Fragile X messenger ribonucleoprotein 1 - Mus musculus

Fragile X messenger ribonucleoprotein 1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Fragile X messenger ribonucleoprotein 1
Accession Code	P35922
Gene	Fmr1
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 614)
MEELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPERQIPFHDVRFPPPVGYNKDINESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKPATKDTFHKIK LEVPEDLRQMCAKESAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLILRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAIDLDEDTC TFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENEKSVPQEEEIMPPSSLPSNNSRVGPNSSEEKKHLDTKENTHFSQPNSTKVQRVLVVSSIVAGGPQKPE PKAWQGMVPFVFVGTKDSIANATVLLDYHLNYLKEVDQLRLERLQIDEQLRQIGASSRPPPNRTDKEKGYVTDDGQGMGRGSRPYRNRGHGRRGPGYTSGTNSEASNASETESDHRDELSDWSLAPTEEE RESFLRRGDGRRRRGGGRGQGGRGRGGGFKGNDDHSRTDNRPRNPREAKGRTADGSLQSASSEGSRLRTGKDRNQKKEKPDSVDGLQPLVNGVP

Subcellular Location

Description
Nucleus {Experimental EvidencePubMed:16908410, Experimental EvidencePubMed:8842725, Experimental EvidencePubMed:8895584}. Nucleus, nucleolus {By SimilarityUniProtKB:Q06787}. Chromosome, centromere {Experimental EvidencePubMed:24813610}. Chromosome {Experimental EvidencePubMed:24813610}. Cytoplasm {Experimental EvidencePubMed:11438699, Experimental EvidencePubMed:14570712, Experimental EvidencePubMed:15317853, Experimental EvidencePubMed:16790844, Experimental EvidencePubMed:24709664, Experimental EvidencePubMed:8895584}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:11438699, Experimental EvidencePubMed:16790844, Experimental EvidencePubMed:8842725, Experimental EvidencePubMed:9285783}. Cytoplasm, Cytoplasmic ribonucleoprotein granule {Experimental EvidencePubMed:15028757, Experimental EvidencePubMed:15312650, Experimental EvidencePubMed:15329415, Experimental EvidencePubMed:16098134, Experimental EvidencePubMed:18539120, Experimental EvidencePubMed:8842725, Experimental EvidencePubMed:9285783}. Cytoplasm, Stress granule {By SimilarityUniProtKB:Q06787}. Perikaryon {ECO:0000269\|PubMed:14613971, Experimental EvidencePubMed:16908410, ECO:0000269\|PubMed:18805096, ECO:0000269\|PubMed:19193898}. Cell projection, neuron projection {By SimilarityUniProtKB:Q06787}. Cell projection, axon {ECO:0000269\|PubMed:16631377, ECO:0000269\|PubMed:19193898}. Cell projection, dendrite {Experimental EvidencePubMed:15028757, ECO:0000269\|PubMed:16631377, Experimental EvidencePubMed:16908410, Experimental EvidencePubMed:18539120, ECO:0000269\|PubMed:18805096, ECO:0000269\|PubMed:19193898}. Cell projection, dendritic spine {Experimental EvidencePubMed:15028757, ECO:0000269\|PubMed:16631377}. Synapse, synaptosome {ECO:0000269\|PubMed:18805096}. Cell projection, filopodium {ECO:0000269\|PubMed:16631377}. Cell projection, growth cone {ECO:0000269\|PubMed:16631377}. Cell projection, filopodium tip {ECO:0000269\|PubMed:16631377}. Synapse {ECO:0000269\|PubMed:16631377}. Postsynaptic cell membrane {ECO:0000269\|PubMed:19193898}. Presynaptic cell membrane {ECO:0000269\|PubMed:19193898}. Cell membrane {Experimental EvidencePubMed:24709664}. Note=Colocalizes with H2AX/H2A.x in pericentromeric heterochromatin in response to DNA damaging agents (PubMed:24813610). Localizes on meiotic pachytene-stage chromosomes (PubMed:24813610). Forms nuclear foci representing sites of ongoing DNA replication in response to DNA damaging agents (PubMed:24813610). Shuttles between nucleus and cytoplasm in a XPO1/CRM1-dependent manner (PubMed:8895584, PubMed:8842725). Localizes to cytoplasmic granules, also referred to as messenger ribonucleoprotein particles or mRNPs, along dendrites and dendritic spines (PubMed:15028757, PubMed:16631377). FMR1-containing cytoplasmic granules colocalize to F- actin-rich structures, including filopodium, spines and growth cone during the development of hippocampal neurons (By similarity). FMR1- containing cytoplasmic granules are transported out of the soma along axon and dendrite to synaptic contacts in a microtubule- and kinesin- dependent manner (PubMed:15312650, PubMed:16098134, PubMed:18539120). Colocalizes with CACNA1B in the cytoplasm and at the cell membrane of neurons (PubMed:24709664). Colocalizes with CYFIP1, CYFIP2, NXF2 and ribosomes in the perinuclear region (PubMed:11438699, PubMed:16790844). Colocalizes with CYFIP1 and EIF4E in dendrites and probably at synapses (PubMed:18805096). Colocalizes with FXR1, kinesin, 60S acidic ribosomal protein RPLP0 and SMN in cytoplasmic granules in the soma and neurite cell processes (By similarity). Colocalizes with FXR1 and FXR2 in discrete granules, called fragile X granules (FXGs), along axon and presynaptic compartments (PubMed:19193898). Colocalizes with TDRD3 in cytoplasmic stress granules (SGs) in response to various cellular stress (By similarity). Interacts with SND1 (By similarity). {By SimilarityUniProtKB:Q06787, ECO:0000250\|UniProtKB:Q80WE1, Experimental EvidencePubMed:11438699, Experimental EvidencePubMed:15028757, Experimental EvidencePubMed:15312650, Experimental EvidencePubMed:16098134, ECO:0000269\|PubMed:16631377, Experimental EvidencePubMed:16790844, Experimental EvidencePubMed:18539120, ECO:0000269\|PubMed:18805096, ECO:0000269\|PubMed:19193898, Experimental EvidencePubMed:24709664, Experimental EvidencePubMed:24813610, Experimental EvidencePubMed:8842725, Experimental EvidencePubMed:8895584}. [Isoform 4]: Nucleus {Experimental EvidencePubMed:8842725}. Nucleus, nucleoplasm {Experimental EvidencePubMed:8842725}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Anchoring Junction (GO:0070161) Axon (GO:0030424) Axon Cytoplasm (GO:1904115) Axon Terminus (GO:0043679) Cajal Body (GO:0015030) Cell Body (GO:0044297) Cell Projection (GO:0042995) Chromocenter (GO:0010369) Chromosome (GO:0005694) Chromosome, Centromeric Region (GO:0000775) Cytoplasm (GO:0005737) Cytoplasmic Ribonucleoprotein Granule (GO:0036464) Cytoplasmic Stress Granule (GO:0010494) Cytosol (GO:0005829) Dendrite (GO:0030425) Dendritic Filopodium (GO:1902737) Dendritic Spine (GO:0043197) Dendritic Spine Head (GO:0044327) Dendritic Spine Neck (GO:0044326) Extrinsic Component Of Plasma Membrane (GO:0019897) Filopodium Tip (GO:0032433) Glial Cell Projection (GO:0097386) Glutamatergic Synapse (GO:0098978) Growth Cone (GO:0030426) Growth Cone Filopodium (GO:1990812) Hippocampal Mossy Fiber To CA3 Synapse (GO:0098686) Membrane (GO:0016020) Messenger Ribonucleoprotein Complex (GO:1990124) Microtubule Cytoskeleton (GO:0015630) MRNA Cap Binding Complex (GO:0005845) Neuron Projection (GO:0043005) Neuronal Cell Body (GO:0043025) Neuronal Ribonucleoprotein Granule (GO:0071598) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471) Polysome (GO:0005844) Postsynapse (GO:0098794) Postsynaptic Cytosol (GO:0099524) Postsynaptic Density (GO:0014069) Postsynaptic Membrane (GO:0045211) Presynapse (GO:0098793) Presynaptic Cytosol (GO:0099523) Presynaptic Membrane (GO:0042734) Proximal Dendrite (GO:1990635) Ribonucleoprotein Complex (GO:1990904) Rough Endoplasmic Reticulum (GO:0005791) Schaffer Collateral - CA1 Synapse (GO:0098685) SMN Complex (GO:0032797) Smooth Endoplasmic Reticulum (GO:0005790) Spine Apparatus (GO:0097444) Synapse (GO:0045202) Terminal Bouton (GO:0043195)

Biology & Function

Description
Multifunctional polyribosome-associated RNA-binding protein that plays a central role in neuronal development and synaptic plasticity through the regulation of alternative mRNA splicing, mRNA stability, mRNA dendritic transport and postsynaptic local protein synthesis of a subset of mRNAs (PubMed:11438589, PubMed:12032354, PubMed:15475576, PubMed:16631377, PubMed:16790844, PubMed:17417632, PubMed:17548835, PubMed:18539120, PubMed:18653529, PubMed:19640847, PubMed:19166269, PubMed:20159450, PubMed:21784246, PubMed:23235829, PubMed:24813610). Plays a role in the alternative splicing of its own mRNA (PubMed:18653529). Plays a role in mRNA nuclear export (PubMed:16790844). Together with export factor NXF2, is involved in the regulation of the NXF1 mRNA stability in neurons (PubMed:17548835). Stabilizes the scaffolding postsynaptic density protein DLG4/PSD-95 and the myelin basic protein MBP mRNAs in hippocampal neurons and glial cells, respectively; this stabilization is further increased in response to metabotropic glutamate receptor (mGluR) stimulation (PubMed:17417632). Plays a role in selective delivery of a subset of dendritic mRNAs to synaptic sites in response to mGluR activation in a kinesin-dependent manner (PubMed:18539120). Plays a role as a repressor of mRNA translation during the transport of dendritic mRNAs to postsynaptic dendritic spines (PubMed:11376146, PubMed:12581522, PubMed:14570712, PubMed:12927206, PubMed:15475576, PubMed:16908410, PubMed:18805096, PubMed:19640847, PubMed:21784246, PubMed:23235829). Component of the CYFIP1-EIF4E-FMR1 complex which blocks cap-dependent mRNA translation initiation (PubMed:18805096). Represses mRNA translation by stalling ribosomal translocation during elongation (PubMed:21784246). Reports are contradictory with regards to its ability to mediate translation inhibition of (MBP) mRNA in oligodendrocytes (PubMed:14613971, PubMed:23891804). Also involved in the recruitment of the RNA helicase MOV10 to a subset of mRNAs and hence regulates microRNA (miRNA)-mediated translational repression by AGO2 (PubMed:20159450, PubMed:25464849). Facilitates the assembly of miRNAs on specific target mRNAs (By similarity). Also plays a role as an activator of mRNA translation of a subset of dendritic mRNAs at synapses (PubMed:14614133, PubMed:14613971, PubMed:15548614, PubMed:19640847, PubMed:19166269, PubMed:21490210). In response to mGluR stimulation, FMR1-target mRNAs are rapidly derepressed, allowing for local translation at synapses (PubMed:16908410, PubMed:17507556, PubMed:19640847). Binds to a large subset of dendritic mRNAs that encode a myriad of proteins involved in pre- and postsynaptic functions (PubMed:11719188, PubMed:11376146, PubMed:14613971, PubMed:17507556, PubMed:21784246, PubMed:21490210, PubMed:24349419). Binds to 5'- ACU[GU]-3' and/or 5'-[AU]GGA-3' RNA consensus sequences within mRNA targets, mainly at coding sequence (CDS) and 3'-untranslated region (UTR) and less frequently at 5'-UTR (By similarity). Binds to intramolecular G-quadruplex structures in the 5'- or 3'-UTRs of mRNA targets (PubMed:25692235). Binds to G-quadruplex structures in the 3'- UTR of its own mRNA (By similarity). Binds also to RNA ligands harboring a kissing complex (kc) structure; this binding may mediate the association of FMR1 with polyribosomes (By similarity). Binds mRNAs containing U-rich target sequences (By similarity). Binds to a triple stem-loop RNA structure, called Sod1 stem loop interacting with FMRP (SoSLIP), in the 5'-UTR region of superoxide dismutase SOD1 mRNA (PubMed:19166269). Binds to the dendritic, small non-coding brain cytoplasmic RNA 1 (BC1); which may increase the association of the CYFIP1-EIF4E-FMR1 complex to FMR1 target mRNAs at synapses (PubMed:12581522, PubMed:18805096). Associates with export factor NXF1 mRNA-containing ribonucleoprotein particles (mRNPs) in a NXF2-dependent manner (PubMed:17548835). Binds to a subset of miRNAs in the brain (PubMed:20159450). May associate with nascent transcripts in a nuclear protein NXF1-dependent manner (By similarity). In vitro, binds to RNA homomer; preferentially on poly(G) and to a lesser extent on poly(U), but not on poly(A) or poly(C) (By similarity). Moreover, plays a role in the modulation of the sodium-activated potassium channel KCNT1 gating activity (PubMed:20512134). Negatively regulates the voltage- dependent calcium channel current density in soma and presynaptic terminals of dorsal root ganglion (DRG) neurons, and hence regulates synaptic vesicle exocytosis (By similarity). Modulates the voltage- dependent calcium channel CACNA1B expression at the plasma membrane by targeting the channels for proteosomal degradation (PubMed:24709664). Plays a role in regulation of MAP1B-dependent microtubule dynamics during neuronal development (PubMed:15475576). Recently, has been shown to play a translation-independent role in the modulation of presynaptic action potential (AP) duration and neurotransmitter release via large- conductance calcium-activated potassium (BK) channels in hippocampal and cortical excitatory neurons (PubMed:25561520). Finally, FMR1 may be involved in the control of DNA damage response (DDR) mechanisms through the regulation of ATR-dependent signaling pathways such as histone H2AX/H2A.x and BRCA1 phosphorylations (PubMed:24813610). {By SimilarityUniProtKB:Q06787, By SimilarityUniProtKB:Q80WE1, Experimental EvidencePubMed:11376146, Experimental EvidencePubMed:11438589, Experimental EvidencePubMed:11719188, Experimental EvidencePubMed:12032354, Experimental EvidencePubMed:12581522, Experimental EvidencePubMed:12927206, Experimental EvidencePubMed:14570712, Experimental EvidencePubMed:14613971, Experimental EvidencePubMed:14614133, Experimental EvidencePubMed:15475576, Experimental EvidencePubMed:15548614, Experimental EvidencePubMed:16631377, Experimental EvidencePubMed:16790844, Experimental EvidencePubMed:16908410, Experimental EvidencePubMed:17417632, Experimental EvidencePubMed:17507556, Experimental EvidencePubMed:17548835, Experimental EvidencePubMed:18539120, Experimental EvidencePubMed:18653529, Experimental EvidencePubMed:18805096, Experimental EvidencePubMed:19166269, Experimental EvidencePubMed:19640847, Experimental EvidencePubMed:20159450, Experimental EvidencePubMed:20512134, Experimental EvidencePubMed:21490210, Experimental EvidencePubMed:21784246, Experimental EvidencePubMed:23235829, Experimental EvidencePubMed:23891804, Experimental EvidencePubMed:24349419, Experimental EvidencePubMed:24709664, Experimental EvidencePubMed:24813610, Experimental EvidencePubMed:25561520, Experimental EvidencePubMed:25692235}.
Assigned Ontology terms

Biological Process	Anterograde Axonal Transport (GO:0008089) Cellular Response To Virus (GO:0098586) Central Nervous System Development (GO:0007417) Dendritic Spine Development (GO:0060996) DNA Repair (GO:0006281) Excitatory Chemical Synaptic Transmission (GO:0098976) RNA-Mediated Gene Silencing (GO:0031047) Glutamate Receptor Signaling Pathway (GO:0007215) Inhibitory Chemical Synaptic Transmission (GO:0098977) Modulation By Host Of Viral RNA Genome Replication (GO:0044830) MRNA Processing (GO:0006397) MRNA Transport (GO:0051028) Negative Regulation Of Cytoplasmic Translation (GO:2000766) Negative Regulation Of Gene Expression (GO:0010629) Negative Regulation Of Long-Term Synaptic Depression (GO:1900453) Negative Regulation Of MRNA Catabolic Process (GO:1902373) Negative Regulation Of Neuron Apoptotic Process (GO:0043524) Negative Regulation Of Neuron Differentiation (GO:0045665) Negative Regulation Of Protein Processing (GO:0010955) Negative Regulation Of Receptor Internalization (GO:0002091) Negative Regulation Of Synaptic Vesicle Exocytosis (GO:2000301) Negative Regulation Of Translation (GO:0017148) Negative Regulation Of Translational Initiation (GO:0045947) Negative Regulation Of Voltage-Gated Calcium Channel Activity (GO:1901386) Positive Regulation Of Dendritic Spine Development (GO:0060999) Positive Regulation Of Filopodium Assembly (GO:0051491) Positive Regulation Of Gene Expression (GO:0010628) Positive Regulation Of Intracellular Transport Of Viral Material (GO:1901254) Positive Regulation Of Long-Term Neuronal Synaptic Plasticity (GO:0048170) Positive Regulation Of Long-Term Synaptic Depression (GO:1900454) Positive Regulation Of Long-Term Synaptic Potentiation (GO:1900273) Positive Regulation Of MiRNA-Mediated Gene Silencing (GO:2000637) Positive Regulation Of MRNA Binding (GO:1902416) Positive Regulation Of Proteasomal Protein Catabolic Process (GO:1901800) Positive Regulation Of Protein Phosphorylation (GO:0001934) Positive Regulation Of Receptor Internalization (GO:0002092) Positive Regulation Of Response To DNA Damage Stimulus (GO:2001022) Positive Regulation Of Synaptic Transmission (GO:0050806) Positive Regulation Of Translation (GO:0045727) Regulation Of Alternative MRNA Splicing, Via Spliceosome (GO:0000381) Regulation Of Dendritic Spine Development (GO:0060998) Regulation Of Filopodium Assembly (GO:0051489) Regulation Of MiRNA-Mediated Gene Silencing (GO:0060964) Regulation Of Modification Of Synaptic Structure (GO:1905244) Regulation Of MRNA Stability (GO:0043488) Regulation Of Neuronal Action Potential (GO:0098908) Regulation Of Neurotransmitter Secretion (GO:0046928) Regulation Of Translation At Postsynapse, Modulating Synaptic Transmission (GO:0099578) Regulation Of Translation At Presynapse, Modulating Synaptic Transmission (GO:0099577) Response To Interleukin-17 (GO:0097396) RNA Splicing (GO:0008380) Social Behavior (GO:0035176) Transmission Of Nerve Impulse (GO:0019226)
Molecular Function	Chromatin Binding (GO:0003682) Dynein Complex Binding (GO:0070840) G-Quadruplex RNA Binding (GO:0002151) Identical Protein Binding (GO:0042802) Methylated Histone Binding (GO:0035064) Microtubule Binding (GO:0008017) MiRNA Binding (GO:0035198) MRNA 3'-UTR Binding (GO:0003730) MRNA 5'-UTR Binding (GO:0048027) MRNA Binding (GO:0003729) Poly(G) Binding (GO:0034046) Poly(U) RNA Binding (GO:0008266) Protein Domain Specific Binding (GO:0019904) Protein Heterodimerization Activity (GO:0046982) Protein Homodimerization Activity (GO:0042803) Protein Kinase Binding (GO:0019901) Protein Phosphatase Binding (GO:0019903) Ribosome Binding (GO:0043022) RNA 7-Methylguanosine Cap Binding (GO:0000340) RNA Binding (GO:0003723) RNA Stem-Loop Binding (GO:0035613) RNA Strand Annealing Activity (GO:0033592) Sequence-Specific MRNA Binding (GO:1990825) SiRNA Binding (GO:0035197) Translation Initiation Factor Binding (GO:0031369) Translation Regulator Activity (GO:0045182) Translation Repressor Activity (GO:0030371) Transmembrane Transporter Binding (GO:0044325)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (12 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P33175	Kinesin heavy chain isoform 5A	EBI-16728828	0.35
Q8CHG7	Rap guanine nucleotide exchange factor 2	EBI-16728828	0.35
P46061	Ran GTPase-activating protein 1	EBI-16728828	0.35
Q9ERU9	E3 SUMO-protein ligase RanBP2	EBI-16728828	0.35
P70168	Importin subunit beta-1	EBI-16728828	0.35
P63318	Protein kinase C gamma type	EBI-16728828	0.35
Q9Z1K7	Adenomatous polyposis coli protein 2	EBI-16728828	0.35
P61205	ADP-ribosylation factor 3	EBI-16728828	0.35
Q8K3W3	Protein CASC3	EBI-16728828	0.35
Q7TMB8	Cytoplasmic FMR1-interacting protein 1	EBI-2000004	0.58
Q5SQX6	Cytoplasmic FMR1-interacting protein 2	EBI-16727864	0.35
Q05BC3	Echinoderm microtubule-associated protein-like 1	EBI-16728828	0.35
Interactions with other proteins (230 interactors)

Partner (UniProt)		IntAct	Confidence score
Q61584	RNA-binding protein FXR1 (mFxr1p)	EBI-8598304	0.56
P26323	Friend leukemia integration 1 transcription factor (Retroviral integration site protein Fli-1)	EBI-653886	0.37
P63073	Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (mRNA cap-binding protein) (eIF-4F 25 kDa subunit)	EBI-2000515	0.43
P49452	Centromere protein C (CENP-C) (Centromere autoantigen C) (Centromere protein C 1) (CENP-C 1)	EBI-8573213	0.35
Q9JHG6	Calcipressin-1 (Down syndrome critical region protein 1 homolog) (Myocyte-enriched calcineurin-interacting protein 1) (MCIP1) (Regulator of calcineurin 1)	EBI-8014106	0.47
P52927	High mobility group protein HMGI-C (High mobility group AT-hook protein 2)	EBI-9986179	0.35
Q7TPH6	E3 ubiquitin-protein ligase MYCBP2 (EC 2.3.2.33) (Myc-binding protein 2) (Pam/highwire/rpm-1 protein) (Protein Magellan) (Protein associated with Myc)	EBI-16728828	0.35
Q9Z2D8	Methyl-CpG-binding domain protein 3 (Methyl-CpG-binding protein MBD3)	EBI-16728828	0.35
Q8CJG0	Protein argonaute-2 (Argonaute2) (mAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF-2C 2) (eIF2C 2) (Piwi/argonaute family protein meIF2C2) (Protein slicer)	EBI-16728828	0.35
Q6PDG5	SWI/SNF complex subunit SMARCC2 (BRG1-associated factor 170) (BAF170) (SWI/SNF complex 170 kDa subunit) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2)	EBI-16728828	0.35
P62996	Transformer-2 protein homolog beta (TRA-2 beta) (TRA2-beta) (Silica-induced gene 41 protein) (SIG-41) (Splicing factor, arginine/serine-rich 10) (Transformer-2 protein homolog B)	EBI-16728828	0.35
Q9EPQ8	Transcription factor 20 (TCF-20) (Nuclear factor SPBP) (Stromelysin-1 PDGF-responsive element-binding protein) (SPRE-binding protein)	EBI-16728828	0.35
Q80YR5	Scaffold attachment factor B2 (SAF-B2)	EBI-16728828	0.35
Q6RHR9	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (BAI1-associated protein 1) (BAP-1) (Membrane-associated guanylate kinase inverted 1) (MAGI-1)	EBI-16728828	0.35
P97379	Ras GTPase-activating protein-binding protein 2 (G3BP-2) (GAP SH3 domain-binding protein 2)	EBI-16728828	0.35
O35218	Cleavage and polyadenylation specificity factor subunit 2 (Cleavage and polyadenylation specificity factor 100 kDa subunit) (CPSF 100 kDa subunit)	EBI-16728828	0.35
Q9JIY2	E3 ubiquitin-protein ligase Hakai (EC 2.3.2.27) (Casitas B-lineage lymphoma-transforming sequence-like protein 1) (c-Cbl-like protein 1) (E-cadherin binding protein E7) (RING-type E3 ubiquitin transferase Hakai)	EBI-16728828	0.35
P53995	Anaphase-promoting complex subunit 1 (APC1) (Cyclosome subunit 1) (Mitotic checkpoint regulator) (Testis-specific gene 24 protein)	EBI-16728828	0.35
P83510	Traf2 and NCK-interacting protein kinase (EC 2.7.11.1)	EBI-16728828	0.35
Q8R151	NFX1-type zinc finger-containing protein 1	EBI-16728828	0.35
Q7TQJ8	Wilms tumor protein 1-interacting protein (WT1-interacting protein)	EBI-16728828	0.35
Q8CGF6	WD repeat-containing protein 47 (Neuronal enriched MAP interacting protein) (Nemitin)	EBI-16728828	0.35
P52479	Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10)	EBI-16728828	0.35
Q91VX2	Ubiquitin-associated protein 2 (UBAP-2) (Protein lingerer homolog 1) (mLig-1)	EBI-16728828	0.35
Q91W18	Tudor domain-containing protein 3	EBI-16728828	0.35
P80560	Receptor-type tyrosine-protein phosphatase N2 (R-PTP-N2) (EC 3.1.3.-) (EC 3.1.3.48) (PTP IA-2beta) (Phogrin) (Protein tyrosine phosphatase-NP) (PTP-NP) [Cleaved into: IA-2beta71; IA-2beta64; IA-2beta60]	EBI-16728828	0.35
Q3V1L4	Cytosolic purine 5'-nucleotidase (EC 3.1.3.5) (EC 3.1.3.99) (Cytosolic nucleoside phosphotransferase 5'N) (EC 2.7.1.77)	EBI-16728828	0.35
Q8R4U7	Leucine zipper protein 1 (Leucine zipper motif-containing protein)	EBI-16728828	0.35
Q6Y7W8	GRB10-interacting GYF protein 2 (PERQ amino acid-rich with GYF domain-containing protein 2) (Trinucleotide repeat-containing gene 15 protein)	EBI-16728828	0.35
Q9WVR4	RNA-binding protein FXR2	EBI-16728828	0.35
Q6A0A9	Constitutive coactivator of PPAR-gamma-like protein 1 (Oxidative stress-associated Src activator) (Protein FAM120A)	EBI-16728828	0.35
Q61701	ELAV-like protein 4 (Hu-antigen D) (HuD) (Paraneoplastic encephalomyelitis antigen HuD)	EBI-16728828	0.35
Q60900	ELAV-like protein 3 (Hu-antigen C) (HuC)	EBI-16728828	0.35
Q60899	ELAV-like protein 2 (ELAV-like neuronal protein 1) (Hu-antigen B) (HuB) (Nervous system-specific RNA-binding protein Mel-N1)	EBI-16728828	0.35
Q6NZJ6	Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G 1) (eIF-4G1)	EBI-16728828	0.35
Q8C008	Double zinc ribbon and ankyrin repeat-containing protein 1	EBI-16728828	0.35
O70305	Ataxin-2 (Spinocerebellar ataxia type 2 protein homolog)	EBI-16728828	0.35
Q61315	Adenomatous polyposis coli protein (Protein APC) (mAPC)	EBI-16728828	0.35
Q9Z1D7	Zinc finger and SCAN domain-containing protein 12 (Zinc finger protein 96) (Zfp-96)	EBI-16728828	0.35
Q6IQX8	Zinc finger protein 219	EBI-16728828	0.35
Q91VL9	Zinc finger and BTB domain-containing protein 1	EBI-16728828	0.35
Q5I043	Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.4.19.12) (Deubiquitinating enzyme 28) (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28)	EBI-16728828	0.35
A2AN08	E3 ubiquitin-protein ligase UBR4 (EC 2.3.2.27) (N-recognin-4) (RING-type E3 ubiquitin transferase UBR4) (Zinc finger UBR1-type protein 1) (p600)	EBI-16728828	0.35
P70399	TP53-binding protein 1 (53BP1) (p53-binding protein 1) (p53BP1)	EBI-16728828	0.35
Q569Z6	Thyroid hormone receptor-associated protein 3 (Thyroid hormone receptor-associated protein complex 150 kDa component) (Trap150)	EBI-16728828	0.35
Q8BHJ5	F-box-like/WD repeat-containing protein TBL1XR1 (Nuclear receptor corepressor/HDAC3 complex subunit TBLR1) (TBL1-related protein 1) (Transducin beta-like 1X-related protein 1)	EBI-16728828	0.35
Q920B9	FACT complex subunit SPT16 (Chromatin-specific transcription elongation factor 140 kDa subunit) (FACT 140 kDa subunit) (FACTp140) (Facilitates chromatin transcription complex subunit SPT16)	EBI-16728828	0.35
Q8C804	Spindle and centriole-associated protein 1 (Coiled-coil domain-containing protein 52)	EBI-16728828	0.35
E1U8D0	Protein SOGA1 (SOGA family member 1) (Suppressor of glucose by autophagy) (Suppressor of glucose, autophagy-associated protein 1) [Cleaved into: N-terminal form; C-terminal 80 kDa form (80-kDa SOGA fragment)]	EBI-16728828	0.35
P61406	Telomerase-binding protein EST1A (EC 3.1.-.-) (Ever shorter telomeres 1A) (Nonsense mediated mRNA decay factor SMG6) (Smg-6 homolog)	EBI-16728828	0.35
Q3TKT4	Transcription activator BRG1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA4) (BRG1-associated factor 190A) (BAF190A) (Protein brahma homolog 1) (SNF2-beta) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4)	EBI-16728828	0.35
Q62141	Paired amphipathic helix protein Sin3b (Histone deacetylase complex subunit Sin3b) (Transcriptional corepressor Sin3b)	EBI-16728828	0.35
Q80U72	Protein scribble homolog (Scribble) (Protein LAP4)	EBI-16728828	0.35
Q9JIF0	Protein arginine N-methyltransferase 1 (EC 2.1.1.319) (Histone-arginine N-methyltransferase PRMT1)	EBI-16728828	0.35
P62137	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)	EBI-16728828	0.35
Q9R0L6	Pericentriolar material 1 protein (PCM-1) (mPCM-1)	EBI-16728828	0.35
P60335	Poly(rC)-binding protein 1 (Alpha-CP1) (Heterogeneous nuclear ribonucleoprotein E1) (hnRNP E1)	EBI-16728828	0.35
Q8BSQ9	Protein polybromo-1 (BRG1-associated factor 180) (BAF180)	EBI-16728828	0.35
Q99NH2	Partitioning defective 3 homolog (PAR-3) (PARD-3) (Atypical PKC isotype-specific-interacting protein) (ASIP) (Ephrin-interacting protein) (PHIP)	EBI-16728828	0.35
Q8C015	Serine/threonine-protein kinase PAK 5 (EC 2.7.11.1) (p21-activated kinase 5) (PAK-5) (p21-activated kinase 7) (PAK-7)	EBI-16728828	0.35
B2RRE7	OTU domain-containing protein 4 (EC 3.4.19.12)	EBI-16728828	0.35
E9Q7G0	Nuclear mitotic apparatus protein 1 (Nuclear mitotic apparatus protein) (NuMA protein)	EBI-16728828	0.35
Q5F2E7	FMR1-interacting protein NUFIP2 (82 kDa FMRP-interacting protein) (82-FIP) (FMRP-interacting protein 2)	EBI-16728828	0.35
Q9D6T0	Nitric oxide synthase-interacting protein (E3 ubiquitin-protein ligase NOSIP) (EC 2.3.2.27) (RING-type E3 ubiquitin transferase NOSIP)	EBI-16728828	0.35
Q80TM9	Nischarin (Imidazoline receptor 1) (I-1) (IR1) (Imidazoline receptor I-1-like protein) (Imidazoline-1 receptor) (I1R)	EBI-16728828	0.35
Q6KCD5	Nipped-B-like protein (Delangin homolog) (SCC2 homolog)	EBI-16728828	0.35
P46935	E3 ubiquitin-protein ligase NEDD4 (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase NEDD4) (Neural precursor cell expressed developmentally down-regulated protein 4) (NEDD-4)	EBI-16728828	0.35
Q61026	Nuclear receptor coactivator 2 (NCoA-2) (Glucocorticoid receptor-interacting protein 1) (GRIP-1) (Steroid receptor coactivator 2) (SRC-2) (Transcriptional intermediary factor 2)	EBI-16728828	0.35
P09405	Nucleolin (Protein C23)	EBI-16728828	0.35
Q9EPN1	Neurobeachin (Lysosomal-trafficking regulator 2)	EBI-16728828	0.35
Q69ZK1	MKIAA1413 protein	EBI-16728828	0.35
P60762	Mortality factor 4-like protein 1 (MORF-related gene 15 protein) (Testis-expressed gene 189 protein) (Transcription factor-like protein MRG15)	EBI-16728828	0.35
P97820	Mitogen-activated protein kinase kinase kinase kinase 4 (EC 2.7.11.1) (HPK/GCK-like kinase HGK) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (Nck-interacting kinase)	EBI-16728828	0.35
Q9QYH6	Melanoma-associated antigen D1 (Dlxin-1) (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog)	EBI-16728828	0.35
Q9QXZ0	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4 (Actin cross-linking family 7)	EBI-16728828	0.35
Q3UMG5	Leucine-rich repeat and calponin homology domain-containing protein 2	EBI-16728828	0.35
Q5XJV6	Serine/threonine-protein kinase LMTK3 (EC 2.7.11.1) (Apoptosis-associated tyrosine kinase 3) (Lemur tyrosine kinase 3)	EBI-16728828	0.35
Q9QXL1	Kinesin-like protein KIF21B (Kinesin-like protein KIF6)	EBI-16728828	0.35
A2AIV2	Protein virilizer homolog	EBI-16728828	0.35
Q6ZQ88	Lysine-specific histone demethylase 1A (EC 1.14.99.66) (BRAF35-HDAC complex protein BHC110) (Flavin-containing amine oxidase domain-containing protein 2)	EBI-16728828	0.35
Q99JP6	Homer protein homolog 3 (Homer-3)	EBI-16728828	0.35
Q4U2R1	E3 ubiquitin-protein ligase HERC2 (EC 2.3.2.26) (HECT domain and RCC1-like domain-containing protein 2) (HECT-type E3 ubiquitin transferase HERC2)	EBI-16728828	0.35
P70288	Histone deacetylase 2 (HD2) (EC 3.5.1.98) (Protein deacylase HDAC2) (EC 3.5.1.-) (YY1 transcription factor-binding protein)	EBI-16728828	0.35
Q9QZQ8	Core histone macro-H2A.1 (Histone macroH2A1) (mH2A1) (H2A.y) (H2A/y)	EBI-16728828	0.35
Q9WV60	Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)	EBI-16728828	0.35
Q61545	RNA-binding protein EWS	EBI-16728828	0.35
P84089	Enhancer of rudimentary homolog (Mer)	EBI-16728828	0.35
Q8BMB0	BRCA2-interacting transcriptional repressor EMSY	EBI-16728828	0.35
Q9Z148	Histone-lysine N-methyltransferase EHMT2 (EC 2.1.1.-) (EC 2.1.1.367) (Euchromatic histone-lysine N-methyltransferase 2) (HLA-B-associated transcript 8) (Histone H3-K9 methyltransferase 3) (H3-K9-HMTase 3) (Protein G9a)	EBI-16728828	0.35
Q3UJB9	Enhancer of mRNA-decapping protein 4	EBI-16728828	0.35
Q60838	Segment polarity protein dishevelled homolog DVL-2 (Dishevelled-2) (DSH homolog 2)	EBI-16728828	0.35
Q8R1A4	Dedicator of cytokinesis protein 7 (Protein moonlight)	EBI-16728828	0.35
P13864	DNA (cytosine-5)-methyltransferase 1 (Dnmt1) (Met-1) (EC 2.1.1.37) (DNA methyltransferase MmuI) (DNA MTase MmuI) (M.MmuI) (MCMT)	EBI-16728828	0.35
Q80Y83	Dixin (Coiled-coil protein DIX1) (Coiled-coil-DIX1) (DIX domain-containing protein 1)	EBI-16728828	0.35
Q62167	ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (D1Pas1-related sequence 2) (DEAD box RNA helicase DEAD3) (mDEAD3) (DEAD box protein 3, X-chromosomal) (Embryonic RNA helicase)	EBI-16728828	0.35
O54833	Casein kinase II subunit alpha' (CK II alpha') (EC 2.7.11.1)	EBI-16728828	0.35
Q60737	Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1)	EBI-16728828	0.35
Q80TV8	CLIP-associating protein 1 (Cytoplasmic linker-associated protein 1)	EBI-16728828	0.35
A2AJK6	Chromodomain-helicase-DNA-binding protein 7 (CHD-7) (EC 3.6.4.12) (ATP-dependent helicase CHD7)	EBI-16728828	0.35
Q6PDQ2	Chromodomain-helicase-DNA-binding protein 4 (CHD-4) (EC 3.6.4.12)	EBI-16728828	0.35
Q8K389	CDK5 regulatory subunit-associated protein 2 (CDK5 activator-binding protein C48)	EBI-16728828	0.35
Q6A068	Cell division cycle 5-like protein (Cdc5-like protein)	EBI-16728828	0.35
Q8VDP4	Cell cycle and apoptosis regulator protein 2 (Cell division cycle and apoptosis regulator protein 2)	EBI-16728828	0.35
P23198	Chromobox protein homolog 3 (Heterochromatin protein 1 homolog gamma) (HP1 gamma) (M32) (Modifier 2 protein)	EBI-16728828	0.35
Q99PV8	B-cell lymphoma/leukemia 11B (BCL-11B) (B-cell CLL/lymphoma 11B) (COUP-TF-interacting protein 2) (Radiation-induced tumor suppressor gene 1 protein) (mRit1)	EBI-16728828	0.35
Q9QYE3	B-cell lymphoma/leukemia 11A (BCL-11A) (B-cell CLL/lymphoma 11A) (COUP-TF-interacting protein 1) (Ecotropic viral integration site 9 protein) (EVI-9)	EBI-16728828	0.35
Q70FJ1	A-kinase anchor protein 9 (AKAP-9) (Protein kinase A-anchoring protein 9) (PRKA9)	EBI-16728828	0.35
Q9DBR0	A-kinase anchor protein 8 (AKAP-8) (A-kinase anchor protein 95 kDa) (AKAP 95)	EBI-16728828	0.35
P61164	Alpha-centractin (Centractin) (ARP1) (Actin-RPV) (Centrosome-associated actin homolog)	EBI-16728828	0.35
F6SEU4	Ras/Rap GTPase-activating protein SynGAP (Neuronal RasGAP) (Synaptic Ras GTPase-activating protein 1) (Synaptic Ras-GAP 1)	EBI-16728828	0.35
Q4ACU6	SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2) (SPANK-2)	EBI-16728828	0.35
Q5DU25	IQ motif and SEC7 domain-containing protein 2	EBI-16728828	0.35
Q68FF6	ARF GTPase-activating protein GIT1 (ARF GAP GIT1) (G protein-coupled receptor kinase-interactor 1) (GRK-interacting protein 1)	EBI-16728828	0.35
Q6PFD5	Disks large-associated protein 3 (DAP-3) (PSD-95/SAP90-binding protein 3) (SAP90/PSD-95-associated protein 3) (SAPAP3)	EBI-16728828	0.35
Q62108	Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90)	EBI-16728828	0.35
Q91XM9	Disks large homolog 2 (Channel-associated protein of synapse-110) (Chapsyn-110) (Postsynaptic density protein PSD-93)	EBI-16728828	0.35
Q811D0	Disks large homolog 1 (Embryo-dlg/synapse-associated protein 97) (E-dlg/SAP97) (Synapse-associated protein 97) (SAP-97) (SAP97)	EBI-16728828	0.35
A2AGT5	Cytoskeleton-associated protein 5	EBI-16728828	0.35
O88737	Protein bassoon	EBI-16728828	0.35
Q8BGS3	Zinc finger protein with KRAB and SCAN domains 1	EBI-16728828	0.35
O88532	Zinc finger RNA-binding protein	EBI-16728828	0.35
Q8BJH1	Zinc finger C2HC domain-containing protein 1A	EBI-16728828	0.35
Q6VNB8	WD repeat and FYVE domain-containing protein 3 (Beach domain, WD repeat and FYVE domain-containing protein 1) (BWF1)	EBI-16728828	0.35
P70398	Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC 3.4.19.12) (Deubiquitinating enzyme FAF-X) (Fat facets homolog) (Fat facets protein-related, X-linked) (Ubiquitin carboxyl-terminal hydrolase FAM) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific protease 9, X chromosome) (Ubiquitin-specific-processing protease FAF-X)	EBI-16728828	0.35
A2RSJ4	UHRF1-binding protein 1-like (Syntaxin-6 Habc-interacting protein of 164 kDa)	EBI-16728828	0.35
Q80X50	Ubiquitin-associated protein 2-like	EBI-16728828	0.35
Q9R1R2	Tripartite motif-containing protein 3 (RING finger protein 22) (RING finger protein HAC1)	EBI-16728828	0.35
Q62318	Transcription intermediary factor 1-beta (TIF1-beta) (E3 SUMO-protein ligase TRIM28) (EC 2.3.2.27) (KRAB-A-interacting protein) (KRIP-1) (RING-type E3 ubiquitin transferase TIF1-beta) (Tripartite motif-containing protein 28)	EBI-16728828	0.35
Q9Z321	DNA topoisomerase 3-beta-1 (EC 5.6.2.1) (DNA topoisomerase III beta-1)	EBI-16728828	0.35
E9Q0S6	Tensin 1	EBI-16728828	0.35
Q8BKI2	Trinucleotide repeat-containing gene 6B protein	EBI-16728828	0.35
Q8BYI9	Tenascin-R (TN-R) (Janusin) (Neural recognition molecule J1-160/180) (Restrictin)	EBI-16728828	0.35
P39447	Tight junction protein ZO-1 (Tight junction protein 1) (Zona occludens protein 1) (Zonula occludens protein 1)	EBI-16728828	0.35
Q9QXE7	F-box-like/WD repeat-containing protein TBL1X (Transducin beta-like protein 1X)	EBI-16728828	0.35
Q60864	Stress-induced-phosphoprotein 1 (STI1) (mSTI1) (Hsc70/Hsp90-organizing protein) (Hop)	EBI-16728828	0.35
P56873	Protein ZNRD2 (Autoantigen p27 homolog) (Protein C184L) (Sjoegren syndrome/scleroderma autoantigen 1 homolog) (Zinc ribbon domain-containing protein 2)	EBI-16728828	0.35
O54781	SRSF protein kinase 2 (EC 2.7.11.1) (SFRS protein kinase 2) (Serine/arginine-rich protein-specific kinase 2) (SR-protein-specific kinase 2) [Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal]	EBI-16728828	0.35
Q62261	Spectrin beta chain, non-erythrocytic 1 (Beta-II spectrin) (Embryonic liver fodrin) (Fodrin beta chain)	EBI-16728828	0.35
Q6NZL0	Protein SOGA3	EBI-16728828	0.35
Q3UHU5	Microtubule cross-linking factor 1 (Coiled-coil domain-containing protein 165) (PAR-1-interacting protein) (SOGA family member 2)	EBI-16728828	0.35
A2AQ25	Sickle tail protein (Enhancer trap locus 4)	EBI-16728828	0.35
Q6P4S6	Serine/threonine-protein kinase SIK3 (EC 2.7.11.1) (Salt-inducible kinase 3) (SIK-3) (Serine/threonine-protein kinase QSK)	EBI-16728828	0.35
P58801	Receptor-interacting serine/threonine-protein kinase 2 (EC 2.7.11.1) (Tyrosine-protein kinase RIPK2) (EC 2.7.10.2)	EBI-16728828	0.35
P69566	Ran-binding protein 9 (RanBP9) (B-cell antigen receptor Ig beta-associated protein 1) (IBAP-1) (Ran-binding protein M) (RanBPM)	EBI-16728828	0.35
P70388	DNA repair protein RAD50 (mRad50) (EC 3.6.-.-)	EBI-16728828	0.35
O35295	Transcriptional activator protein Pur-beta (Purine-rich element-binding protein B) (Vascular actin single-stranded DNA-binding factor 2 p44 component)	EBI-16728828	0.35
P42669	Transcriptional activator protein Pur-alpha (Purine-rich single-stranded DNA-binding protein alpha)	EBI-16728828	0.35
Q3TLH4	Protein PRRC2C (BAT2 domain-containing protein 1) (HLA-B-associated transcript 2-like 2) (Proline-rich and coiled-coil-containing protein 2C)	EBI-16728828	0.35
Q7TPM1	Protein PRRC2B (HLA-B-associated transcript 2-like 1) (Proline-rich coiled-coil protein 2B)	EBI-16728828	0.35
Q7TSC1	Protein PRRC2A (HLA-B-associated transcript 2) (Proline-rich and coiled-coil-containing protein 2A)	EBI-16728828	0.35
Q62101	Serine/threonine-protein kinase D1 (EC 2.7.11.13) (Protein kinase C mu type) (Protein kinase D) (nPKC-D1) (nPKC-mu)	EBI-16728828	0.35
P68404	Protein kinase C beta type (PKC-B) (PKC-beta) (EC 2.7.11.13)	EBI-16728828	0.35
Q76MZ3	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (PP2A subunit A isoform PR65-alpha) (PP2A subunit A isoform R1-alpha)	EBI-16728828	0.35
Q68FH0	Plakophilin-4 (Armadillo-related protein)	EBI-16728828	0.35
Q922S4	cGMP-dependent 3',5'-cyclic phosphodiesterase (EC 3.1.4.17) (Cyclic GMP-stimulated phosphodiesterase) (CGS-PDE) (cGSPDE)	EBI-16728828	0.35
P48725	Pericentrin	EBI-16728828	0.35
O08919	Numb-like protein	EBI-16728828	0.35
P46460	Vesicle-fusing ATPase (EC 3.6.4.6) (N-ethylmaleimide-sensitive fusion protein) (NEM-sensitive fusion protein) (Suppressor of K(+) transport growth defect 2) (Protein SKD2) (Vesicular-fusion protein NSF)	EBI-16728828	0.35
P08551	Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein)	EBI-16728828	0.35
Q9WU42	Nuclear receptor corepressor 2 (N-CoR2) (Silencing mediator of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (T3 receptor-associating factor) (TRAC) (Thyroid-, retinoic-acid-receptor-associated corepressor)	EBI-16728828	0.35
Q60974	Nuclear receptor corepressor 1 (N-CoR) (N-CoR1) (Retinoid X receptor-interacting protein 13) (RIP13)	EBI-16728828	0.35
O09000	Nuclear receptor coactivator 3 (NCoA-3) (EC 2.3.1.48) (Amplified in breast cancer-1 protein homolog) (AIB-1) (CBP-interacting protein) (p/CIP) (pCIP) (Receptor-associated coactivator 3) (RAC-3) (Steroid receptor coactivator protein 3) (SRC-3) (Thyroid hormone receptor activator molecule 1) (ACTR) (TRAM-1)	EBI-16728828	0.35
P28660	Nck-associated protein 1 (NAP 1) (Brain protein H19) (MH19) (Membrane-associated protein HEM-2) (p125Nap1)	EBI-16728828	0.35
Q8VE19	GATOR complex protein MIOS	EBI-16728828	0.35
E9PWI3	Mutated in colorectal cancers	EBI-16728828	0.35
Q8K310	Matrin-3	EBI-16728828	0.35
P63085	Mitogen-activated protein kinase 1 (MAP kinase 1) (MAPK 1) (EC 2.7.11.24) (ERT1) (Extracellular signal-regulated kinase 2) (ERK-2) (MAP kinase isoform p42) (p42-MAPK) (Mitogen-activated protein kinase 2) (MAP kinase 2) (MAPK 2)	EBI-16728828	0.35
Q91ZX7	Prolow-density lipoprotein receptor-related protein 1 (LRP-1) (Alpha-2-macroglobulin receptor) (A2MR) (CD antigen CD91) [Cleaved into: Low-density lipoprotein receptor-related protein 1 85 kDa subunit (LRP-85); Low-density lipoprotein receptor-related protein 1 515 kDa subunit (LRP-515); Low-density lipoprotein receptor-related protein 1 intracellular domain (LRPICD)]	EBI-16728828	0.35
Q7TME0	Phospholipid phosphatase-related protein type 4 (Brain-specific phosphatidic acid phosphatase-like protein 1) (Inactive 2-lysophosphatidate phosphatase PLPPR4) (Lipid phosphate phosphatase-related protein type 4) (Plasticity-related gene 1 protein) (PRG-1)	EBI-16728828	0.35
Q8BZL8	LIM domain only protein 3 (LMO-3) (Neuronal-specific transcription factor DAT1)	EBI-16728828	0.35
O55203	LIM domain-binding protein 2 (LDB-2) (Carboxyl-terminal LIM domain-binding protein 1) (CLIM-1) (LIM domain-binding factor CLIM1)	EBI-16728828	0.35
P70662	LIM domain-binding protein 1 (LDB-1) (Carboxyl-terminal LIM domain-binding protein 2) (CLIM-2) (LIM domain-binding factor CLIM2) (mLdb1) (Nuclear LIM interactor)	EBI-16728828	0.35
O88447	Kinesin light chain 1 (KLC 1)	EBI-16728828	0.35
P28738	Kinesin heavy chain isoform 5C (EC 3.6.4.-) (Kinesin heavy chain neuron-specific 2) (Kinesin-1)	EBI-16728828	0.35
Q61768	Kinesin-1 heavy chain (Conventional kinesin heavy chain) (Ubiquitous kinesin heavy chain) (UKHC)	EBI-16728828	0.35
P28740	Kinesin-like protein KIF2A (Kinesin-2)	EBI-16728828	0.35
Q3U0V1	Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH type-splicing regulatory protein) (KSRP)	EBI-16728828	0.35
Q3UXZ9	Lysine-specific demethylase 5A (EC 1.14.11.67) (Histone demethylase JARID1A) (Jumonji/ARID domain-containing protein 1A) (Retinoblastoma-binding protein 2) (RBBP-2) ([histone H3]-trimethyl-L-lysine(4) demethylase 5A)	EBI-16728828	0.35
Q6ZPR4	Potassium channel subfamily T member 1	EBI-16728828	0.35
Q08460	Calcium-activated potassium channel subunit alpha-1 (BK channel) (BKCA alpha) (Calcium-activated potassium channel, subfamily M subunit alpha-1) (K(VCA)alpha) (KCa1.1) (Maxi K channel) (MaxiK) (Slo-alpha) (Slo1) (mSlo1) (Slowpoke homolog) (Slo homolog) (mSlo)	EBI-16728828	0.35
Q8C863	E3 ubiquitin-protein ligase Itchy (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase Itchy homolog)	EBI-16728828	0.35
Q8R0S2	IQ motif and SEC7 domain-containing protein 1	EBI-16728828	0.35
P46660	Alpha-internexin (Alpha-Inx) (66 kDa neurofilament protein) (NF-66) (Neurofilament-66)	EBI-16728828	0.35
Q60625	Intercellular adhesion molecule 5 (ICAM-5) (Telencephalin)	EBI-16728828	0.35
O88895	Histone deacetylase 3 (HD3) (EC 3.5.1.98) (Protein deacetylase HDAC3) (EC 3.5.1.-) (Protein deacylase HDAC3) (EC 3.5.1.-)	EBI-16728828	0.35
Q91VW5	Golgin subfamily A member 4 (tGolgin-1)	EBI-16728828	0.35
A2A699	Protein FAM171A2	EBI-16728828	0.35
A2ATK9	Family with sequence similarity 171, member A1	EBI-16728828	0.35
Q8C3F2	Constitutive coactivator of PPAR-gamma-like protein 2 (Protein FAM120C)	EBI-16728828	0.35
P70372	ELAV-like protein 1 (Elav-like generic protein) (Hu-antigen R) (HuR) (MelG)	EBI-16728828	0.35
Q9QXY6	EH domain-containing protein 3	EBI-16728828	0.35
P63168	Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) (mPIN)	EBI-16728828	0.35
Q9JHU4	Cytoplasmic dynein 1 heavy chain 1 (Cytoplasmic dynein heavy chain 1) (Dynein heavy chain, cytosolic)	EBI-16728828	0.35
O08553	Dihydropyrimidinase-related protein 2 (DRP-2) (Unc-33-like phosphoprotein 2) (ULIP-2)	EBI-16728828	0.35
P39053	Dynamin-1 (EC 3.6.5.5)	EBI-16728828	0.35
Q3UH60	Disco-interacting protein 2 homolog B (DIP2 homolog B)	EBI-16728828	0.35
O70566	Protein diaphanous homolog 2 (Diaphanous-related formin-2) (DRF2) (mDia3)	EBI-16728828	0.35
O54784	Death-associated protein kinase 3 (DAP kinase 3) (EC 2.7.11.1) (DAP-like kinase) (Dlk) (MYPT1 kinase) (ZIP-kinase)	EBI-16728828	0.35
Q02248	Catenin beta-1 (Beta-catenin)	EBI-16728828	0.35
Q0V8T9	Contactin-associated protein like 5-1 (Cell recognition molecule Caspr5-1) (Cell recognition molecule Caspr5a) (Contactin-associated protein-like 5a)	EBI-16728828	0.35
P12960	Contactin-1 (Neural cell surface protein F3)	EBI-16728828	0.35
Q6ZQ08	CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1)	EBI-16728828	0.35
Q80U49	Centrosomal protein of 170 kDa protein B (Centrosomal protein 170B) (Cep170B)	EBI-16728828	0.35
Q6A065	Centrosomal protein of 170 kDa (Cep170)	EBI-16728828	0.35
Q6P9K8	Caskin-1 (CASK-interacting protein 1)	EBI-16728828	0.35
Q60865	Caprin-1 (Cytoplasmic activation- and proliferation-associated protein 1) (GPI-anchored membrane protein 1) (GPI-anchored protein p137) (GPI-p137) (p137GPI) (Membrane component chromosome 11 surface marker 1) (RNA granule protein 105)	EBI-16728828	0.35
Q8C1B1	Calmodulin-regulated spectrin-associated protein 2 (Calmodulin-regulated spectrin-associated protein 1-like protein 1)	EBI-16728828	0.35
Q923T9	Calcium/calmodulin-dependent protein kinase type II subunit gamma (CaM kinase II subunit gamma) (CaMK-II subunit gamma) (EC 2.7.11.17)	EBI-16728828	0.35
Q6PHZ2	Calcium/calmodulin-dependent protein kinase type II subunit delta (CaM kinase II subunit delta) (CaMK-II subunit delta) (EC 2.7.11.17)	EBI-16728828	0.35
P28652	Calcium/calmodulin-dependent protein kinase type II subunit beta (CaM kinase II subunit beta) (CaMK-II subunit beta) (EC 2.7.11.17)	EBI-16728828	0.35
P11798	Calcium/calmodulin-dependent protein kinase type II subunit alpha (CaM kinase II subunit alpha) (CaMK-II subunit alpha) (EC 2.7.11.17)	EBI-16728828	0.35
Q8R0S4	Voltage-dependent L-type calcium channel subunit beta-4 (CAB4) (Calcium channel voltage-dependent subunit beta 4)	EBI-16728828	0.35
Q8CC27	Voltage-dependent L-type calcium channel subunit beta-2 (CAB2) (Calcium channel voltage-dependent subunit beta 2)	EBI-16728828	0.35
Q8R3Z5	Voltage-dependent L-type calcium channel subunit beta-1 (CAB1) (Calcium channel voltage-dependent subunit beta 1)	EBI-16728828	0.35
Q5RJI5	Serine/threonine-protein kinase BRSK1 (EC 2.7.11.1) (EC 2.7.11.26) (Brain-specific serine/threonine-protein kinase 1) (BR serine/threonine-protein kinase 1) (Serine/threonine-protein kinase SAD-B)	EBI-16728828	0.35
O08539	Myc box-dependent-interacting protein 1 (Amphiphysin II) (Amphiphysin-like protein) (Bridging integrator 1) (SH3 domain-containing protein 9)	EBI-16728828	0.35
Q9D219	B-cell CLL/lymphoma 9 protein (B-cell lymphoma 9 protein) (Bcl-9)	EBI-16728828	0.35
Q60875	Rho guanine nucleotide exchange factor 2 (Guanine nucleotide exchange factor H1) (GEF-H1) (LBC'S first cousin) (Lymphoid blast crisis-like 1) (Oncogene LFC) (Rhobin)	EBI-16728828	0.35
Q6P9R4	Rho guanine nucleotide exchange factor 18	EBI-16728828	0.35
Q8C4V1	Rho GTPase-activating protein 24 (Rho-type GTPase-activating protein 24)	EBI-16728828	0.35
Q6DFV3	Rho GTPase-activating protein 21 (Rho GTPase-activating protein 10) (Rho-type GTPase-activating protein 21)	EBI-16728828	0.35
Q99NH0	Ankyrin repeat domain-containing protein 17 (Ankyrin repeat domain-containing protein FOE) (Gene trap ankyrin repeat protein)	EBI-16728828	0.35
Q8CJG1	Protein argonaute-1 (Argonaute1) (mAgo1) (Argonaute RISC catalytic component 1) (Eukaryotic translation initiation factor 2C 1) (eIF-2C 1) (eIF2C 1) (Piwi/argonaute family protein meIF2C1)	EBI-16728828	0.35
Q9ESC8	AF4/FMR2 family member 4	EBI-16728828	0.35
Q9EP53	Hamartin (Tuberous sclerosis 1 protein homolog)	EBI-16734894	0.35
Q9D415	Disks large-associated protein 1 (DAP-1) (Guanylate kinase-associated protein) (PSD-95/SAP90-binding protein 1) (SAP90/PSD-95-associated protein 1) (SAPAP1)	EBI-16725590	0.35
Q3UHD9	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 (AGAP-2) (Centaurin-gamma-1) (Cnt-g1) (Phosphatidylinositol 3-kinase enhancer) (PIKE)	EBI-16750831	0.35
Q6UWE0	E3 ubiquitin-protein ligase LRSAM1 (EC 2.3.2.27) (Leucine-rich repeat and sterile alpha motif-containing protein 1) (RING-type E3 ubiquitin transferase LRSAM1) (Tsg101-associated ligase) (hTAL)	EBI-22050272	0.35
Q6NZM9	Histone deacetylase 4 (HD4) (EC 3.5.1.98)	EBI-26472902	0.35
D0ZPH9	E3 ubiquitin-protein ligase SspH2 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase SspH2) (Salmonella secreted protein H2) (Secreted effector protein sspH2)	EBI-27035192	0.35

Cross-References

Database	Links
UNIPROT	P35922
Pfam	PF05641 PF16098 PF12235 PF00013 PF17904 PF18336
PROSITE	PS51641 PS50084

Fragile X messenger ribonucleoprotein 1 (Mus musculus)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (12 interactors)

Interactions with other proteins (230 interactors)

Cross-References

Database

Links

Description

Description