Protein Information |
|
---|---|
Protein Name | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 |
Accession Code | P62879 |
Gene | GNB2 |
Organism | Homo sapiens | Human (Taxonomy: 9606) |
Part of Reference Proteome? | Yes |
Sequence (Length: 340) | |
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTRE GNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQE LLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN |
Description |
||
---|---|---|
Cytoplasm, perinuclear region {Experimental EvidencePubMed:16498633}. Cell membrane {Experimental EvidencePubMed:28219978}. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
Topology | Source | Annotation Type |
Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Extracellular Space (GO:0005615) Focal Adhesion (GO:0005925) Heterotrimeric G-Protein Complex (GO:0005834) Lysosomal Membrane (GO:0005765) Membrane (GO:0016020) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Vesicle (GO:0031982) |
Description |
|
---|---|
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. | Assigned Ontology terms |
Biological Process | G Protein-Coupled Receptor Signaling Pathway (GO:0007186) Regulation Of Potassium Ion Transmembrane Transport (GO:1901379) |
Molecular Function | GTPase Activity (GO:0003924) GTPase Binding (GO:0051020) Protein-Containing Complex Binding (GO:0044877) Signaling Receptor Complex Adaptor Activity (GO:0030159) |
Description |
|
---|---|
Neurodevelopmental disorder with hypotonia and dysmorphic facies (NEDHYDF) [MIM:619503]: An autosomal dominant disorder characterized by global developmental delay, hypotonia, and variably impaired intellectual development, often with speech delay and delayed walking. Most patients have dysmorphic facial features. Clinical features are highly variable and may include congenital cardiac defects, non-specific renal anomalies, joint contractures or joint hyperextensibility, dry skin, and cryptorchidism. {Experimental EvidencePubMed:31698099, Experimental EvidencePubMed:33971351, Experimental EvidencePubMed:34183358}. Note=The disease is caused by variants affecting the gene represented in this entry. Sick sinus syndrome 4 (SSS4) [MIM:619464]: The term 'sick sinus syndrome' encompasses a variety of conditions caused by sinus node dysfunction. The most common clinical manifestations are syncope, presyncope, dizziness, and fatigue. Electrocardiogram typically shows sinus bradycardia, sinus arrest, and/or sinoatrial block. Episodes of atrial tachycardias coexisting with sinus bradycardia ('tachycardia- bradycardia syndrome') are also common in this disorder. SSS occurs most often in the elderly associated with underlying heart disease or previous cardiac surgery, but can also occur in the fetus, infant, or child without heart disease or other contributing factors. SSS4 is characterized by early and progressive sinus node and atrioventricular conduction dysfunction. Some affected individuals are asymptomatic. SSS4 inheritance is autosomal dominant. {Experimental EvidencePubMed:28219978}. Note=The disease is caused by variants affecting the gene represented in this entry. | Database Associations |
OMIM | 139390 619464 619503 |
DisGeNET | 2783 |
Interactions with Nuclear Envelope proteins (4 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
P0C6X7 | 2'-O-methyltransferase nsp16 | EBI-25507431 | 0.37 |
Q9WMX2 | RNA-directed RNA polymerase | EBI-9079674 | 0.37 |
P10909 | Clusterin alpha chain | EBI-21693789 | 0.35 |
P04626 | Receptor tyrosine-protein kinase erbB-2 | EBI-8770853 | 0.35 | Interactions with other proteins (169 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
Q99759 | Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.11.25) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3) | EBI-362076 | 0.00 |
Q9Y572 | Receptor-interacting serine/threonine-protein kinase 3 (EC 2.7.11.1) (RIP-like protein kinase 3) (Receptor-interacting protein 3) (RIP-3) | EBI-363730 | 0.00 |
P04632 | Calpain small subunit 1 (CSS1) (Calcium-activated neutral proteinase small subunit) (CANP small subunit) (Calcium-dependent protease small subunit) (CDPS) (Calcium-dependent protease small subunit 1) (Calpain regulatory subunit) | EBI-732037 | 0.00 |
Q14164 | Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i) | EBI-1074963 | 0.00 |
Q9Y4K3 | TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6) | EBI-1079942 | 0.00 |
P49286 | Melatonin receptor type 1B (Mel-1B-R) (Mel1b receptor) | EBI-1188355 | 0.53 |
Q70EL3 | Inactive ubiquitin carboxyl-terminal hydrolase 50 (Inactive ubiquitin-specific peptidase 50) | EBI-2512984 | 0.40 |
P83917 | Chromobox protein homolog 1 (Heterochromatin protein 1 homolog beta) (HP1 beta) (Heterochromatin protein p25) (M31) (Modifier 1 protein) | EBI-2556579 | 0.40 |
P11440 | Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase) | EBI-2556914 | 0.40 |
Q8BFT2 | HAUS augmin-like complex subunit 4 | EBI-2558223 | 0.40 |
Q9D2X5 | MAU2 chromatid cohesion factor homolog (MAU-2) (Cohesin loading complex subunit SCC4 homolog) | EBI-2561173 | 0.40 |
Q80X56 | E3 ubiquitin-protein ligase TRIM69 (EC 2.3.2.27) (RING finger B-box coiled-coil transcription factor) (RING finger protein 36) (RING-type E3 ubiquitin transferase TRIM69) (Testis-specific RING finger protein) (Tripartite motif-containing protein 69) | EBI-2561540 | 0.40 |
Q8BHX1 | HAUS augmin-like complex subunit 1 (Coiled-coil domain-containing protein 5) | EBI-2562723 | 0.40 |
Q0VEJ0 | Centrosomal protein of 76 kDa (Cep76) | EBI-2563897 | 0.40 |
P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-2878124 | 0.35 |
P48729 | Casein kinase I isoform alpha (CKI-alpha) (EC 2.7.11.1) (CK1) | EBI-3907887 | 0.37 |
P11177 | Pyruvate dehydrogenase E1 component subunit beta, mitochondrial (PDHE1-B) (EC 1.2.4.1) | EBI-3909631 | 0.37 |
P20073 | Annexin A7 (Annexin VII) (Annexin-7) (Synexin) | EBI-7098405 | 0.37 |
P38936 | Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21) | EBI-7123717 | 0.37 |
Q9BPY3 | Protein FAM118B | EBI-7147527 | 0.37 |
P24522 | Growth arrest and DNA damage-inducible protein GADD45 alpha (DNA damage-inducible transcript 1 protein) (DDIT-1) | EBI-7153265 | 0.37 |
Q14451 | Growth factor receptor-bound protein 7 (B47) (Epidermal growth factor receptor GRB-7) (GRB7 adapter protein) | EBI-7160608 | 0.37 |
P49841 | Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1) | EBI-7165519 | 0.55 |
P18754 | Regulator of chromosome condensation (Cell cycle regulatory protein) (Chromosome condensation protein 1) | EBI-7349763 | 0.37 |
P42229 | Signal transducer and activator of transcription 5A | EBI-7392908 | 0.37 |
Q15714 | TSC22 domain family protein 1 (Cerebral protein 2) (Regulatory protein TSC-22) (TGFB-stimulated clone 22 homolog) (Transforming growth factor beta-1-induced transcript 4 protein) | EBI-7407723 | 0.37 |
P15336 | Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response element-binding protein CRE-BP1) | EBI-5529812 | 0.35 |
P03496 | Non-structural protein 1 (NS1) (NS1A) | EBI-6156949 | 0.35 |
P42858 | Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment] | EBI-9071699 | 0.67 |
P05549 | Transcription factor AP-2-alpha (AP2-alpha) (AP-2 transcription factor) (Activating enhancer-binding protein 2-alpha) (Activator protein 2) (AP-2) | EBI-9679115 | 0.37 |
P35579 | Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA) | EBI-11004631 | 0.35 |
P36895 | Bone morphogenetic protein receptor type-1A (BMP type-1A receptor) (BMPR-1A) (EC 2.7.11.30) (Activin receptor-like kinase 3) (ALK-3) (BMP-2/BMP-4 receptor) (Serine/threonine-protein kinase receptor R5) (SKR5) (CD antigen CD292) | EBI-11008521 | 0.35 |
Q8VC57 | BTB/POZ domain-containing protein KCTD5 | EBI-11009211 | 0.35 |
P80315 | T-complex protein 1 subunit delta (TCP-1-delta) (A45) (CCT-delta) | EBI-11016531 | 0.35 |
P80314 | T-complex protein 1 subunit beta (TCP-1-beta) (CCT-beta) | EBI-11019324 | 0.35 |
P80318 | T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma) (Matricin) (mTRiC-P5) | EBI-11029579 | 0.35 |
Q96H55 | Unconventional myosin-XIX (Myosin head domain-containing protein 1) | EBI-11031416 | 0.35 |
P21333 | Filamin-A (FLN-A) (Actin-binding protein 280) (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin) | EBI-11038784 | 0.35 |
Q61879 | Myosin-10 (Cellular myosin heavy chain, type B) (Myosin heavy chain 10) (Myosin heavy chain, non-muscle IIb) (Non-muscle myosin heavy chain B) (NMMHC-B) (Non-muscle myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) | EBI-11041929 | 0.35 |
P51149 | Ras-related protein Rab-7a (EC 3.6.5.2) | EBI-11050319 | 0.35 |
Q9JHJ0 | Tropomodulin-3 (Ubiquitous tropomodulin) (U-Tmod) | EBI-11063313 | 0.35 |
P58771 | Tropomyosin alpha-1 chain (Alpha-tropomyosin) (Tropomyosin-1) | EBI-11063826 | 0.35 |
Q16643 | Drebrin (Developmentally-regulated brain protein) | EBI-11080402 | 0.35 |
Q8N3V7 | Synaptopodin | EBI-11086992 | 0.35 |
Q8CCJ3 | E3 UFM1-protein ligase 1 (EC 2.3.2.-) (E3 UFM1-protein transferase 1) (Multiple alpha-helix protein located at ER) (Regulator of C53/LZAP and DDRGK1) | EBI-11104920 | 0.35 |
Q9Z1Z0 | General vesicular transport factor p115 (Protein USO1 homolog) (Transcytosis-associated protein) (TAP) (Vesicle-docking protein) | EBI-11110688 | 0.35 |
Q6P5F9 | Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog) | EBI-11603310 | 0.35 |
P60033 | CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81) | EBI-20568535 | 0.60 |
Q6IQ23 | Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7) | EBI-16398399 | 0.35 |
Q05322 | Membrane-associated protein VP24 (Ebola VP24) (eVP24) | EBI-15481401 | 0.35 |
P48960 | Adhesion G protein-coupled receptor E5 (Leukocyte antigen CD97) (CD antigen CD97) [Cleaved into: Adhesion G protein-coupled receptor E5 subunit alpha; Adhesion G protein-coupled receptor E5 subunit beta] | EBI-21506471 | 0.35 |
P18075 | Bone morphogenetic protein 7 (BMP-7) (Osteogenic protein 1) (OP-1) (Eptotermin alfa) | EBI-21530438 | 0.35 |
P28335 | 5-hydroxytryptamine receptor 2C (5-HT-2C) (5-HT2C) (5-HTR2C) (5-hydroxytryptamine receptor 1C) (5-HT-1C) (5-HT1C) (Serotonin receptor 2C) | EBI-21534882 | 0.35 |
Q01415 | N-acetylgalactosamine kinase (EC 2.7.1.157) (GalNAc kinase) (Galactokinase 2) | EBI-21540352 | 0.35 |
P26842 | CD27 antigen (CD27L receptor) (T-cell activation antigen CD27) (T14) (Tumor necrosis factor receptor superfamily member 7) (CD antigen CD27) | EBI-21555258 | 0.35 |
O14530 | Thioredoxin domain-containing protein 9 (ATP-binding protein associated with cell differentiation) (Protein 1-4) | EBI-21558244 | 0.35 |
Q2Y0W8 | Electroneutral sodium bicarbonate exchanger 1 (Electroneutral Na(+)-driven Cl-HCO3 exchanger) (Solute carrier family 4 member 8) (k-NBC3) | EBI-21566582 | 0.35 |
Q9NRX5 | Serine incorporator 1 (Tumor differentially expressed protein 1-like) (Tumor differentially expressed protein 2) | EBI-21567084 | 0.35 |
Q16288 | NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase) | EBI-21583226 | 0.35 |
Q9H813 | Proton-activated chloride channel (PAC) (hPAC) (Acid-sensitive outwardly-rectifying anion channel) (ASOR) (Proton-activated outwardly rectifying anion channel) (PAORAC) (Transmembrane protein 206) (hTMEM206) | EBI-21593240 | 0.35 |
Q9Y262 | Eukaryotic translation initiation factor 3 subunit L (eIF3l) (Eukaryotic translation initiation factor 3 subunit 6-interacting protein) (Eukaryotic translation initiation factor 3 subunit E-interacting protein) | EBI-21610950 | 0.35 |
Q9Y345 | Sodium- and chloride-dependent glycine transporter 2 (GlyT-2) (GlyT2) (Solute carrier family 6 member 5) | EBI-21615000 | 0.35 |
Q2MV58 | Tectonic-1 | EBI-21625612 | 0.35 |
Q5VTA0 | PRAME family member 17 | EBI-21649184 | 0.35 |
Q07954 | Prolow-density lipoprotein receptor-related protein 1 (LRP-1) (Alpha-2-macroglobulin receptor) (A2MR) (Apolipoprotein E receptor) (APOER) (CD antigen CD91) [Cleaved into: Low-density lipoprotein receptor-related protein 1 85 kDa subunit (LRP-85); Low-density lipoprotein receptor-related protein 1 515 kDa subunit (LRP-515); Low-density lipoprotein receptor-related protein 1 intracellular domain (LRPICD)] | EBI-21684279 | 0.35 |
Q9NRE1 | Matrix metalloproteinase-26 (MMP-26) (EC 3.4.24.-) (Endometase) (Matrilysin-2) | EBI-21684885 | 0.35 |
Q9GZM7 | Tubulointerstitial nephritis antigen-like (Glucocorticoid-inducible protein 5) (Oxidized LDL-responsive gene 2 protein) (OLRG-2) (Tubulointerstitial nephritis antigen-related protein) (TIN Ag-related protein) (TIN-Ag-RP) | EBI-21699118 | 0.35 |
O15496 | Group 10 secretory phospholipase A2 (EC 3.1.1.4) (Group X secretory phospholipase A2) (GX sPLA2) (sPLA2-X) (Phosphatidylcholine 2-acylhydrolase 10) | EBI-21699277 | 0.35 |
P14091 | Cathepsin E (EC 3.4.23.34) [Cleaved into: Cathepsin E form I; Cathepsin E form II] | EBI-21699601 | 0.35 |
Q6UWB1 | Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Cytokine receptor WSX-1) (Cytokine receptor-like 1) (Type I T-cell cytokine receptor) (TCCR) (ZcytoR1) | EBI-21703330 | 0.35 |
Q9NVU0 | DNA-directed RNA polymerase III subunit RPC5 (RNA polymerase III subunit C5) (DNA-directed RNA polymerase III 80 kDa polypeptide) | EBI-21705041 | 0.35 |
P08754 | Guanine nucleotide-binding protein G(i) subunit alpha-3 (G(i) alpha-3) | EBI-21709056 | 0.35 |
Q9UKJ8 | Disintegrin and metalloproteinase domain-containing protein 21 (ADAM 21) (EC 3.4.24.-) | EBI-21717781 | 0.35 |
Q13371 | Phosducin-like protein (PHLP) | EBI-21726063 | 0.35 |
Q9NQP4 | Prefoldin subunit 4 (Protein C-1) | EBI-21726063 | 0.35 |
Q99471 | Prefoldin subunit 5 (Myc modulator 1) (c-Myc-binding protein Mm-1) | EBI-21726063 | 0.35 |
Q92526 | T-complex protein 1 subunit zeta-2 (TCP-1-zeta-2) (CCT-zeta-2) (CCT-zeta-like) (TCP-1-zeta-like) (Testis-specific Tcp20) (Testis-specific protein TSA303) | EBI-21726063 | 0.35 |
Q13148 | TAR DNA-binding protein 43 (TDP-43) | EBI-21726063 | 0.67 |
P78371 | T-complex protein 1 subunit beta (TCP-1-beta) (CCT-beta) | EBI-21726063 | 0.35 |
P63218 | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 | EBI-21726063 | 0.35 |
P63092 | Guanine nucleotide-binding protein G(s) subunit alpha isoforms short (Adenylate cyclase-stimulating G alpha protein) | EBI-21726063 | 0.35 |
P61758 | Prefoldin subunit 3 (HIBBJ46) (von Hippel-Lindau-binding protein 1) (VBP-1) (VHL-binding protein 1) | EBI-21726063 | 0.35 |
P50991 | T-complex protein 1 subunit delta (TCP-1-delta) (CCT-delta) (Stimulator of TAR RNA-binding) | EBI-21726063 | 0.35 |
P49368 | T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma) (hTRiC5) | EBI-21726063 | 0.35 |
P40227 | T-complex protein 1 subunit zeta (TCP-1-zeta) (Acute morphine dependence-related protein 2) (CCT-zeta-1) (HTR3) (Tcp20) | EBI-21726063 | 0.35 |
P17987 | T-complex protein 1 subunit alpha (TCP-1-alpha) (CCT-alpha) | EBI-21726063 | 0.35 |
P04083 | Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) [Cleaved into: Annexin Ac2-26] | EBI-21726063 | 0.35 |
O60925 | Prefoldin subunit 1 | EBI-21726063 | 0.35 |
O15212 | Prefoldin subunit 6 (Protein Ke2) | EBI-21726063 | 0.35 |
Q9NWX5 | Ankyrin repeat and SOCS box protein 6 (ASB-6) | EBI-21736726 | 0.35 |
P48544 | G protein-activated inward rectifier potassium channel 4 (GIRK-4) (Cardiac inward rectifier) (CIR) (Heart KATP channel) (Inward rectifier K(+) channel Kir3.4) (IRK-4) (KATP-1) (Potassium channel, inwardly rectifying subfamily J member 5) | EBI-21754197 | 0.35 |
O95154 | Aflatoxin B1 aldehyde reductase member 3 (EC 1.-.-.-) (AFB1 aldehyde reductase 2) (AFB1-AR 2) | EBI-21755189 | 0.35 |
P08833 | Insulin-like growth factor-binding protein 1 (IBP-1) (IGF-binding protein 1) (IGFBP-1) (Placental protein 12) (PP12) | EBI-21768638 | 0.35 |
Q86WS5 | Transmembrane protease serine 12 (EC 3.4.21.-) | EBI-21771386 | 0.35 |
P30519 | Heme oxygenase 2 (HO-2) (EC 1.14.14.18) [Cleaved into: Heme oxygenase 2 soluble form] | EBI-21779750 | 0.35 |
Q9NTU7 | Cerebellin-4 (Cerebellin-like glycoprotein 1) | EBI-21783449 | 0.35 |
Q8WVH0 | Complexin-3 (Complexin III) (CPX III) | EBI-21802744 | 0.35 |
Q6ZMY9 | Zinc finger protein 517 | EBI-21818150 | 0.35 |
Q8N1E6 | F-box/LRR-repeat protein 14 (F-box and leucine-rich repeat protein 14) | EBI-21820146 | 0.35 |
Q8WTQ1 | Beta-defensin 104 (Beta-defensin 4) (BD-4) (DEFB-4) (hBD-4) (Defensin, beta 104) | EBI-21825173 | 0.35 |
Q96GD3 | Polycomb protein SCMH1 (Sex comb on midleg homolog 1) | EBI-21834539 | 0.35 |
Q9UNU6 | 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase (EC 1.14.14.139) (7-alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase) (CYPVIIIB1) (Cytochrome P450 8B1) (Sterol 12-alpha-hydroxylase) | EBI-21839336 | 0.35 |
Q99808 | Equilibrative nucleoside transporter 1 (Equilibrative nitrobenzylmercaptopurine riboside-sensitive nucleoside transporter) (Equilibrative NBMPR-sensitive nucleoside transporter) (Nucleoside transporter, es-type) (Solute carrier family 29 member 1) | EBI-21849345 | 0.35 |
O43827 | Angiopoietin-related protein 7 (Angiopoietin-like factor) (Angiopoietin-like protein 7) (Cornea-derived transcript 6 protein) | EBI-21853419 | 0.35 |
Q9BZP6 | Acidic mammalian chitinase (AMCase) (EC 3.2.1.14) (Lung-specific protein TSA1902) | EBI-21862020 | 0.35 |
P32455 | Guanylate-binding protein 1 (EC 3.6.5.-) (GTP-binding protein 1) (GBP-1) (HuGBP-1) (Guanine nucleotide-binding protein 1) (Interferon-induced guanylate-binding protein 1) | EBI-21864916 | 0.35 |
O60383 | Growth/differentiation factor 9 (GDF-9) | EBI-21866276 | 0.35 |
Q8N8M0 | Probable N-acetyltransferase 16 (EC 2.3.1.-) | EBI-21867232 | 0.35 |
P28799 | Progranulin (PGRN) (Acrogranin) (Epithelin precursor) (Glycoprotein of 88 Kda) (GP88) (Glycoprotein 88) (Granulin precursor) (PC cell-derived growth factor) (PCDGF) (Proepithelin) (PEPI) [Cleaved into: Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Epithelin-2) (Granulin B); Granulin-4 (Epithelin-1) (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Granulin E)] | EBI-21877218 | 0.35 |
P04278 | Sex hormone-binding globulin (SHBG) (Sex steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) (Testosterone-estradiol-binding globulin) (TeBG) (Testosterone-estrogen-binding globulin) | EBI-21877199 | 0.35 |
Q96CM8 | Medium-chain acyl-CoA ligase ACSF2, mitochondrial (EC 6.2.1.2) | EBI-21877340 | 0.40 |
Q3SY56 | Transcription factor Sp6 (Krueppel-like factor 14) | EBI-21877291 | 0.35 |
Q99518 | Flavin-containing monooxygenase 2 (EC 1.14.13.-) (Dimethylaniline oxidase 2) (FMO 1B1) (Pulmonary flavin-containing monooxygenase 2) (FMO 2) | EBI-21877353 | 0.40 |
P27824 | Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) | EBI-16788621 | 0.27 |
Q96I36 | Cytochrome c oxidase assembly protein COX14 | EBI-16791250 | 0.27 |
P23258 | Tubulin gamma-1 chain (Gamma-1-tubulin) (Gamma-tubulin complex component 1) (GCP-1) | EBI-16800113 | 0.27 |
A2A935 | Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1) | EBI-21022882 | 0.35 |
P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
Q5T7N2 | LINE-1 type transposase domain-containing protein 1 (ES cell-associated protein 11) | EBI-20993270 | 0.35 |
Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-21360986 | 0.35 |
Q9H0J9 | Protein mono-ADP-ribosyltransferase PARP12 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 12) (ARTD12) (Poly [ADP-ribose] polymerase 12) (PARP-12) (Zinc finger CCCH domain-containing protein 1) | EBI-21263845 | 0.35 |
O43924 | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (GMP-PDE delta) (Protein p17) | EBI-21019227 | 0.35 |
Q8N6Q3 | CD177 antigen (Human neutrophil alloantigen 2a) (HNA-2a) (NB1 glycoprotein) (NB1 GP) (Polycythemia rubra vera protein 1) (PRV-1) (CD antigen CD177) | EBI-21402192 | 0.35 |
P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-25416349 | 0.53 |
Q13115 | Dual specificity protein phosphatase 4 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase hVH2) (Mitogen-activated protein kinase phosphatase 2) (MAP kinase phosphatase 2) (MKP-2) | EBI-25372724 | 0.35 |
Q15139 | Serine/threonine-protein kinase D1 (EC 2.7.11.13) (Protein kinase C mu type) (Protein kinase D) (nPKC-D1) (nPKC-mu) | EBI-25395029 | 0.35 |
P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
O76071 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 (WD repeat-containing protein 39) | EBI-25477658 | 0.35 |
Q9BY14 | Testis-expressed protein 101 (Cell surface receptor NYD-SP8) (Scleroderma-associated autoantigen) (Spermatogenesis-related gene protein) | EBI-25504841 | 0.35 |
Q9C0B5 | Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375) | EBI-25637382 | 0.35 |
Q5VVX9 | Ubiquitin-conjugating enzyme E2 U (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme U) (Ubiquitin carrier protein U) (Ubiquitin-protein ligase U) | EBI-25859638 | 0.56 |
Q969M7 | NEDD8-conjugating enzyme UBE2F (EC 2.3.2.32) (NEDD8 carrier protein UBE2F) (NEDD8 protein ligase UBE2F) (NEDD8-conjugating enzyme 2) (RING-type E3 NEDD8 transferase UBE2F) (Ubiquitin-conjugating enzyme E2 F) | EBI-25859630 | 0.56 |
Q8N2K1 | Ubiquitin-conjugating enzyme E2 J2 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme J2) (Non-canonical ubiquitin-conjugating enzyme 2) (NCUBE-2) | EBI-25859622 | 0.56 |
Q8WVN8 | Ubiquitin-conjugating enzyme E2 Q2 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme Q2) (Ubiquitin carrier protein Q2) (Ubiquitin-protein ligase Q2) | EBI-25859614 | 0.56 |
Q9H0Y0 | Ubiquitin-like-conjugating enzyme ATG10 (EC 2.3.2.-) (Autophagy-related protein 10) (APG10-like) | EBI-25859606 | 0.56 |
Q9NT62 | Ubiquitin-like-conjugating enzyme ATG3 (EC 2.3.2.-) (Autophagy-related protein 3) (APG3-like) (hApg3) (Protein PC3-96) | EBI-25859598 | 0.56 |
Q9C0C9 | (E3-independent) E2 ubiquitin-conjugating enzyme (EC 2.3.2.24) (E2/E3 hybrid ubiquitin-protein ligase UBE2O) (Ubiquitin carrier protein O) (Ubiquitin-conjugating enzyme E2 O) (Ubiquitin-conjugating enzyme E2 of 230 kDa) (Ubiquitin-conjugating enzyme E2-230K) (Ubiquitin-protein ligase O) | EBI-25859588 | 0.56 |
Q7Z7E8 | Ubiquitin-conjugating enzyme E2 Q1 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme Q1) (Protein NICE-5) (Ubiquitin carrier protein Q1) (Ubiquitin-protein ligase Q1) | EBI-25859570 | 0.56 |
Q9Y2X8 | Ubiquitin-conjugating enzyme E2 D4 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme D4) (HBUCE1) (Ubiquitin carrier protein D4) (Ubiquitin-protein ligase D4) | EBI-25859562 | 0.56 |
Q9NPD8 | Ubiquitin-conjugating enzyme E2 T (EC 2.3.2.23) (Cell proliferation-inducing gene 50 protein) (E2 ubiquitin-conjugating enzyme T) (Ubiquitin carrier protein T) (Ubiquitin-protein ligase T) | EBI-25859554 | 0.56 |
Q16763 | Ubiquitin-conjugating enzyme E2 S (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme S) (E2-EPF) (Ubiquitin carrier protein S) (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-conjugating enzyme E2-EPF5) (Ubiquitin-protein ligase S) | EBI-25859546 | 0.56 |
Q6NXQ4 | UBE2S protein | EBI-25859538 | 0.56 |
O00762 | Ubiquitin-conjugating enzyme E2 C (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme C) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme C) (UbcH10) (Ubiquitin carrier protein C) (Ubiquitin-protein ligase C) | EBI-25859524 | 0.56 |
O14933 | Ubiquitin/ISG15-conjugating enzyme E2 L6 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme L6) (Retinoic acid-induced gene B protein) (RIG-B) (UbcH8) (Ubiquitin carrier protein L6) (Ubiquitin-protein ligase L6) | EBI-25859516 | 0.56 |
P61081 | NEDD8-conjugating enzyme Ubc12 (EC 2.3.2.34) (NEDD8 carrier protein) (Ubiquitin-conjugating enzyme E2 M) | EBI-25859508 | 0.56 |
P61077 | Ubiquitin-conjugating enzyme E2 D3 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D3) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2(17)KB 3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (Ubiquitin-protein ligase D3) | EBI-25859476 | 0.56 |
P62837 | Ubiquitin-conjugating enzyme E2 D2 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D2) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2(17)KB 2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (Ubiquitin-protein ligase D2) (p53-regulated ubiquitin-conjugating enzyme 1) | EBI-25859468 | 0.56 |
P51668 | Ubiquitin-conjugating enzyme E2 D1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D1) (Stimulator of Fe transport) (SFT) (UBC4/5 homolog) (UbcH5) (Ubiquitin carrier protein D1) (Ubiquitin-conjugating enzyme E2(17)KB 1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (Ubiquitin-protein ligase D1) | EBI-25859460 | 0.56 |
P61086 | Ubiquitin-conjugating enzyme E2 K (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme K) (Huntingtin-interacting protein 2) (HIP-2) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme E2-25 kDa) (Ubiquitin-conjugating enzyme E2(25K)) (Ubiquitin-conjugating enzyme E2-25K) (Ubiquitin-protein ligase) | EBI-25859442 | 0.56 |
Q7KZS0 | Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) (Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform CRA_b) | EBI-25859500 | 0.56 |
P62256 | Ubiquitin-conjugating enzyme E2 H (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme H) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme H) (UbcH2) (Ubiquitin carrier protein H) (Ubiquitin-conjugating enzyme E2-20K) (Ubiquitin-protein ligase H) | EBI-25859492 | 0.56 |
P62253 | Ubiquitin-conjugating enzyme E2 G1 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme G1) (E217K) (UBC7) (Ubiquitin carrier protein G1) (Ubiquitin-protein ligase G1) [Cleaved into: Ubiquitin-conjugating enzyme E2 G1, N-terminally processed] | EBI-25859484 | 0.56 |
O60260 | E3 ubiquitin-protein ligase parkin (Parkin) (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) (Parkinson juvenile disease protein 2) (Parkinson disease protein 2) | EBI-25879531 | 0.56 |
P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | EBI-25895413 | 0.56 |
Q9Y3C5 | RING finger protein 11 | EBI-25918235 | 0.56 |
Q7Z699 | Sprouty-related, EVH1 domain-containing protein 1 (Spred-1) (hSpred1) | EBI-25930439 | 0.56 |
P00441 | Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) (Superoxide dismutase 1) (hSod1) | EBI-25934837 | 0.56 |
P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | EBI-25940648 | 0.56 |
Q13363 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) | EBI-27047305 | 0.35 |
P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27108918 | 0.35 |
Q05513 | Protein kinase C zeta type (EC 2.7.11.13) (nPKC-zeta) | EBI-28938998 | 0.35 |
Q12792 | Twinfilin-1 (Protein A6) (Protein tyrosine kinase 9) | EBI-28939213 | 0.35 |
Q13188 | Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) [Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C)] | EBI-28939324 | 0.35 |
Q86V86 | Serine/threonine-protein kinase pim-3 (EC 2.7.11.1) | EBI-28942203 | 0.35 |
Q8IVW4 | Cyclin-dependent kinase-like 3 (EC 2.7.11.22) (Serine/threonine-protein kinase NKIAMRE) | EBI-28942376 | 0.35 |
Q8TEA7 | TBC domain-containing protein kinase-like protein | EBI-28943849 | 0.35 |
Q8TF76 | Serine/threonine-protein kinase haspin (EC 2.7.11.1) (Germ cell-specific gene 2 protein) (H-haspin) (Haploid germ cell-specific nuclear protein kinase) | EBI-28943924 | 0.35 |
Q92772 | Cyclin-dependent kinase-like 2 (EC 2.7.11.22) (Protein kinase p56 KKIAMRE) (Serine/threonine-protein kinase KKIAMRE) | EBI-28944167 | 0.35 |
Q9HCP0 | Casein kinase I isoform gamma-1 (CKI-gamma 1) (EC 2.7.11.1) | EBI-28946348 | 0.35 |
Database | Links |
UNIPROT | P62879 B3KPU1 P11016 P54312 |
Pfam | PF00400 |
PROSITE | PS00678 PS50082 PS50294 |
OMIM | 139390 619464 619503 |
DisGeNET | 2783 |