P40079 | U3 small nucleolar ribonucleoprotein protein LCP5 | EBI-11611503 | 0.35 |
P50278 | 6-phosphogluconolactonase-like protein 1 | EBI-11611503 | 0.35 |
P32525 | Protein ECM25 (Extracellular matrix protein 25) | EBI-11611503 | 0.35 |
Q02908 | Elongator complex protein 3 (EC 2.3.1.-) (Gamma-toxin target 3) (tRNA uridine(34) acetyltransferase) | EBI-11611503 | 0.35 |
Q06604 | Protein BSP1 (Binding of synaptojanin polyphosphoinositide phosphatase domain protein 1) | EBI-11611503 | 0.35 |
Q07418 | Peroxisomal membrane protein import receptor PEX19 (Peroxin-19) | EBI-11611503 | 0.35 |
P27636 | Cell division control protein 15 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P20448 | ATP-dependent RNA helicase HCA4 (EC 3.6.4.13) (DEAD box protein 4) (Helicase CA4) (Helicase UF1) | EBI-11611503 | 0.35 |
P40157 | Vacuolar import and degradation protein 27 | EBI-11611503 | 0.35 |
Q12090 | RNA exonuclease 3 (EC 3.1.-.-) | EBI-11611503 | 0.35 |
P23292 | Casein kinase I homolog 2 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P47130 | Cop9 signalosome complex subunit 12 | EBI-11611503 | 0.35 |
Q99369 | Family of serine hydrolases 3 (EC 3.1.-.-) | EBI-11611503 | 0.35 |
P40021 | Zinc-regulated protein 8 | EBI-11611503 | 0.35 |
P38089 | Protein phosphatase 2C homolog 4 (PP2C-4) (EC 3.1.3.16) | EBI-11611503 | 0.35 |
P40013 | Protein BIM1 | EBI-11611503 | 0.35 |
P21304 | Periodic tryptophan protein 1 | EBI-11611503 | 0.35 |
P25042 | Repressor ROX1 (Heme-dependent repression factor) (Hypoxic function repressor) | EBI-11611503 | 0.35 |
P20434 | DNA-directed RNA polymerases I, II, and III subunit RPABC1 (RNA polymerases I, II, and III subunit ABC1) (ABC27) (DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide) | EBI-11611503 | 0.35 |
P39743 | Reduced viability upon starvation protein 167 | EBI-11611503 | 0.35 |
Q03466 | Nonsense-mediated mRNA decay factor EBS1 (EST1-like BCY1 suppressor 1) | EBI-11611503 | 0.35 |
Q04377 | DNA damage checkpoint protein LCD1 (DNA damage checkpoint protein 2) (Lethal, checkpoint-defective, DNA damage-sensitive protein 1) | EBI-11611503 | 0.35 |
Q05123 | Actin-like protein ARP9 (Chromatin structure-remodeling complex protein ARP9) (SWI/SNF complex component ARP9) | EBI-11611503 | 0.35 |
Q04372 | Type 2A phosphatase-associated protein 42 | EBI-11611503 | 0.35 |
P50094 | Inosine-5'-monophosphate dehydrogenase 4 (IMP dehydrogenase 4) (IMPD 4) (IMPDH 4) (EC 1.1.1.205) | EBI-11611503 | 0.35 |
P53901 | Ingression protein 1 | EBI-11611503 | 0.35 |
P25559 | Sister chromatid cohesion protein DCC1 (Defective in sister chromatid cohesion protein 1) | EBI-11611503 | 0.35 |
P36049 | rRNA-processing protein EBP2 (EBNA1-binding protein homolog) | EBI-11611503 | 0.35 |
Q07350 | Pre-mRNA-splicing factor PRP11 | EBI-11611503 | 0.35 |
P40335 | Carboxypeptidase Y-deficient protein 8 (Vacuolar protein sorting-associated protein 26) (Vacuolar protein-targeting protein 4) | EBI-11611503 | 0.35 |
Q12034 | Protein SLF1 | EBI-11611503 | 0.35 |
P15442 | eIF-2-alpha kinase GCN2 (EC 2.7.11.1) (General control non-derepressible protein 2) (Serine/threonine-protein kinase GCN2) | EBI-11611503 | 0.35 |
Q3E705 | rRNA-processing protein EFG1 (Exit from G1 protein 1) | EBI-11611503 | 0.35 |
P34164 | SNF1 protein kinase subunit beta-2 (Protein SPM2) (SNF1-interacting protein 2) | EBI-11611503 | 0.35 |
P29478 | Signal recognition particle subunit SEC65 | EBI-11611503 | 0.35 |
Q99216 | Pre-rRNA-processing protein PNO1 (Partner of NOB1) (Ribosomal RNA-processing protein 20) | EBI-11611503 | 0.35 |
P34072 | Negative regulator of RAS-cAMP pathway | EBI-11611503 | 0.35 |
Q02805 | Protein ROD1 (Resistance to o-dinitrobenzene protein 1) | EBI-11611503 | 0.35 |
P23248 | 40S ribosomal protein S1-B (RP10B) (Small ribosomal subunit protein eS1-B) | EBI-11611503 | 0.35 |
Q08444 | 20S-pre-rRNA D-site endonuclease NOB1 (EC 3.1.-.-) (NIN1-binding protein) (Pre-rRNA-processing endonuclease NOB1) | EBI-11611503 | 0.35 |
P54000 | RNA polymerase II transcriptional coactivator SUB1 | EBI-11611503 | 0.35 |
Q02884 | Elongator complex protein 4 (Gamma-toxin target 7) (HAT-associated protein 1) | EBI-11611503 | 0.35 |
P10962 | Protein MAK16 (Maintenance of killer protein 16) | EBI-11611503 | 0.35 |
P49955 | U2 snRNP component HSH155 | EBI-11611503 | 0.35 |
Q08484 | GTPase-activating protein GYP1 (GAP for YPT1) | EBI-11611503 | 0.35 |
P47135 | Protein JSN1 (Pumilio homology domain family member 1) | EBI-11611503 | 0.35 |
P53050 | Protein MGA1 | EBI-11611503 | 0.35 |
Q99186 | AP-2 complex subunit mu (Adaptin medium chain APM4) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein) | EBI-11611503 | 0.35 |
P34110 | Vacuolar protein sorting-associated protein 35 (Vacuolar protein-targeting protein 7) | EBI-11611503 | 0.35 |
Q08235 | Ribosome biogenesis protein BRX1 | EBI-11611503 | 0.35 |
P40187 | GSY2-interacting protein PIG2 | EBI-11611503 | 0.35 |
P07270 | Phosphate system positive regulatory protein PHO4 | EBI-11611503 | 0.35 |
P32566 | Cell wall assembly regulator SMI1 (Killer toxin-resistance protein 4) | EBI-11611503 | 0.35 |
P46946 | DNA endonuclease SAE2 (EC 3.1.-.-) (Completion of meiotic recombination protein 1) (Sporulation in the absence of SPO11 protein 2) | EBI-11611503 | 0.35 |
Q12481 | rRNA biogenesis protein RRP36 (Ribosomal RNA-processing protein 36) | EBI-11611503 | 0.35 |
Q04007 | SRP-independent targeting protein 1 | EBI-11611503 | 0.35 |
P48562 | Serine/threonine-protein kinase CLA4 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P25293 | Nucleosome assembly protein | EBI-11611503 | 0.35 |
P32790 | Actin cytoskeleton-regulatory complex protein SLA1 | EBI-11611503 | 0.35 |
P50896 | Protein PSP1 (Growth inhibitory protein 5) (Polymerase suppressor protein 1) | EBI-11611503 | 0.35 |
P80235 | Putative mitochondrial carnitine O-acetyltransferase (EC 2.3.1.7) | EBI-11611503 | 0.35 |
Q04304 | UPF0659 protein YMR090W | EBI-11611503 | 0.35 |
P43563 | CBK1 kinase activator protein MOB2 (MPS1 binder 2) (Maintenance of ploidy protein MOB2) | EBI-11611503 | 0.35 |
P34243 | DNA polymerase alpha-associated DNA helicase A (EC 3.6.4.12) | EBI-11611503 | 0.35 |
Q02354 | U3 small nucleolar RNA-associated protein 6 (U3 snoRNA-associated protein 6) (U three protein 6) | EBI-11611503 | 0.35 |
P53829 | Protein CAF40 (40 kDa CCR4-associated factor) | EBI-11611503 | 0.35 |
P53741 | UBP3-associated protein BRE5 (Brefeldin-A sensitivity protein 5) | EBI-11611503 | 0.35 |
P39715 | Shuttling pre-60S factor ECM1 (Extracellular mutant protein 1) (Protein SIM1) | EBI-11611503 | 0.35 |
Q02875 | SMY2 homolog 2 | EBI-11611503 | 0.35 |
Q03330 | Histone acetyltransferase GCN5 (EC 2.3.1.48) (Histone crotonyltransferase GCN5) (EC 2.3.1.-) | EBI-11611503 | 0.35 |
P17536 | Tropomyosin-1 | EBI-11611503 | 0.35 |
P38080 | Serine/threonine-protein kinase AKL1 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
Q12213 | 60S ribosomal protein L7-B (L6) (Large ribosomal subunit protein uL30-B) (RP11) (YL8) | EBI-11611503 | 0.35 |
Q12186 | Branchpoint-bridging protein (Mud synthetic-lethal 5 protein) (Splicing factor 1) (Zinc finger protein BBP) | EBI-11611503 | 0.35 |
P53924 | E3 ubiquitin-protein ligase DMA2 (EC 2.3.2.27) (Checkpoint forkhead associated with RING domains-containing protein 1) (Defective in mitotic arrest protein 2) (RING-type E3 ubiquitin transferase DMA2) | EBI-11611503 | 0.35 |
P39960 | GTPase-activating protein BEM2/IPL2 (Bud emergence protein 2) | EBI-11611503 | 0.35 |
P47077 | Nucleolar protein 9 (Pumilio domain-containing protein NOP9) | EBI-11611503 | 0.35 |
Q07807 | mRNA-binding protein PUF3 (Pumilio homology domain family member 3) | EBI-11611503 | 0.35 |
P19524 | Myosin-2 (Cell division control protein 66) (Class V unconventional myosin MYO2) (Type V myosin heavy chain MYO2) (Myosin V MYO2) | EBI-11611503 | 0.35 |
P53894 | Serine/threonine-protein kinase CBK1 (EC 2.7.11.1) (Cell wall biosynthesis kinase) | EBI-11611503 | 0.35 |
P06844 | Protein SPT3 (Positive regulator of Ty transcription) | EBI-11611503 | 0.35 |
P40084 | RNA polymerase II subunit B1 CTD phosphatase RTR1 (EC 3.1.3.16) (RNA polymerase II-associated protein 2 homolog RTR1) (Regulator of transcription 1) | EBI-11611503 | 0.35 |
P20053 | U4/U6 small nuclear ribonucleoprotein PRP4 (Pre-mRNA-processing protein 4) | EBI-11611503 | 0.35 |
Q03233 | Alpha1-proteinase inhibitor-degradation deficient protein 37 | EBI-11611503 | 0.35 |
P51401 | 60S ribosomal protein L9-B (L8) (Large ribosomal subunit protein uL6-B) (RP24) (YL11) | EBI-11611503 | 0.35 |
P32794 | ATPase family gene 2 protein (EC 3.6.4.10) (Diazaborine resistance gene 1 protein) | EBI-11611503 | 0.35 |
Q12259 | BTB/POZ domain-containing protein YLR108C | EBI-11611503 | 0.35 |
P22204 | Cell cycle protein kinase DBF2 (EC 2.7.11.1) (Dumbbell forming protein 2) | EBI-11611503 | 0.35 |
P53743 | Pre-rRNA-processing protein ESF2 (18S rRNA factor 2) | EBI-11611503 | 0.35 |
Q08951 | AP-3 complex subunit delta (Adaptor-related protein complex 3 subunit delta) (Delta-adaptin 3) (Delta-adaptin) | EBI-11611503 | 0.35 |
P09959 | Regulatory protein SWI6 (Cell-cycle box factor subunit SWI6) (MBF subunit P90) (Trans-acting activator of HO endonuclease gene) | EBI-11611503 | 0.35 |
Q12753 | Transcriptional activator HAA1 | EBI-11611503 | 0.35 |
P36124 | SET domain-containing protein 3 | EBI-11611503 | 0.35 |
P25644 | DNA topoisomerase 2-associated protein PAT1 (Decapping activator and translational repressor PAT1) (Topoisomerase II-associated protein PAT1) (mRNA turnover protein 1) | EBI-11611503 | 0.35 |
P40339 | Replication factor C subunit 4 (Replication factor C4) (Activator 1 37 kDa subunit) | EBI-11611503 | 0.35 |
P36115 | Increased rDNA silencing protein 4 | EBI-11611503 | 0.35 |
Q08438 | Phosphopantothenoylcysteine decarboxylase subunit VHS3 (Viable in a HAL3 SIT4 background protein 3) | EBI-11611503 | 0.35 |
P38688 | Signal recognition particle subunit SRP72 (Signal recognition particle 72 kDa protein homolog) | EBI-11611503 | 0.35 |
Q07362 | Protein PBP4 (PBP1-binding protein 4) | EBI-11611503 | 0.35 |
P50079 | SVP1-like protein 2 | EBI-11611503 | 0.35 |
P36119 | RQC trigger complex subunit RQT4 | EBI-11611503 | 0.35 |
P46654 | 40S ribosomal protein S0-B (Nucleic acid-binding protein NAB1B) (Small ribosomal subunit protein uS2-B) | EBI-11611503 | 0.35 |
P09547 | SWI/SNF chromatin-remodeling complex subunit SWI1 (Regulatory protein GAM3) (SWI/SNF complex subunit SWI1) (Transcription regulatory protein ADR6) (Transcription regulatory protein SWI1) | EBI-11611503 | 0.35 |
P40449 | Uncharacterized protein YIL161W | EBI-11611503 | 0.35 |
P38263 | Vacuolar import and degradation protein 24 (Glucose-induced degradation protein 4) | EBI-11611503 | 0.35 |
P17076 | 60S ribosomal protein L8-A (L4) (L4-2) (L7a-1) (Large ribosomal subunit protein eL8-A) (Maintenance of killer protein 7) (RP6) (YL5) | EBI-11611503 | 0.35 |
P32364 | Kinesin-related protein SMY1 (Suppressor protein SMY1) | EBI-11611503 | 0.35 |
P40078 | Ribosome biogenesis protein NSA2 (NOP7-associated protein 2) | EBI-11611503 | 0.35 |
P14127 | 40S ribosomal protein S17-B (RP51B) (Small ribosomal subunit protein eS17-B) | EBI-11611503 | 0.35 |
P38284 | Increased copper sensitivity protein 2 | EBI-11611503 | 0.35 |
Q99207 | Nucleolar complex protein 14 (U three protein 2) (U3 small nucleolar RNA-associated protein 2) (U3 snoRNA-associated protein 2) | EBI-11611503 | 0.35 |
P53863 | J protein JJJ1 | EBI-11611503 | 0.35 |
P38806 | Chromatin modification-related protein YNG2 (ESA1-associated factor 4) (ING1 homolog 2) | EBI-11611503 | 0.35 |
P38243 | Uncharacterized protein YBR071W | EBI-11611503 | 0.35 |
P53107 | Ran-specific GTPase-activating protein 30 (Ran-binding protein 30) (RANBP30) | EBI-11611503 | 0.35 |
P10080 | Single-stranded nucleic acid-binding protein | EBI-11611503 | 0.35 |
Q01855 | 40S ribosomal protein S15 (RIG protein) (RP52) (S21) (Small ribosomal subunit protein uS19) (YS21) | EBI-11611503 | 0.35 |
Q04660 | Ribosome biogenesis protein ERB1 (Eukaryotic ribosome biogenesis protein 1) | EBI-11611503 | 0.35 |
P40010 | Nuclear GTP-binding protein NUG1 (Nuclear GTPase 1) | EBI-11611503 | 0.35 |
P32357 | A1 cistron-splicing factor AAR2 | EBI-11611503 | 0.35 |
P47017 | Sm-like protein LSm1 (SPB8 protein) | EBI-11611503 | 0.35 |
P53550 | m7GpppN-mRNA hydrolase (EC 3.6.1.62) (Protein PSU1) (mRNA-decapping enzyme subunit 2) | EBI-11611503 | 0.35 |
P47149 | Kinetochore-associated protein NNF1 | EBI-11611503 | 0.35 |
P47035 | Nucleolar protein NET1 | EBI-11611503 | 0.35 |
P05755 | 40S ribosomal protein S9-B (RP21) (S13) (Small ribosomal subunit protein uS4-B) (YP28) (YS11) | EBI-11611503 | 0.35 |
P34078 | Protein LTV1 (Low-temperature viability protein 1) | EBI-11611503 | 0.35 |
P30771 | ATP-dependent helicase NAM7 (EC 3.6.4.12) (EC 3.6.4.13) (Nonsense-mediated mRNA decay protein 1) (Nuclear accommodation of mitochondria 7 protein) (Up-frameshift suppressor 1) | EBI-11611503 | 0.35 |
P25379 | Catabolic L-serine/threonine dehydratase [Includes: L-serine dehydratase (EC 4.3.1.17) (L-serine deaminase); L-threonine dehydratase (EC 4.3.1.19) (L-threonine deaminase)] | EBI-11611503 | 0.35 |
P40348 | Replication factor C subunit 2 (Replication factor C2) (Activator 1 41 kDa subunit) | EBI-11611503 | 0.35 |
P53935 | Stress response protein NST1 (Negatively-affecting salt tolerance protein 1) | EBI-11611503 | 0.35 |
Q06631 | Protein BFR2 (Brefeldin A resistance protein 2) | EBI-11611503 | 0.35 |
P21192 | Metallothionein expression activator | EBI-11611503 | 0.59 |
P38987 | Protein TEM1 | EBI-11611503 | 0.35 |
P49626 | 60S ribosomal protein L4-B (L2) (Large ribosomal subunit protein uL4-B) (RP2) (YL2) | EBI-11611503 | 0.35 |
P32578 | SNF1 protein kinase subunit beta-1 (SNF1-interacting protein 1) | EBI-11611503 | 0.35 |
P24276 | Protein SSD1 (Protein SRK1) | EBI-11611503 | 0.35 |
P48361 | Activator of SKN7 protein 10 (Regulator of the glycerol channel 2) | EBI-11611503 | 0.35 |
P26448 | Mitotic check point protein BUB2 (Cell cycle arrest protein BUB2) | EBI-11611503 | 0.35 |
P37262 | 6-phosphogluconolactonase-like protein 2 (Suppressor of LOS1) | EBI-11611503 | 0.35 |
P25368 | Ribosomal RNA-processing protein 7 | EBI-11611503 | 0.35 |
P28004 | Pre-mRNA-processing protein 45 | EBI-11611503 | 0.35 |
Q92331 | Vacuolar protein sorting-associated protein 5 (Carboxypeptidase Y-deficient protein 10) (Vacuolar protein-targeting protein 5) | EBI-11611503 | 0.35 |
P36080 | Ribosomal RNA-processing protein 14 (Ribosome biogenesis protein RRP14) | EBI-11611503 | 0.35 |
P26321 | 60S ribosomal protein L5 (L1) (L1a) (Large ribosomal subunit protein uL18) (Ribosomal 5S RNA-binding protein) (YL3) | EBI-11611503 | 0.35 |
Q12199 | Type 2A phosphatase activator TIP41 (PP2A phosphatase activator TIP41) (TAP42-interacting protein 1) | EBI-11611503 | 0.35 |
P36104 | COMPASS component SWD2 (Complex proteins associated with SET1 protein SWD2) (Set1C component SWD2) | EBI-11611503 | 0.35 |
O13329 | DNA replication fork-blocking protein FOB1 | EBI-11611503 | 0.35 |
P47083 | U3 small nucleolar RNA-associated protein MPP10 (U3 snoRNA-associated protein MPP10) (M phase phosphoprotein 10) | EBI-11611503 | 0.35 |
P23202 | Transcriptional regulator URE2 (Disulfide reductase) (EC 1.8.4.-) (Glutathione peroxidase) (EC 1.11.1.9) | EBI-11611503 | 0.35 |
P21339 | Morphogenesis-related protein MSB1 (Multicopy suppressor of bud emergence 1) | EBI-11611503 | 0.35 |
Q03063 | Down-regulator of invasive growth 1 (Regulator of STE12 protein 1) (Regulator of sterile twelve 1) | EBI-11611503 | 0.35 |
P09032 | Translation initiation factor eIF-2B subunit gamma (GCD complex subunit GCD1) (Guanine nucleotide exchange factor subunit GCD1) (eIF-2B GDP-GTP exchange factor subunit gamma) | EBI-11611503 | 0.35 |
P32501 | Translation initiation factor eIF-2B subunit epsilon (GCD complex subunit GCD6) (Guanine nucleotide exchange factor subunit GCD6) (eIF-2B GDP-GTP exchange factor subunit epsilon) | EBI-11611503 | 0.35 |
P53830 | Cold sensitive U2 snRNA suppressor 2 | EBI-11611503 | 0.35 |
P40523 | Uncharacterized protein YIL055C | EBI-11611503 | 0.35 |
P38254 | Probable tubulin--tyrosine ligase PBY1 (EC 6.3.2.25) (P-body-associated protein 1) | EBI-11611503 | 0.35 |
P36041 | Protein EAP1 (eIF4E-associated protein 1) | EBI-11611503 | 0.35 |
P38835 | PH domain-containing protein YHR131C | EBI-11611503 | 0.35 |
P27515 | Uridine kinase (EC 2.7.1.48) (Uridine monophosphokinase) | EBI-11611503 | 0.35 |
P43639 | Casein kinase II subunit beta (CK II beta) | EBI-11611503 | 0.35 |
Q01080 | DNA-directed RNA polymerase I subunit RPA49 (A49) (DNA-directed RNA polymerase I 49 kDa polypeptide) | EBI-11611503 | 0.35 |
Q12532 | Ribosome quality control complex subunit 2 (Translation-associated element 2) | EBI-11611503 | 0.35 |
P53104 | Serine/threonine-protein kinase ATG1 (EC 2.7.11.1) (Autophagy protein 3) (Autophagy-related protein 1) (Cytoplasm to vacuole targeting protein 10) | EBI-11611503 | 0.35 |
P38856 | Clathrin coat assembly protein AP180A | EBI-11611503 | 0.35 |
P26784 | 60S ribosomal protein L16-A (L13a) (L21) (Large ribosomal subunit protein uL13-A) (RP22) (YL15) | EBI-11611503 | 0.35 |
Q03768 | Protein GIR2 (DRG family-regulatory protein 2) (Genetically interacts with ribosomal genes protein 2) | EBI-11611503 | 0.35 |
P40054 | D-3-phosphoglycerate dehydrogenase 1 (3-PGDH 1) (EC 1.1.1.95) (2-oxoglutarate reductase) (EC 1.1.1.399) | EBI-11611503 | 0.35 |
P40214 | Protein FDO1 (FKH1-interacting protein involved in donor preference) | EBI-11611503 | 0.35 |
P19880 | AP-1-like transcription factor YAP1 (Phenanthroline resistance protein PAR1) (Pleiotropic drug resistance protein PDR4) | EBI-11611503 | 0.35 |
P32608 | Retrograde regulation protein 2 | EBI-11611503 | 0.35 |
P25333 | Serine/threonine-protein kinase HAL4/SAT4 (EC 2.7.11.1) (Halotolerance protein 4) | EBI-11611503 | 0.35 |
P08518 | DNA-directed RNA polymerase II subunit RPB2 (RNA polymerase II subunit 2) (EC 2.7.7.6) (B150) (DNA-directed RNA polymerase II 140 kDa polypeptide) | EBI-11611503 | 0.35 |
Q08909 | Uncharacterized protein YOR385W | EBI-11611503 | 0.35 |
P36000 | AP-1 complex subunit beta-1 (Beta-1-adaptin) (Clathrin assembly protein complex 1 beta-1 large chain) (Clathrin assembly protein large beta-1 chain) | EBI-11611503 | 0.35 |
Q04740 | Ribonuclease H (RNase H) (EC 3.1.26.4) | EBI-11611503 | 0.35 |
P20604 | Serine/threonine-protein phosphatase PP1-1 (EC 3.1.3.16) | EBI-11611503 | 0.35 |
Q07953 | Ribosome maturation protein SDO1 | EBI-11611503 | 0.35 |
P40531 | Protein GVP36 (36 kDa Golgi vesicle protein) | EBI-11611503 | 0.35 |
P25502 | Proline utilization trans-activator | EBI-11611503 | 0.35 |
Q12100 | Probable serine/threonine-protein kinase RTK1 (EC 2.7.11.1) (Ribosome biogenesis and tRNA synthetase-associated kinase 1) | EBI-11611503 | 0.35 |
P25344 | Protein STE50 | EBI-11611503 | 0.35 |
Q12453 | Cytoplasmic export protein 1 | EBI-11611503 | 0.35 |
P05453 | Eukaryotic peptide chain release factor GTP-binding subunit (ERF-3) (ERF3) (ERF2) (G1 to S phase transition protein 1) (Omnipotent suppressor protein 2) (PSI no more protein 2) (Polypeptide release factor 3) (Translation release factor 3) | EBI-11611503 | 0.35 |
P26570 | Serine/threonine-protein phosphatase PP-Z1 (EC 3.1.3.16) | EBI-11611503 | 0.35 |
P38970 | Serine/threonine-protein kinase HAL5 (EC 2.7.11.1) (Halotolerance protein 5) | EBI-11611503 | 0.35 |
P18899 | Stress protein DDR48 (DNA damage-responsive protein 48) (DDRP 48) (Flocculent-specific protein) (YP 75) | EBI-11611503 | 0.35 |
P53297 | PAB1-binding protein 1 (Poly(A)-binding protein-binding protein) | EBI-11611503 | 0.35 |
P24309 | Lariat debranching enzyme (EC 3.1.-.-) | EBI-11611503 | 0.35 |
P07266 | Mitochondrial RNA-splicing protein MRS1 | EBI-11611503 | 0.35 |
P37263 | UPF0743 protein YCR087C-A | EBI-11611503 | 0.35 |
P53836 | CCR4-NOT transcriptional complex subunit CAF120 (120 kDa CCR4-associated factor) | EBI-11611503 | 0.35 |
P0CX52 | 40S ribosomal protein S16-B (RP61R) (Small ribosomal subunit protein uS9-B) | EBI-11611503 | 0.35 |
P34761 | Protein WHI3 | EBI-11611503 | 0.35 |
P35193 | Autophagy-related protein 19 (Cytoplasm-to-vacuole targeting protein 19) | EBI-11611503 | 0.35 |
Q05672 | RNA-binding suppressor of PAS kinase protein 1 | EBI-11611503 | 0.35 |
Q12527 | Autophagy-related protein 11 (Cytoplasm to vacuole targeting protein 9) | EBI-11611503 | 0.35 |
Q12221 | mRNA-binding protein PUF2 (Pumilio homology domain family member 2) | EBI-11611503 | 0.35 |
P53309 | Clathrin coat assembly protein AP180B | EBI-11611503 | 0.35 |
Q00916 | U1 small nuclear ribonucleoprotein 70 kDa homolog (U1 70K) (U1 snRNP 70 kDa homolog) (U1-70K) (U1 small nuclear ribonucleoprotein SNP1) (U1 snRNP protein SNP1) | EBI-11611503 | 0.35 |
Q03373 | Down-regulator of invasive growth 2 (Regulator of STE12 protein 2) (Regulator of sterile twelve 2) | EBI-11611503 | 0.35 |
Q04429 | Protein HLR1 (LRE1 homolog) | EBI-11611503 | 0.35 |
Q04226 | Transcription initiation factor TFIID subunit 11 (TAFII-40) (TAFII40) (TBP-associated factor 11) (TBP-associated factor 40 kDa) (P40) | EBI-11611503 | 0.35 |
Q03833 | Transcriptional activator/repressor GIS1 | EBI-11611503 | 0.35 |
P38070 | Serine/threonine-protein kinase YPK3 (EC 2.7.11.1) (Ribosomal S6 kinase homolog YPK3) (S6K homolog YPK3) | EBI-11611503 | 0.35 |
P32481 | Eukaryotic translation initiation factor 2 subunit gamma (eIF-2-gamma) (EC 3.6.5.3) | EBI-11611503 | 0.35 |
P26786 | 40S ribosomal protein S7-A (RP30) (RP40) (Small ribosomal subunit protein eS7-A) | EBI-11611503 | 0.35 |
P53686 | NAD-dependent protein deacetylase HST2 (EC 2.3.1.286) (Homologous to SIR2 protein 2) (Regulatory protein SIR2 homolog 2) | EBI-11611503 | 0.35 |
P32494 | Chromatin-remodeling complexes subunit NGG1 (Transcriptional adapter 3) | EBI-11611503 | 0.35 |
Q06511 | Ribosomal RNA-processing protein 15 | EBI-11611503 | 0.35 |
P22517 | Calcium/calmodulin-dependent protein kinase II (EC 2.7.11.17) | EBI-11611503 | 0.35 |
P40466 | Fork head protein homolog 1 | EBI-11611503 | 0.35 |
Q3E7Y3 | 40S ribosomal protein S22-B (RP50) (S24) (Small ribosomal subunit protein uS8-B) (YP58) (YS22) | EBI-11611503 | 0.35 |
Q06512 | Nucleolar complex protein 4 (U three protein 19) (U3 small nucleolar RNA-associated protein 19) (U3 snoRNA-associated protein 19) | EBI-11611503 | 0.35 |
P40992 | RNA polymerase I-specific transcription initiation factor RRN7 | EBI-11611503 | 0.35 |
P32491 | MAP kinase kinase MKK2/SSP33 (EC 2.7.12.2) | EBI-11611503 | 0.35 |
P40210 | Protein SIP5 (SNF1-interacting protein 5) | EBI-11611503 | 0.35 |
P36123 | SIT4-associating protein SAP190 | EBI-11611503 | 0.35 |
Q00776 | AP-1 complex subunit mu-1-I (Clathrin assembly protein complex 1 mu-1-I medium chain) (Clathrin coat assembly protein AP54) (Clathrin coat-associated protein AP54) (Golgi adaptor AP-1 54 kDa protein) (HA1 54 kDa subunit) (Mu(1)-adaptin) (Mu1-I-adaptin) | EBI-11611503 | 0.35 |
P53040 | Transcription initiation factor TFIID subunit 6 (TBP-associated factor 6) (TBP-associated factor 60 kDa) (TAFII-60) (TAFII60) | EBI-11611503 | 0.35 |
Q02931 | NET1-associated nuclear protein 1 (U three protein 17) (t-17) (U3 protein 17 required for transcription) (U3 small nucleolar RNA-associated protein 17) (U3 snoRNA-associated protein 17) | EBI-11611503 | 0.35 |
P40160 | Serine/threonine-protein kinase RIO2 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P47049 | UBX domain-containing protein 6 | EBI-11611503 | 0.35 |
P40357 | Protein transport protein SEC9 | EBI-11611503 | 0.35 |
P38333 | Essential nuclear protein 1 | EBI-11611503 | 0.35 |
P38961 | 25S rRNA (adenine(645)-N(1))-methyltransferase (EC 2.1.1.287) (Ribosomal RNA-processing protein 8) | EBI-11611503 | 0.35 |
P38861 | 60S ribosomal export protein NMD3 (Nonsense-mediated mRNA decay protein 3) | EBI-11611503 | 0.35 |
P53972 | 25S rRNA (cytosine(2278)-C(5))-methyltransferase (EC 2.1.1.311) (rRNA m(5)C methyltransferase 1) | EBI-11611503 | 0.35 |
P53289 | Protein phosphatase type 2A regulatory subunit RTS3 | EBI-11611503 | 0.35 |
Q02197 | N-alpha-acetyltransferase 35, NatC auxiliary subunit (Glucose repressible protein MAK10) (L-A virus GAG protein N-acetyltransferase subunit MAK10) (Maintenance of killer protein 10) (N-terminal acetyltransferase C complex subunit MAK10) (NatC complex subunit MAK10) | EBI-11611503 | 0.35 |
P47019 | Ribosome biogenesis protein ALB1 | EBI-11611503 | 0.35 |
P10664 | 60S ribosomal protein L4-A (L2) (Large ribosomal subunit protein uL4-A) (RP2) (YL2) | EBI-11611503 | 0.35 |
Q07622 | Activator of C kinase protein 1 | EBI-11611503 | 0.35 |
P40356 | Mediator of RNA polymerase II transcription subunit 3 (Hyper-recombination suppressor protein 1) (Mediator complex subunit 3) (Poly-glutamine domain protein 1) | EBI-11611503 | 0.35 |
P53865 | Chaotic nuclear migration protein 67 | EBI-11611503 | 0.35 |
P53930 | Protein AF-9 homolog | EBI-11611503 | 0.35 |
P35181 | AP-1 complex subunit sigma-1 (Clathrin assembly protein complex 1 sigma-1 small chain) (Clathrin coat assembly protein AP19) (Clathrin coat-associated protein AP19) (Golgi adaptor AP-1 19 kDa adaptin) (HA1 19 kDa subunit) (Sigma1-adaptin) | EBI-11611503 | 0.35 |
P38011 | Guanine nucleotide-binding protein subunit beta-like protein (Receptor for activated C kinase) (Receptor of activated protein kinase C 1) (RACK1) (Small ribosomal subunit protein RACK1) | EBI-11611503 | 0.35 |
P53237 | Protein LST7 (Lethal with SEC thirteen protein 7) | EBI-11611503 | 0.35 |
P53201 | SWR1-complex protein 4 (ESA1-associated factor 2) | EBI-11611503 | 0.35 |
P20424 | Signal recognition particle subunit SRP54 (Signal recognition particle 54 kDa protein homolog) | EBI-11611503 | 0.35 |
Q08972 | [NU+] prion formation protein 1 | EBI-11611503 | 0.35 |
P32524 | Pre-mRNA-splicing factor PRP21 | EBI-11611503 | 0.35 |
P29453 | 60S ribosomal protein L8-B (L4) (L4-1) (Large ribosomal subunit protein eL8-B) (RP6) (YL5) | EBI-11611503 | 0.35 |
P48164 | 40S ribosomal protein S7-B (Small ribosomal subunit protein eS7-B) | EBI-11611503 | 0.35 |
P47129 | Assembly-complementing factor 4 | EBI-11611503 | 0.35 |
P06634 | ATP-dependent RNA helicase DED1 (EC 3.6.4.13) (DEAD box protein 1) (Defines essential domain protein 1) | EBI-11611503 | 0.35 |
Q05775 | Eukaryotic translation initiation factor 3 subunit J (eIF3j) (Eukaryotic translation initiation factor 3 30 kDa subunit) (eIF-3 30 kDa) (High-copy suppressor of Rpg1 protein 1) | EBI-11611503 | 0.35 |
Q05518 | Protein PAL1 (Pears and lemons protein 1) | EBI-11611503 | 0.35 |
Q04199 | Chromatin assembly factor 1 subunit p60 (CAF-1 60 kDa subunit) | EBI-11611503 | 0.35 |
Q06412 | Rho1 guanine nucleotide exchange factor TUS1 (TOR unique function suppressor protein 1) | EBI-11611503 | 0.35 |
Q03900 | Uncharacterized protein YDR132C | EBI-11611503 | 0.35 |
P39939 | 40S ribosomal protein S26-B (Small ribosomal subunit protein eS26-B) | EBI-11611503 | 0.35 |
P39927 | Protein PTI1 | EBI-11611503 | 0.35 |
P42944 | Protein GZF3 | EBI-11611503 | 0.35 |
P38809 | Uncharacterized protein YHR097C | EBI-11611503 | 0.35 |
P39985 | rDNA transcriptional regulator POL5 (EC 2.7.7.7) (DNA polymerase V) (POL V) (DNA polymerase phi) | EBI-11611503 | 0.35 |
P20459 | Eukaryotic translation initiation factor 2 subunit alpha (eIF-2-alpha) | EBI-11611503 | 0.35 |
Q04305 | U3 small nucleolar RNA-associated protein 15 (U3 snoRNA-associated protein 15) (U three protein 15) (U3 protein 15 required for transcription) (t-UTP15) | EBI-11611503 | 0.35 |
Q08687 | Translation machinery-associated protein 16 | EBI-11611503 | 0.35 |
P27999 | DNA-directed RNA polymerase II subunit RPB9 (RNA polymerase II subunit B9) (B12.6) (DNA-directed RNA polymerase II 14.2 kDa polypeptide) (DNA-directed RNA polymerase II subunit 9) | EBI-11611503 | 0.35 |
Q12102 | Cleavage factor two protein 2 (105 kDa protein associated with polyadenylation factor I) | EBI-11611503 | 0.35 |
P38882 | U3 small nucleolar RNA-associated protein 9 (U3 snoRNA-associated protein 9) (U three protein 9) (U3 protein 9 required for transcription) (t-UTP9) | EBI-11611503 | 0.35 |
P32913 | Vacuolar protein sorting-associated protein 17 (Carboxypeptidase Y-deficient protein 21) | EBI-11611503 | 0.35 |
Q06834 | Alcohol-sensitive RING finger protein 1 | EBI-11611503 | 0.35 |
P38177 | Uncharacterized protein YBL086C | EBI-11611503 | 0.35 |
P32914 | Transcription elongation factor SPT4 (Chromatin elongation factor SPT4) | EBI-11611503 | 0.35 |
Q02796 | Transcriptional regulatory protein LGE1 (Large cells protein 1) | EBI-11611503 | 0.35 |
P53272 | Uncharacterized protein YGR122W | EBI-11611503 | 0.35 |
P53091 | DNA replication licensing factor MCM6 (EC 3.6.4.12) (Minichromosome maintenance protein 6) | EBI-11611503 | 0.35 |
P34758 | Protein SCD5 (Protein FTB1) | EBI-11611503 | 0.35 |
Q12432 | Chromatin modification-related protein EAF3 (ESA1-associated factor 3) | EBI-11611503 | 0.35 |
P33322 | H/ACA ribonucleoprotein complex subunit CBF5 (EC 5.4.99.-) (Centromere-binding factor 5) (Centromere/microtubule-binding protein CBF5) (H/ACA snoRNP protein CBF5) (Small nucleolar RNP protein CBF5) (p64') | EBI-11611503 | 0.35 |
P43615 | Increased recombination centers protein 6 | EBI-11611503 | 0.35 |
P47160 | Epsin-3 | EBI-11611503 | 0.35 |
P38874 | Elongator complex protein 5 (Gamma-toxin target 5) (HAT-associated protein 2) (Protein IKI1) | EBI-11611503 | 0.35 |
Q06410 | Autophagy-related protein 17 | EBI-11611503 | 0.35 |
P38817 | ADP-ribosylation factor-binding protein GGA2 (Golgi-localized, gamma ear-containing, ARF-binding protein 2) | EBI-11611503 | 0.35 |
P53136 | Ribosome biogenesis protein NSA1 (NOP7-associated protein 1) | EBI-11611503 | 0.35 |
P38789 | Ribosome biogenesis protein SSF1 | EBI-11611503 | 0.35 |
P32328 | Serine/threonine-protein kinase DBF20 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P48415 | COPII coat assembly protein SEC16 (Protein transport protein SEC16) | EBI-11611503 | 0.35 |
P39108 | Peroxisomal targeting signal 2 receptor (PTS2 receptor) (Peroxin-7) (Peroxisome import protein PAS7) | EBI-11611503 | 0.35 |
P38282 | Pre-mRNA-splicing factor SPP381 (Suppressor of PRP38-1 mutation) | EBI-11611503 | 0.35 |
P32605 | U1 small nuclear ribonucleoprotein A (U1 snRNP A) (U1-A) (U1A) (Mutant U1 die protein 1) | EBI-11611503 | 0.35 |
P53094 | Negative regulator of sporulation MDS3 (MCK1 dosage suppressor 3) | EBI-11611503 | 0.35 |
P38687 | Signal recognition particle subunit SRP68 (Signal recognition particle 68 kDa protein homolog) | EBI-11611503 | 0.35 |
P25343 | Reduced viability upon starvation protein 161 | EBI-11611503 | 0.35 |
Q02948 | Vacuolar protein sorting-associated protein 30 (Autophagy-related protein 6) | EBI-11611503 | 0.35 |
Q04868 | Elongator complex protein 6 (Gamma-toxin target 6) (HAT-associated protein 3) | EBI-11611503 | 0.35 |
Q12271 | Polyphosphatidylinositol phosphatase INP53 (Suppressor of PMA1 protein 2) (Synaptojanin-like protein 3) [Includes: SAC1-like phosphoinositide phosphatase (EC 3.1.3.-); Phosphatidylinositol 4,5-bisphosphate 5-phosphatase (EC 3.1.3.36)] | EBI-11611503 | 0.35 |
P15646 | rRNA 2'-O-methyltransferase fibrillarin (EC 2.1.1.-) (Histone-glutamine methyltransferase) (U3 small nucleolar RNA-associated protein NOP1) (Nucleolar protein 1) (U3 snoRNA-associated protein NOP1) | EBI-11611503 | 0.35 |
P38747 | OTU domain-containing protein 2 | EBI-11611503 | 0.35 |
P38630 | Replication factor C subunit 1 (Replication factor C1) (Activator 1 95 kDa subunit) (Cell division control protein 44) | EBI-11611503 | 0.35 |
P39517 | ATP-dependent RNA helicase DHH1 (EC 3.6.4.13) (DExD/H-box helicase 1) | EBI-11611503 | 0.35 |
P05740 | 60S ribosomal protein L17-A (L20A) (Large ribosomal subunit protein uL22-A) (YL17) | EBI-11611503 | 0.35 |
P54783 | D-arabinono-1,4-lactone oxidase (ALO) (EC 1.1.3.37) (L-galactono-gamma-lactone oxidase) | EBI-11611503 | 0.35 |
Q01919 | Serine/threonine-protein kinase KIN4 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
Q07655 | Protein WHI4 | EBI-11611503 | 0.35 |
P25367 | [PIN+] prion protein RNQ1 (Rich in asparagine and glutamine protein 1) | EBI-11611503 | 0.35 |
Q08921 | Target of rapamycin complex 1 subunit TCO89 (TORC1 subunit TCO89) (89 kDa TOR complex 1 protein) | EBI-11611503 | 0.35 |
Q06436 | RING-finger protein MAG2 | EBI-11611503 | 0.35 |
P12904 | 5'-AMP-activated protein kinase subunit gamma (AMPK gamma) (AMPK subunit gamma) (Regulatory protein CAT3) (Sucrose non-fermenting protein 4) | EBI-11611503 | 0.35 |
P25567 | RNA-binding protein SRO9 (Suppressor of RHO3 protein 9) | EBI-11611503 | 0.35 |
Q03503 | N-alpha-acetyltransferase 30 (EC 2.3.1.256) (L-A virus GAG protein N-acetyltransferase subunit MAK3) (Maintenance of killer protein 3) (N-terminal acetyltransferase C complex catalytic subunit MAK3) (NatC complex subunit MAK3) (NatC catalytic subunit) | EBI-11611503 | 0.35 |
P20134 | Flocculation suppression protein (Protein SFL1) | EBI-11611503 | 0.35 |
P38700 | Adaptin medium chain homolog APM2 (Adaptin-mu1-II) | EBI-11611503 | 0.35 |
P36024 | Phosphopantothenoylcysteine decarboxylase subunit SIS2 (Halotolerance protein HAL3) (Sit4 suppressor 2) | EBI-11611503 | 0.35 |
P12962 | Cap-associated protein CAF20 (20 kDa cap-associated protein) (CCR4-associated factor 2) (p20) | EBI-11611503 | 0.35 |
Q12194 | RHO1 GEF localizing protein 1 | EBI-11611503 | 0.35 |
P38990 | SNF1-activating kinase 1 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P05756 | 40S ribosomal protein S13 (S27a) (Small ribosomal subunit protein uS15) (YS15) | EBI-11611503 | 0.35 |
Q12347 | F-box protein HRT3 (High level expression reduces Ty3 transposition protein 3) | EBI-11611503 | 0.35 |
P25586 | KRR1 small subunit processome component (KRR-R motif-containing protein 1) (Ribosomal RNA assembly protein KRR1) | EBI-11611503 | 0.35 |
Q04067 | Eukaryotic translation initiation factor 3 subunit G (eIF3g) (Eukaryotic translation initiation factor 3 RNA-binding subunit) (eIF-3 RNA-binding subunit) (Translation initiation factor eIF3 p33 subunit) (eIF3 p33) | EBI-11611503 | 0.35 |
Q03508 | Uncharacterized protein YMR265C | EBI-11611503 | 0.35 |
P40208 | Glucose-induced degradation protein 8 (Dosage-dependent cell cycle regulator 1) | EBI-11611503 | 0.35 |
P39008 | Poly(A) ribonuclease POP2 (EC 3.1.13.4) (CCR4-associated factor 1) | EBI-11611503 | 0.35 |
P38262 | SIR4-interacting protein SIF2 | EBI-11611503 | 0.35 |
P32829 | Double-strand break repair protein MRE11 | EBI-11611503 | 0.35 |
P53628 | Transcription regulatory protein SNF12 (SWI/SNF complex component SWP73) | EBI-11611503 | 0.35 |
P53583 | Protein MPA43 | EBI-11611503 | 0.35 |
P40991 | 25S rRNA (cytosine(2870)-C(5))-methyltransferase (EC 2.1.1.310) (Nucleolar protein 2) | EBI-11611503 | 0.35 |
P53965 | Inositol phosphatase SIW14 (EC 3.6.1.52) (5-PP-InsP phosphatase) (Inositol pyrophosphate phosphatase SIW14) (Oxidant-induced cell-cycle arrest protein 3) (Synthetic interaction with WHI2 protein 14) | EBI-11611503 | 0.35 |
P39730 | Eukaryotic translation initiation factor 5B (eIF-5B) (EC 3.6.5.3) (Translation initiation factor IF-2) | EBI-11611503 | 0.35 |
Q12428 | Probable 2-methylcitrate dehydratase (2-MC dehydratase) (EC 4.2.1.79) ((2S,3S)-2-methylcitrate dehydratase) | EBI-11611503 | 0.35 |
Q12406 | Actin-related protein 7 (Actin-like protein ARP7) (Chromatin structure-remodeling complex protein ARP7) (SWI/SNF complex component ARP7) | EBI-11611503 | 0.35 |
Q12502 | Protein LDB19 (Low dye-binding protein 19) | EBI-11611503 | 0.35 |
P40484 | DBF2 kinase activator protein MOB1 (MPS1 binder 1) (Maintenance of ploidy protein MOB1) | EBI-11611503 | 0.35 |
P36157 | Putative transcriptional activator MSA2 (MBF and SBF-associated protein 2) | EBI-11611503 | 0.35 |
Q12024 | Ribosome biogenesis protein YTM1 (Microtubule-associated protein YTM1) | EBI-11611503 | 0.35 |
Q00381 | AP-2 complex subunit sigma (Adaptin small chain) (Clathrin assembly protein 2 sigma small chain) (Clathrin coat assembly protein AP17) (Clathrin coat-associated protein AP17) (Plasma membrane adaptor AP-2 17 kDa protein) (Sigma2-adaptin) | EBI-11611503 | 0.35 |
Q06108 | Regulator of the glycerol channel 1 | EBI-11611503 | 0.35 |
P32342 | Signal recognition particle subunit SRP21 (Signal recognition particle 21 kDa protein) | EBI-11611503 | 0.35 |
P40099 | 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) (5,10-methenyl-tetrahydrofolate synthetase) (MTHFS) (Methenyl-THF synthetase) | EBI-11611503 | 0.35 |
Q02939 | General transcription and DNA repair factor IIH subunit TFB2 (TFIIH subunit TFB2) (RNA polymerase II transcription factor B 52 kDa subunit) (RNA polymerase II transcription factor B p52 subunit) (RNA polymerase II transcription factor B subunit 2) | EBI-11611503 | 0.35 |
Q03497 | Serine/threonine-protein kinase STE20 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P32607 | Retrograde regulation protein 1 | EBI-11611503 | 0.35 |
P39016 | Suppressor protein MPT5 (Protein HTR1) (Pumilio homology domain family member 5) | EBI-11611503 | 0.35 |
P04147 | Polyadenylate-binding protein, cytoplasmic and nuclear (PABP) (Poly(A)-binding protein) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) | EBI-11611503 | 0.35 |
P36083 | Uncharacterized protein YKL075C | EBI-11611503 | 0.35 |
P32502 | Translation initiation factor eIF-2B subunit beta (GCD complex subunit GCD7) (Guanine nucleotide exchange factor subunit GCD7) (eIF-2B GDP-GTP exchange factor subunit beta) | EBI-11611503 | 0.35 |
Q03208 | Uncharacterized protein YML119W | EBI-11611503 | 0.35 |
Q12071 | Vacuolar protein sorting-associated protein 54 (CPF1 genetically-interacting protein 1) (Temperature-sensitive clathrin synthetic mutation protein 3) | EBI-11611503 | 0.35 |
P07347 | N-terminal acetyltransferase A complex catalytic subunit ARD1 (NatA complex subunit ARD1) (EC 2.3.1.255) (Arrest-defective protein 1) | EBI-11611503 | 0.35 |
P53215 | tRNA(His) guanylyltransferase (EC 2.7.7.79) (tRNA-histidine guanylyltransferase) | EBI-11611503 | 0.35 |
P32590 | Heat shock protein homolog SSE2 | EBI-11611503 | 0.35 |
Q3E757 | 60S ribosomal protein L11-B (L16) (Large ribosomal subunit protein uL5-B) (RP39) (YL22) | EBI-11611503 | 0.35 |
P38236 | Protein MUM2 (Muddled meiosis protein 2) | EBI-11611503 | 0.35 |
P40547 | Vacuolar import and degradation protein 28 (Glucose-induced degradation protein 5) | EBI-11611503 | 0.35 |
Q07084 | Osmolarity two-component system protein SSK1 | EBI-11611503 | 0.35 |
P38682 | ADP-ribosylation factor GTPase-activating protein GLO3 (ARF GAP GLO3) | EBI-11611503 | 0.35 |
P36103 | Uncharacterized protein YKL023W | EBI-11611503 | 0.35 |
P38151 | PAB1-binding protein 2 | EBI-11611503 | 0.35 |
P40017 | Carnitine O-acetyltransferase YAT2 (EC 2.3.1.7) | EBI-11611503 | 0.35 |
P16522 | Anaphase-promoting complex subunit CDC23 (Cell division control protein 23) | EBI-11611503 | 0.35 |
P26783 | 40S ribosomal protein S5 (RP14) (S2) (Small ribosomal subunit protein uS7) (YS8) | EBI-11611503 | 0.35 |
Q03776 | U1 small nuclear ribonucleoprotein component PRP42 (U1 snRNP protein PRP42) (65 kDa snRNP protein) (Pre-mRNA-processing factor 42) | EBI-11611503 | 0.35 |
Q05543 | Regulator of Ty1 transposition protein 103 | EBI-11611503 | 0.35 |
P11746 | Pheromone receptor transcription factor (GRM/PRTF protein) | EBI-11611503 | 0.35 |
P53734 | ATP-dependent RNA helicase DBP6 (EC 3.6.4.13) (DEAD box protein 6) | EBI-11611503 | 0.35 |
Q12515 | Protein PAR32 (Protein phosphorylated after rapamycin 32) | EBI-11611503 | 0.35 |
P15625 | Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) | EBI-11611503 | 0.35 |
Q03088 | Styryl dye vacuolar localization protein 3 | EBI-11611503 | 0.35 |
Q04600 | Translation machinery-associated protein 64 | EBI-11611503 | 0.35 |
P38691 | Serine/threonine-protein kinase KSP1 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P47168 | TEL2-interacting protein 2 | EBI-11611503 | 0.35 |
P50091 | Peroxisomal membrane protein PEX21 (Peroxin-21) | EBI-11611503 | 0.35 |
P53036 | SIT4-associating protein SAP4 | EBI-11611503 | 0.35 |
P05738 | 60S ribosomal protein L9-A (L8) (Large ribosomal subunit protein uL6-A) (RP24) (YL11) | EBI-11611503 | 0.35 |
Q08096 | RNA 3'-terminal phosphate cyclase-like protein | EBI-11611503 | 0.35 |
P38112 | ATP-dependent RNA helicase MAK5 (EC 3.6.4.13) (Maintenance of killer protein 5) | EBI-11611503 | 0.35 |
P20433 | DNA-directed RNA polymerase II subunit RPB4 (RNA polymerase II subunit B4) (B32) (DNA-directed RNA polymerase II 32 kDa polypeptide) | EBI-11611503 | 0.35 |
P29468 | Poly(A) polymerase (PAP) (EC 2.7.7.19) (Polynucleotide adenylyltransferase) | EBI-11611503 | 0.35 |
Q99314 | Something about silencing protein 5 | EBI-11611503 | 0.35 |
P42846 | Protein KRI1 (KRR1-interacting protein 1) | EBI-11611503 | 0.35 |
P43586 | 60S ribosomal subunit assembly/export protein LOC1 (Localization of ASH1 mRNA protein 1) | EBI-11611503 | 0.35 |
P28263 | Ubiquitin-conjugating enzyme E2-24 kDa (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme 8) (Glucose-induced degradation protein 3) (Ubiquitin carrier protein) (Ubiquitin-protein ligase) | EBI-11611503 | 0.35 |
Q12417 | Pre-mRNA-splicing factor PRP46 (Complexed with CEF1 protein 1) (PRP nineteen-associated complex protein 50) (PRP19-associated complex protein 50) (Pre-mRNA-processing protein 46) | EBI-11611503 | 0.35 |
Q06671 | Autophagy-related protein 23 (Cytoplasm to vacuole targeting protein 23) | EBI-11611503 | 0.35 |
P15790 | Casein kinase II subunit alpha (CK II subunit alpha) (EC 2.7.11.1) | EBI-11611503 | 0.35 |
Q12099 | ATP-dependent RNA helicase FAL1 (EC 3.6.4.13) (Translation initiation factor four A-like protein 1) | EBI-11611503 | 0.35 |
P40007 | Nucleolar protein 16 | EBI-11611503 | 0.35 |
O13516 | 40S ribosomal protein S9-A (RP21) (S13) (Small ribosomal subunit protein uS4-A) (YP28) (YS11) | EBI-11611503 | 0.35 |
P47122 | GPN-loop GTPase 1 (EC 3.6.5.-) (Essential PCL1-interacting ATPase 1) (GPN-loop GTPase NPA3) (Nucleolar preribosomal-associated protein 3) | EBI-11611503 | 0.35 |
P53327 | RQC trigger complex helicase SLH1 (EC 3.6.4.13) (Antiviral helicase SLH1) (SKI2-like helicase 1) | EBI-11611503 | 0.35 |
P39936 | Eukaryotic initiation factor 4F subunit p130 (eIF-4F p130) (eIF4F p130) (Translation initiation factor 4(4)-F(6) subunit gamma(3) protein 2) (eIF4G2) (mRNA cap-binding protein complex subunit p130) | EBI-11611503 | 0.35 |
Q07915 | Ribosome biogenesis protein RLP24 (Ribosomal protein L24-like) | EBI-11611503 | 0.35 |
P53165 | SAGA-associated factor 73 (73 kDa SAGA-associated factor) (SAGA histone acetyltransferase complex 73 kDa subunit) | EBI-11611503 | 0.35 |
P38272 | SWI5-dependent HO expression protein 3 | EBI-11611503 | 0.35 |
Q04461 | Transcription factor-like protein EUC1 (Enriches ubiquitin on chromatin protein 1) | EBI-11611503 | 0.35 |
Q08287 | 60S ribosome subunit biogenesis protein NOP8 (Nucleolar protein 8) | EBI-11611503 | 0.35 |
P52920 | Cytosolic Fe-S cluster assembly factor NBP35 (Nucleotide-binding protein 35) | EBI-11611503 | 0.35 |
Q06709 | Cytoplasmic 60S subunit biogenesis factor REH1 (REI1-homolog 1) (pre-60S factor REH1) | EBI-11611503 | 0.35 |
Q02326 | 60S ribosomal protein L6-A (L17) (Large ribosomal subunit protein eL6-A) (RP18) (YL16) | EBI-11611503 | 0.35 |
P32351 | Sugar utilization regulatory protein IMP2 | EBI-11611503 | 0.35 |
P47006 | DNA-directed RNA polymerase I subunit RPA34 (A34) (DNA-directed DNA-dependent RNA polymerase 34.5 kDa polypeptide) (A34.5) | EBI-11611503 | 0.35 |
P18888 | Transcription regulatory protein SNF6 (SWI/SNF complex component SNF6) | EBI-11611503 | 0.35 |
Q04934 | Protein IVY1 (Interaction with VPS33 and YPT7 protein 1) | EBI-11611503 | 0.35 |
P39516 | 40S ribosomal protein S14-B (RP59B) (Small ribosomal subunit protein uS11-B) | EBI-11611503 | 0.35 |
Q12380 | Autophagy protein 5 | EBI-11611503 | 0.35 |
P40963 | Histone acetyltransferase SAS2 (EC 2.3.1.48) (Something about silencing protein 2) | EBI-11611503 | 0.35 |
P15807 | Siroheme biosynthesis protein MET8 [Includes: Precorrin-2 dehydrogenase (EC 1.3.1.76); Sirohydrochlorin ferrochelatase (EC 4.99.1.4)] | EBI-11611503 | 0.35 |
Q12454 | Putative tyrosine-protein phosphatase OCA6 (EC 3.1.3.48) (Oxidant-induced cell-cycle arrest protein 6) | EBI-11611503 | 0.35 |
Q00723 | Pre-mRNA-splicing factor 38 (Pre-mRNA-processing factor 38) | EBI-11611503 | 0.35 |
P18961 | Serine/threonine-protein kinase YPK2/YKR2 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
Q12368 | 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component | EBI-11611503 | 0.35 |
P42223 | Protein SBE2 (Suppressor of BEM4 protein 2) | EBI-11611503 | 0.35 |
P50111 | Protein ZDS1 (Protein NRC1) (RT2GS1) | EBI-11611503 | 0.35 |
Q05468 | Ribosome quality control complex subunit 1 | EBI-11611503 | 0.35 |
P22209 | Serine/threonine-protein kinase KIN3 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P38873 | Target of rapamycin complex 1 subunit KOG1 (TORC1 subunit KOG1) (Kontroller of growth protein 1) (Local anesthetic-sensitive protein 24) (Regulatory-associated protein of TOR) (Raptor) | EBI-11611503 | 0.35 |
P36053 | Transcription elongation factor 1 | EBI-11611503 | 0.35 |
P38719 | ATP-dependent RNA helicase DBP8 (EC 3.6.4.13) (DEAD box protein 8) | EBI-11611503 | 0.35 |
P32591 | SWI/SNF complex subunit SWI3 (Transcription factor TYE2) (Transcription regulatory protein SWI3) | EBI-11611503 | 0.35 |
P38431 | Eukaryotic translation initiation factor 5 (eIF-5) | EBI-11611503 | 0.35 |
P39998 | Enhancer of mRNA-decapping protein 3 | EBI-11611503 | 0.35 |
P14904 | Vacuolar aminopeptidase 1 (EC 3.4.11.22) (Aminopeptidase yscI) (Leucine aminopeptidase IV) (LAPIV) (Lysosomal aminopeptidase III) (Polypeptidase) (Vacuolar aminopeptidase I) | EBI-11611503 | 0.35 |
P19454 | Casein kinase II subunit alpha' (CK II) (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P32899 | U3 small nucleolar ribonucleoprotein protein IMP3 (U3 snoRNP protein IMP3) (Interacting with MPP10 protein 3) | EBI-11611503 | 0.35 |
P11433 | Cell division control protein 24 (Calcium regulatory protein) | EBI-11611503 | 0.35 |
Q02864 | Uncharacterized protein YPL071C | EBI-11611503 | 0.35 |
P40070 | U6 snRNA-associated Sm-like protein LSm4 (Like-SM protein 4) | EBI-11611503 | 0.35 |
P53952 | Uncharacterized protein YNL050C | EBI-11611503 | 0.35 |
P16370 | DNA-directed RNA polymerase II subunit RPB3 (RNA polymerase II subunit 3) (RNA polymerase II subunit B3) (B44.5) (DNA-directed RNA polymerase II 45 kDa polypeptide) | EBI-11611503 | 0.35 |
Q02892 | Nucleolar GTP-binding protein 1 | EBI-11611503 | 0.35 |
Q08689 | N-alpha-acetyltransferase NAT5 (NatA complex subunit NAT5) (EC 2.3.1.258) | EBI-11611503 | 0.35 |
P39955 | Protein SAP1 (SIN1-associated protein) | EBI-11611503 | 0.35 |
P41903 | Peroxisomal acyl-coenzyme A thioester hydrolase 1 (EC 3.1.2.2) (Peroxisomal long-chain acyl-CoA thioesterase 1) | EBI-11611503 | 0.35 |
P38315 | YAP1-binding protein 1 (Activator of YAP1) | EBI-11611503 | 0.35 |
P38041 | Protein BOB1 (BEM1-binding protein) (Growth inhibitory protein 7) | EBI-11611503 | 0.35 |
P45976 | Pre-mRNA polyadenylation factor FIP1 | EBI-11611503 | 0.35 |
P32497 | Eukaryotic translation initiation factor 3 subunit C (eIF3c) (Eukaryotic translation initiation factor 3 93 kDa subunit) (eIF3 p93) (Nuclear transport protein NIP1) (Translation initiation factor eIF3, p93 subunit) | EBI-11611503 | 0.35 |
P37304 | Protein PAM1 | EBI-11611503 | 0.35 |
P43597 | Uncharacterized protein YFR016C | EBI-11611503 | 0.35 |
Q12191 | Binder of USO1 and GRH1 protein 1 | EBI-11611503 | 0.35 |
P38759 | Vacuolar protein sorting-associated protein 29 (Carboxypeptidase Y-deficient protein 11) (Vesicle protein sorting 29) | EBI-11611503 | 0.35 |
P53883 | Nucleolar protein 13 | EBI-11611503 | 0.35 |
Q06706 | Elongator complex protein 1 (Gamma-toxin target 1) (Protein IKI3) | EBI-11611503 | 0.35 |
P38712 | ATP-dependent rRNA helicase RRP3 (EC 3.6.4.13) (Ribosomal RNA-processing protein 3) | EBI-11611503 | 0.35 |
P32495 | H/ACA ribonucleoprotein complex subunit NHP2 (H/ACA snoRNP protein NHP2) (High mobility group-like nuclear protein 2) | EBI-11611503 | 0.35 |
Q03656 | Serine/threonine-protein kinase SKY1 (SRPK) (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P38230 | Probable quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) | EBI-11611503 | 0.35 |
P53316 | Uncharacterized RNA-binding protein YGR250C | EBI-11611503 | 0.35 |
P25390 | Serine/threonine-protein kinase SSK22 (EC 2.7.11.1) (MAP kinase kinase kinase SSK22) (Suppressor of sensor kinase 22) | EBI-11611503 | 0.35 |
Q03862 | Probable metalloprotease ARX1 (EC 3.-.-.-) (Associated with ribosomal export complex protein 1) | EBI-11611503 | 0.35 |
P25555 | Serine/arginine (SR)-type shuttling mRNA binding protein GBP2 (Polyadenylate-binding protein GBP2) (RAP1 localization factor 6) (Single-strand telomeric DNA-binding protein GBP2) (G-strand-binding protein 2) | EBI-11611503 | 0.35 |
P0CX73 | Transposon Ty1-PL Gag polyprotein (Gag-p49) (Transposon Ty1 protein A) (TY1A) (TYA) (p58) [Cleaved into: Capsid protein (CA) (Gag-p45) (p54); Gag-p4] | EBI-11611503 | 0.35 |
P40453 | Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) | EBI-11611503 | 0.35 |
P34253 | Protein KTI12 (Gamma-toxin target protein 4) (Killer toxin insensitivity protein 12) | EBI-11611503 | 0.35 |
P24784 | ATP-dependent RNA helicase DBP1 (EC 3.6.4.13) (DEAD box protein 1) (Helicase CA1) | EBI-11611503 | 0.35 |
P39525 | 3-oxoacyl-[acyl-carrier-protein] synthase homolog (EC 2.3.1.41) (Beta-ketoacyl-ACP synthase homolog) | EBI-11611503 | 0.35 |
P34239 | Protein LST4 (Lethal with SEC30 protein 4) | EBI-11611503 | 0.35 |
P38200 | Mitotic spindle-associated protein SHE1 (Sensitive to high expression protein 1) | EBI-11611503 | 0.35 |
Q12124 | Mediator of RNA polymerase II transcription subunit 2 (Mediator complex subunit 2) | EBI-11611503 | 0.35 |
P53199 | Sterol-4-alpha-carboxylate 3-dehydrogenase ERG26, decarboxylating (EC 1.1.1.170) (C-3 sterol dehydrogenase ERG26) (C-4 decarboxylase ERG26) (Ergosterol biosynthetic protein 26) | EBI-11611503 | 0.35 |
P47108 | Nucleolar pre-ribosomal-associated protein 2 (Unhealthy ribosome biogenesis protein 2) | EBI-11611503 | 0.35 |
P47148 | Peroxisomal protein 2 | EBI-11611503 | 0.35 |
P05748 | 60S ribosomal protein L15-A (L13) (Large ribosomal subunit protein eL15-A) (RP15R) (YL10) (YP18) | EBI-11611503 | 0.35 |
P12945 | N-terminal acetyltransferase A complex subunit NAT1 (NatA complex subunit NAT1) (Amino-terminal, alpha-amino, acetyltransferase 1) | EBI-11611503 | 0.35 |
Q12163 | NAP1-binding protein 2 | EBI-11611503 | 0.35 |
P53063 | Decapping nuclease RAI1 (ScRai1) (EC 3.6.1.-) (NAD-capped RNA hydrolase RAI1) (DeNADding enzyme RAI1) (EC 3.6.1.-) (RAT1-interacting protein) | EBI-11611503 | 0.35 |
Q08208 | Nucleolar protein 12 | EBI-11611503 | 0.35 |
Q05949 | Protein BUR2 (Bypass UAS requirement protein 2) (Chromosome stability protein 4) | EBI-11611503 | 0.35 |
P36146 | Protein LAS1 | EBI-11611503 | 0.35 |
Q08732 | Serine/threonine-protein kinase HRK1 (EC 2.7.11.1) (Hygromycin resistance kinase 1) | EBI-11611503 | 0.35 |
Q07872 | Epsin-4 | EBI-11611503 | 0.35 |
P35182 | Protein phosphatase 2C homolog 1 (PP2C-1) (EC 3.1.3.16) | EBI-11611503 | 0.35 |
P25617 | Uncharacterized protein YCR016W | EBI-11611503 | 0.35 |
P35178 | Ribosomal RNA-processing protein 1 | EBI-11611503 | 0.35 |
Q06078 | U3 small nucleolar RNA-associated protein 21 (U3 snoRNA-associated protein 21) (U three protein 21) | EBI-11611503 | 0.35 |
Q04418 | RNA polymerase II-associated protein RBA50 (RNA polymerase II-associated protein of 50 kDa) | EBI-11611503 | 0.35 |
Q04003 | Something about silencing protein 4 | EBI-11611503 | 0.35 |
P32909 | Protein SMY2 (Suppressor of MYO2-66 protein) | EBI-11611503 | 0.35 |
P23561 | Serine/threonine-protein kinase STE11 (EC 2.7.11.25) | EBI-11611503 | 0.35 |
P15274 | AMP deaminase (EC 3.5.4.6) (Myoadenylate deaminase) | EBI-11611503 | 0.35 |
P53131 | Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 (EC 3.6.4.13) (Helicase JA1) | EBI-11611503 | 0.35 |
P49704 | Pre-mRNA-processing factor 31 | EBI-11611503 | 0.35 |
Q06315 | Protein SKG3 (Suppressor of lethality of KEX2-GAS1 double null mutant protein 3) | EBI-11611503 | 0.35 |
P18494 | Nitrogen regulatory protein GLN3 | EBI-11611503 | 0.35 |
P20447 | ATP-dependent RNA helicase DBP3 (EC 3.6.4.13) (DEAD box protein 3) (Helicase CA3) | EBI-11611503 | 0.35 |
P53145 | Large subunit GTPase 1 (EC 3.6.1.-) | EBI-11611503 | 0.35 |
Q04347 | Bud site selection protein 22 | EBI-11611503 | 0.35 |
P25294 | Protein SIS1 | EBI-11611503 | 0.35 |
P40561 | RNA-binding protein SGN1 | EBI-11611503 | 0.35 |
Q00816 | Resistance to glucose repression protein 1 (Protein HEX2) (Second-site suppressor of the rna1-1 mutation 1) | EBI-11611503 | 0.35 |
Q03532 | ATP-dependent RNA helicase HAS1 (EC 3.6.4.13) (Helicase associated with SET1 protein 1) | EBI-11611503 | 0.35 |
P43573 | Bud site selection protein 27 | EBI-11611503 | 0.35 |
P25339 | Pumilio homology domain family member 4 | EBI-11611503 | 0.35 |
P39702 | Vacuolar protein sorting-associated protein 8 (Vacuolar protein-targeting protein 8) | EBI-11611503 | 0.35 |
P50946 | Putative tyrosine-protein phosphatase OCA1 (EC 3.1.3.48) (Oxidant-induced cell-cycle arrest protein 1) | EBI-11611503 | 0.35 |
P48412 | Nonsense-mediated mRNA decay protein 3 (Up-frameshift suppressor 3) | EBI-11611503 | 0.35 |
P21374 | Pre-mRNA-splicing factor ISY1 (Interactor of SYF1) (PRP19-associated complex protein 30) | EBI-11611503 | 0.35 |
P38779 | Proteasome-interacting protein CIC1 (Core interacting component 1) | EBI-11611503 | 0.35 |
P03871 | Partitioning protein REP1 (R1) (Protein Baker) (Trans-acting factor B) | EBI-11611503 | 0.35 |
Q02554 | Cold sensitive U2 snRNA suppressor 1 | EBI-11611503 | 0.35 |
Q12460 | Nucleolar protein 56 (Ribosome biosynthesis protein SIK1) (Suppressor of I kappa b protein 1) | EBI-11611503 | 0.35 |
P50109 | Protein PSP2 (Mitochondrial regulator of splicing 15) (Polymerase suppressor protein 2) | EBI-11611503 | 0.35 |
P34241 | Nucleolar pre-ribosomal-associated protein 1 (Unhealthy ribosome biogenesis protein 1) | EBI-11611503 | 0.35 |
P53892 | Protein IBD2 (Inhibition of bud division protein 2) | EBI-11611503 | 0.35 |
P53914 | RNA cytidine acetyltransferase (EC 2.3.1.-) (18S rRNA cytosine acetyltransferase) (Killer toxin-resistance protein 33) (Ribosomal RNA cytidine acetyltransferase 1) | EBI-11611503 | 0.35 |
P43572 | Enhancer of polycomb-like protein 1 | EBI-11611503 | 0.35 |
Q12476 | Protein AIR2 (Arginine methyltransferase-interacting RING finger protein 2) | EBI-11611503 | 0.35 |
P48234 | Ribosome biogenesis protein ENP2 (Essential nuclear protein 2) | EBI-11611503 | 0.35 |
P38321 | Uncharacterized protein YBR225W | EBI-11611503 | 0.35 |
P53137 | RQC trigger complex subunit CUE3 (CUE domain-containing protein 3) (Coupling of ubiquitin conjugation to ER degradation protein 3) | EBI-11611503 | 0.35 |
Q12378 | RNA polymerase II subunit B1 CTD phosphatase RTR2 (EC 3.1.3.16) (RNA polymerase II-associated protein 2 homolog RTR2) (Regulator of transcription 2) | EBI-11611503 | 0.35 |
P40956 | Protein GTS1 (Protein LSR1) | EBI-11611503 | 0.35 |
Q04673 | General transcription and DNA repair factor IIH subunit SSL1 (TFIIH subunit SSL1) (RNA polymerase II transcription factor B subunit SSL1) (TFB subunit SSL1) (Suppressor of stem-loop protein 1) | EBI-11611503 | 0.35 |
P40482 | Protein transport protein SEC24 (Abnormal nuclear morphology 1) | EBI-11611503 | 0.35 |
Q03758 | Ubiquitin ligase-binding protein BUL2 | EBI-11611503 | 0.35 |
P38823 | E3 ubiquitin-protein ligase DMA1 (EC 2.3.2.27) (Checkpoint forkhead associated with RING domains-containing protein 1) (Defective in mitotic arrest protein 1) (RING-type E3 ubiquitin transferase DMA1) | EBI-11611503 | 0.35 |
P40559 | Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 (EC 3.1.3.36) (Synaptojanin-like protein 1) | EBI-11611503 | 0.35 |
Q07896 | Nucleolar complex-associated protein 3 | EBI-11611503 | 0.35 |
Q06211 | E3 ubiquitin-protein ligase linker protein MMS1 (Methyl methanesulfonate-sensitivity protein 1) (Regulator of Ty1 transposition protein 108) (Synthetically lethal with MCM10 protein 6) | EBI-11611503 | 0.35 |
P51534 | SWI5-dependent HO expression protein 4 | EBI-11611503 | 0.35 |
P13186 | Serine/threonine-protein kinase KIN2 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P38281 | Actin patches distal protein 1 | EBI-11611503 | 0.35 |
P15303 | Protein transport protein SEC23 | EBI-11611503 | 0.35 |
Q08226 | Protein CRT10 (Constitutive RNR transcription regulator 10) | EBI-11611503 | 0.35 |
P12688 | Serine/threonine-protein kinase YPK1 (EC 2.7.11.1) (Sphingosine-like immunosuppressant resistant protein 2) (Yeast protein kinase 1) | EBI-11611503 | 0.35 |
P36160 | Ribosome biogenesis protein RPF2 | EBI-11611503 | 0.35 |
Q12060 | Transcriptional coactivator HFI1/ADA1 | EBI-11611503 | 0.35 |
P38697 | Inosine-5'-monophosphate dehydrogenase 2 (IMP dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205) | EBI-11611503 | 0.35 |
Q06344 | Pre-rRNA-processing protein ESF1 (18S rRNA factor 1) | EBI-11611503 | 0.35 |
P32598 | Serine/threonine-protein phosphatase PP1-2 (EC 3.1.3.16) | EBI-11611503 | 0.35 |
P29366 | Bud emergence protein 1 (Suppressor of RHO3 protein 1) | EBI-11611503 | 0.35 |
P34087 | DNA-directed RNA polymerase II subunit RPB7 (RNA polymerase II subunit B7) (B16) | EBI-11611503 | 0.35 |
P38344 | Cytoplasmic 60S subunit biogenesis factor REI1 (Required for isotropic bud growth protein 1) (pre-60S factor REI1) | EBI-11611503 | 0.35 |
Q08649 | Histone acetyltransferase ESA1 (EC 2.3.1.48) (Protein 2-hydroxyisobutyryltransferase ESA1) (EC 2.3.1.-) (Protein acetyltransferase ESA1) (EC 2.3.1.-) (Protein crotonyltransferase ESA1) (EC 2.3.1.-) | EBI-11611503 | 0.35 |
Q04408 | Uncharacterized protein YDR514C | EBI-11611503 | 0.35 |
Q07381 | Ribosome biogenesis protein TSR1 (20S rRNA accumulation protein 1) | EBI-11611503 | 0.35 |
P09064 | Eukaryotic translation initiation factor 2 subunit beta (eIF-2-beta) | EBI-11611503 | 0.35 |
P16892 | Mitogen-activated protein kinase FUS3 (MAP kinase FUS3) (EC 2.7.11.24) | EBI-11611503 | 0.35 |
P43612 | SIT4-associating protein SAP155 | EBI-11611503 | 0.35 |
P06103 | Eukaryotic translation initiation factor 3 subunit B (eIF3b) (Cell cycle regulation and translation initiation protein) (Eukaryotic translation initiation factor 3 90 kDa subunit) (eIF3 p90) (Translation initiation factor eIF3 p90 subunit) | EBI-11611503 | 0.35 |
P53251 | Ribosome biogenesis protein SLX9 | EBI-11611503 | 0.35 |
P14126 | 60S ribosomal protein L3 (Large ribosomal subunit protein uL3) (Maintenance of killer protein 8) (RP1) (Trichodermin resistance protein) (YL1) | EBI-11611503 | 0.35 |
Q04739 | SNF1 protein kinase subunit beta-3 (Glucose repression protein GAL83) (Protein SPM1) | EBI-11611503 | 0.35 |
Q12343 | Mediator of RNA polymerase II transcription subunit 4 (Mediator complex subunit 4) | EBI-11611503 | 0.35 |
P47170 | Vacuolar membrane-associated protein IML1 (Increased minichromosome loss protein 1) (SEH-associated protein 1) | EBI-11611503 | 0.35 |
P15624 | Phenylalanine--tRNA ligase beta subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase beta subunit) (PheRS) | EBI-11611503 | 0.35 |
P47050 | Cullin-8 (Cullin-C) (Regulator of Ty1 transposition protein 101) | EBI-11611503 | 0.35 |
Q08886 | Guanine nucleotide-binding protein subunit beta 1 (Gbeta mimic kelch protein 1) | EBI-11611503 | 0.35 |
P51862 | RHO1 GDP-GTP exchange protein 2 | EBI-11611503 | 0.35 |
P53941 | U3 small nucleolar ribonucleoprotein protein IMP4 (U3 snoRNP protein IMP4) (Interacting with MPP10 protein 4) | EBI-11611503 | 0.35 |
P54113 | Bifunctional purine biosynthesis protein ADE16 [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (ATIC) (IMP synthase) (Inosinicase)] | EBI-11611503 | 0.35 |
Q12517 | mRNA-decapping enzyme subunit 1 | EBI-11611503 | 0.35 |
P30665 | DNA replication licensing factor MCM4 (EC 3.6.4.12) (Cell division control protein 54) | EBI-11611503 | 0.35 |
Q03785 | Serine/threonine-protein kinase VHS1 (EC 2.7.11.1) (Viable in a HAL3 SIT4 background protein 1) | EBI-11611503 | 0.35 |
P38249 | Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 110 kDa subunit homolog) (eIF3 p110) (Translation initiation factor eIF3, p110 subunit homolog) | EBI-11611503 | 0.35 |
P53855 | Autophagy-related protein 2 (Sporulation-specific protein 72) | EBI-11611503 | 0.35 |
P32786 | RNA polymerase I-specific transcription initiation factor RRN6 | EBI-11611503 | 0.35 |
P53604 | Protein MSO1 | EBI-11611503 | 0.35 |
Q06628 | Autophagy-related protein 13 | EBI-11611503 | 0.35 |
Q08237 | RNA exonuclease 4 (EC 3.1.-.-) | EBI-11611503 | 0.35 |
P39717 | Guanine nucleotide-binding protein subunit beta 2 (Gbeta mimic kelch protein 2) | EBI-11611503 | 0.35 |
P53942 | Ribonuclease H2 subunit A (RNase H2 subunit A) (EC 3.1.26.4) (RNase H(201)) (RNase H(35)) (Ribonuclease HI large subunit) (RNase HI large subunit) (Ribonuclease HI subunit A) | EBI-11611503 | 0.35 |
Q06218 | ATP-dependent RNA helicase DBP9 (EC 3.6.4.13) (DEAD box protein 9) | EBI-11611503 | 0.35 |
P53893 | Ribosome assembly protein 1 (EC 3.6.5.-) (EF-2-like GTPase) (Elongation factor-like 1) | EBI-11611503 | 0.35 |
Q12028 | AP-1 complex subunit gamma-1 (Clathrin assembly protein complex 1 gamma large chain) (Clathrin assembly protein large gamma chain) (Gamma-adaptin) | EBI-11611503 | 0.35 |
Q12321 | Mediator of RNA polymerase II transcription subunit 1 (Mediator complex subunit 1) | EBI-11611503 | 0.35 |
P40217 | Eukaryotic translation initiation factor 3 subunit I (eIF3i) (Eukaryotic translation initiation factor 3 39 kDa subunit) (eIF-3 39 kDa subunit) (eIF3 p39) | EBI-11611503 | 0.35 |
Q07834 | KH domain-containing protein YLL032C | EBI-11611503 | 0.35 |
Q01477 | Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.4.19.12) (Deubiquitinating enzyme 3) (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) | EBI-11611503 | 0.35 |
Q03780 | Uncharacterized protein YDR239C | EBI-11611503 | 0.35 |
Q06632 | Protein CFT1 (Cleavage factor two protein 1) | EBI-11611503 | 0.35 |
Q02336 | Transcriptional adapter 2 | EBI-11611503 | 0.35 |
P38165 | Retrograde regulation protein 3 | EBI-11611503 | 0.35 |
P47116 | Serine/threonine-protein kinase PTK2/STK2 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P38696 | Centractin (Actin-like protein) (Actin-related protein 1) | EBI-11611503 | 0.35 |
P53949 | Tyrosine-protein phosphatase-like protein OCA2 (Oxidant-induced cell-cycle arrest protein 2) | EBI-11611503 | 0.35 |
P38180 | Uncharacterized protein YBL081W | EBI-11611503 | 0.35 |
Q04712 | RNA polymerase I-specific transcription initiation factor RRN11 | EBI-11611503 | 0.35 |
P39731 | Kinetochore-associated protein MTW1 (Mis12-like protein) | EBI-11611503 | 0.35 |
P53270 | Uncharacterized protein YGR117C | EBI-11611503 | 0.35 |
P08018 | MAP kinase kinase PBS2 (EC 2.7.12.2) (Polymyxin B resistance protein 2) (Suppressor of fluoride sensitivity 4) | EBI-11611503 | 0.35 |
Q03769 | Epsin-5 | EBI-11611503 | 0.35 |
P40091 | Protein PEA2 (Protein PPF2) | EBI-11611503 | 0.35 |
P37838 | Nucleolar protein 4 (Nucleolar protein NOP77) | EBI-11611503 | 0.35 |
Q03735 | RNA-binding protein NAB6 (Nucleic acid-binding protein 6) | EBI-11611503 | 0.35 |
P29055 | Transcription initiation factor IIB (General transcription factor TFIIB) (Transcription factor E) | EBI-11611503 | 0.35 |
P38065 | AP-2 complex subunit alpha (Alpha-adaptin) (Clathrin assembly protein complex 2 alpha large chain) (Clathrin assembly protein large alpha chain) | EBI-11611503 | 0.35 |
P32047 | Protein MLF3 (Multicopy suppressor of leflunomide sensitivity 3) | EBI-11611503 | 0.35 |
P42841 | Polyadenylation factor subunit 2 | EBI-11611503 | 0.35 |
P53953 | SED5-binding protein 2 (SEC24-related protein 2) | EBI-11611503 | 0.35 |
P27476 | Nuclear localization sequence-binding protein (p67) | EBI-11611503 | 0.35 |
Q06132 | Suppressor of glycerol defect protein 1 | EBI-11611503 | 0.35 |
P21373 | NAD(+) kinase (EC 2.7.1.23) (Unknown transcript 1 protein) | EBI-11611503 | 0.35 |
Q03338 | U4/U6 small nuclear ribonucleoprotein PRP3 (Pre-mRNA-splicing factor 3) | EBI-11611503 | 0.35 |
P27692 | Transcription elongation factor SPT5 (Chromatin elongation factor SPT5) | EBI-11611503 | 0.35 |
P40693 | Ribosome biogenesis protein RLP7 (Ribosomal protein L7-like) | EBI-11611503 | 0.35 |
P09734 | Tubulin alpha-3 chain (EC 3.6.5.-) | EBI-11611503 | 0.35 |
Q07913 | Non-structural maintenance of chromosomes element 1 (Non-SMC element 1) (EC 2.3.2.27) | EBI-11611503 | 0.35 |
P06784 | Serine/threonine-protein kinase STE7 (EC 2.7.12.2) | EBI-11611503 | 0.35 |
P38129 | Transcription initiation factor TFIID subunit 5 (TAFII-90) (TBP-associated factor 5) (TBP-associated factor 90 kDa) | EBI-11611503 | 0.35 |
P53873 | Protein SWT21 (Synthetic With TGS1 protein 21) | EBI-11611503 | 0.35 |
Q12159 | RNA annealing protein YRA1 | EBI-11611503 | 0.35 |
P47048 | Uncharacterized protein YJL049W | EBI-11611503 | 0.35 |
Q02256 | Tyrosine-protein phosphatase YVH1 (PTPase YVH1) (EC 3.1.3.48) | EBI-11611503 | 0.35 |
P38798 | Nonsense-mediated mRNA decay protein 2 (Up-frameshift suppressor 2) | EBI-11611503 | 0.35 |
P25366 | Protein OCA4 (Oxidant-induced cell-cycle arrest protein 4) | EBI-11611503 | 0.35 |
Q12522 | Eukaryotic translation initiation factor 6 (eIF-6) | EBI-11611503 | 0.35 |
Q12176 | Ribosome biogenesis protein MAK21 (Maintenance of killer protein 21) (Nucleolar complex protein 1) | EBI-11611503 | 0.35 |
Q00539 | Protein NAM8 (Nuclear accommodation of mitochondria protein 8) (U1 snRNP component NAM8) | EBI-11611503 | 0.35 |
Q12136 | Something about silencing protein 10 (U three protein 3) (U3 small nucleolar RNA-associated protein 3) (U3 snoRNA-associated protein 11) | EBI-11611503 | 0.35 |
P46990 | 60S ribosomal protein L17-B (L20) (Large ribosomal subunit protein uL22-B) (YL17) | EBI-11611503 | 0.35 |
P40856 | SIT4-associating protein SAP185 | EBI-11611503 | 0.35 |
P38930 | Casein kinase II subunit beta' (CK II beta') | EBI-11611503 | 0.35 |
P04840 | Mitochondrial outer membrane protein porin 1 (Voltage-dependent anion-selective channel protein 1) (VDAC-1) | EBI-11611503 | 0.35 |
P14741 | Translation initiation factor eIF-2B subunit alpha (GCD complex subunit GCN3) (Guanine nucleotide exchange factor subunit GCN3) (Translational activator GCN3) (eIF-2B GDP-GTP exchange factor subunit alpha) | EBI-11611503 | 0.35 |
Q04410 | GRASP65 homolog protein 1 | EBI-11611503 | 0.35 |
P32523 | Pre-mRNA-processing factor 19 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase PRP19) | EBI-11611503 | 0.35 |
Q12504 | Ribosomal lysine N-methyltransferase 4 (EC 2.1.1.-) (SET domain-containing protein 7) | EBI-11611503 | 0.35 |
P29295 | Casein kinase I homolog HRR25 (EC 2.7.11.1) | EBI-11611503 | 0.35 |
P53742 | Nucleolar GTP-binding protein 2 | EBI-11611503 | 0.35 |
P38701 | 40S ribosomal protein S20 (Small ribosomal subunit protein uS10) | EBI-11611503 | 0.35 |
Q02959 | Histone deacetylase HOS3 (EC 3.5.1.98) | EBI-11611503 | 0.35 |
Q12523 | WD repeat-containing protein YPL247C | EBI-11611503 | 0.35 |
P40535 | ATF/CREB activator 2 (Chromosome stability protein CST6) | EBI-11611503 | 0.35 |
P34167 | Eukaryotic translation initiation factor 4B (eIF-4B) | EBI-11611503 | 0.35 |
Q02793 | Antiviral protein SKI8 (Superkiller protein 8) | EBI-11611503 | 0.35 |
P36076 | Coenzyme A biosynthesis protein 3 | EBI-11611503 | 0.35 |
Q07825 | Putative Xaa-Pro aminopeptidase FRA1 (EC 3.4.11.9) (Fe repressor of activation 1) | EBI-11611503 | 0.35 |
P53088 | Cytoplasmic tRNA 2-thiolation protein 1 (EC 2.7.7.-) (Cytoplasmic tRNA adenylyltransferase 1) (Needs CLA4 to survive protein 6) (Thiolation of uridine in cytoplasmic tRNA protein 1) | EBI-11611503 | 0.35 |
P45978 | Protein SCD6 (Suppressor of clathrin deficiency protein 6) | EBI-11611503 | 0.35 |
Q12094 | 18S rRNA aminocarboxypropyltransferase (EC 2.5.1.-) (20S rRNA accumulation protein 3) (ScTsr3) | EBI-11611503 | 0.35 |
Q12421 | Autophagy-related protein 31 (CIK1 suppressor protein 1) (Protein CIS1) | EBI-11611503 | 0.35 |
P06843 | Protein SPT2 (Negative regulator of Ty transcription) | EBI-11611503 | 0.35 |
P38738 | Oxidant-induced cell-cycle arrest protein 5 | EBI-11611503 | 0.35 |
P33400 | pH-response transcription factor pacC/RIM101 (Regulator of IME2 protein 1) (pH-response regulator protein RIM101) | EBI-11611503 | 0.35 |
P46675 | Protein STU2 (Suppressor of tubulin 2) | EBI-11611503 | 0.35 |
Q07532 | RNA polymerase II nuclear localization protein IWR1 (Interacting with RNA polymerase II protein 1) | EBI-11611503 | 0.35 |
Q08726 | GPN-loop GTPase 2 (EC 3.6.5.-) (ATP-binding domain 1 family member B homolog) | EBI-11611503 | 0.35 |
Q08217 | Serine/threonine-protein kinase PSK2 (EC 2.7.11.1) (PAS kinase 2) | EBI-11611503 | 0.35 |
P25635 | Periodic tryptophan protein 2 (U three protein 1) (U3 small nucleolar RNA-associated protein 1) (U3 snoRNA-associated protein 1) | EBI-11611503 | 0.35 |
P33442 | 40S ribosomal protein S1-A (RP10A) (Small ribosomal subunit protein eS1-A) | EBI-11611503 | 0.35 |
P38251 | Replication factor C subunit 5 (Replication factor C5) (Activator 1 40 kDa subunit) | EBI-11611503 | 0.35 |
P05750 | 40S ribosomal protein S3 (RP13) (Small ribosomal subunit protein uS3) (YS3) | EBI-11611503 | 0.35 |
Q06205 | FK506-binding protein 4 (EC 5.2.1.8) (Histone proline isomerase) (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) | EBI-11611503 | 0.35 |
P04803 | Tryptophan--tRNA ligase, mitochondrial (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) | EBI-11611503 | 0.35 |
P53238 | Peflin (Penta-EF hand domain-containing protein 1) | EBI-11611503 | 0.35 |
Q07844 | Ribosome biogenesis ATPase RIX7 | EBI-11611503 | 0.35 |
P39682 | Pre-mRNA-processing factor 39 | EBI-11611503 | 0.35 |
P39744 | Nucleolar complex protein 2 | EBI-11611503 | 0.35 |
P33201 | Ribosome assembly factor MRT4 (mRNA turnover protein 4) | EBI-11611503 | 0.35 |
P39969 | Protein BOI2 (Protein BEB1) | EBI-11611503 | 0.35 |
Q06337 | Chromatin modification-related protein EAF1 (ESA1-associated factor 1) (Vacuolar import and degradation protein 21) | EBI-11611503 | 0.35 |
P14680 | Dual specificity protein kinase YAK1 (EC 2.7.12.1) | EBI-11611503 | 0.35 |
P38061 | 60S ribosomal protein L32 (Large ribosomal subunit protein eL32) | EBI-11611503 | 0.35 |
Q04511 | Ubiquitin ligase complex F-box protein UFO1 | EBI-11611503 | 0.35 |
Q12216 | E3 SUMO-protein ligase SIZ2 (EC 2.3.2.-) (E3 SUMO-protein transferase SIZ2) (SAP and Miz-finger domain-containing protein 2) | EBI-11611503 | 0.35 |
Q07821 | Iron-sulfur assembly protein 1 | EBI-11611503 | 0.35 |
P38213 | Protein DSF2 (Deletion suppressor of MPT5 mutation protein 2) | EBI-11611503 | 0.35 |
P46682 | AP-3 complex subunit beta (Adaptor-related protein complex 3 subunit beta) (Beta-3-adaptin) (Clathrin assembly protein complex 3 beta large chain) (Clathrin assembly protein large beta chain) | EBI-11611503 | 0.35 |
P38153 | AP-3 complex subunit mu (AP-3 adaptor complex mu3A subunit) (Adaptor-related protein complex 3 subunit mu) (Mu-adaptin 3A) (Mu3-adaptin) | EBI-11611503 | 0.35 |
Q12092 | Autophagy-related protein 29 | EBI-11611503 | 0.35 |
P39729 | Ribosome-interacting GTPase 1 (GTP-binding protein RBG1) (Genetically interacts with ribosomal genes protein 1) | EBI-11611503 | 0.35 |
P41819 | Dimethyladenosine transferase (EC 2.1.1.183) (18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase) (18S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) | EBI-11611503 | 0.35 |
P42935 | Elongator complex protein 2 (Gamma-toxin target 2) | EBI-11611503 | 0.35 |
P47089 | Translation machinery-associated protein 22 (Density-regulated protein homolog) | EBI-11611503 | 0.35 |
P38805 | Ribosome production factor 1 (Ribosome biogenesis protein RPF1) | EBI-11611503 | 0.35 |
Q07533 | Cytokinesis protein 3 | EBI-11611503 | 0.35 |
P49960 | U4/U6 snRNA-associated-splicing factor PRP24 (U4/U6 snRNP protein) | EBI-11611503 | 0.35 |
P42843 | F-box protein SKP2 | EBI-11611503 | 0.35 |
P38316 | Ubiquitin-like protein ATG12 (Autophagy-related protein 12) | EBI-16263556 | 0.35 |
Q08273 | RING-box protein HRT1 (RING-box protein 1) (E3 ubiquitin-protein ligase complex SCF subunit HRT1) (High level expression reduces Ty3 transposition protein 1) (Regulator of cullins protein 1) | EBI-16271112 | 0.35 |
P40517 | Ran-specific GTPase-activating protein 2 (Ran-binding protein 2) (RANBP2) | EBI-16292729 | 0.35 |
Database | Links |
UNIPROT | P30822 D6VV01 |
PDB | 3M1I 3VYC 3WYF 3WYG 4GMX 4GPT 4HAT 4HAU 4HAV 4HAW 4HAX 4HAY 4HAZ 4HB0 4HB2 4HB3 4HB4 5DH9 5DHA 5DHF 5DI9 5DIF 5JLJ 5UWH 5UWI 5UWJ 5UWO 5UWP 5UWQ 5UWR 5UWS 5UWT 5UWU 5UWW 5XOJ 5YRO 5YST 5YSU 5YTB 5ZPU 6A38 6A3A 6A3B 6A3C 6A3E 6CIT 6KFT 6LQ9 6M60 6M6X 6X2M 6X2O 6X2P 6X2R 6X2S 6X2U 6X2V 6X2W 6X2X 6X2Y 6XJP 6XJR 6XJS 6XJT 6XJU 7CND 7DBG 7L5E |
Pfam | PF08767 PF18777 PF18784 PF18787 PF03810 PF08389 |
PROSITE | PS50166 |