National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory
Protein Information |
|
|---|---|
| Protein Name | Small ubiquitin-related modifier 1 |
| Accession Code | P63165 |
| Gene | SUMO1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 101) | |
|
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL GMEEEDVIEVYQEQTGGHSTV |
|
Structure Viewer (PDB: 4WJP) |
|---|
Description |
||
|---|---|---|
| Nucleus membrane {Experimental EvidencePubMed:10574707, Experimental EvidencePubMed:12383504}. Nucleus speckle {By SimilarityUniProtKB:P63166}. Cytoplasm {Experimental EvidencePubMed:12383504, Experimental EvidencePubMed:9162015}. Nucleus, PML body {Experimental EvidencePubMed:10574707, Experimental EvidencePubMed:12383504, ECO:0000269|PubMed:22406621}. Cell membrane {ECO:0000269|PubMed:19223394}. Nucleus {ECO:0000269|PubMed:24651376, Experimental EvidencePubMed:9162015}. Note=Recruited by BCL11A into the nuclear body (By similarity). In the presence of ZFHX3, sequesterd to nuclear body (NB)-like dots in the nucleus some of which overlap or closely associate with PML body (PubMed:24651376). {By SimilarityUniProtKB:P63166, ECO:0000269|PubMed:24651376}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. |
| Nuclear Membrane | SL-0182 | The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytosol (GO:0005829) Nuclear Body (GO:0016604) Nuclear Membrane (GO:0031965) Nuclear Pore (GO:0005643) Nuclear Speck (GO:0016607) Nuclear Stress Granule (GO:0097165) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Plasma Membrane (GO:0005886) PML Body (GO:0016605) XY Body (GO:0001741) |
|
Description |
|
|---|---|
| Non-syndromic orofacial cleft 10 (OFC10) [MIM:613705]: A birth defect consisting of cleft lips with or without cleft palate. Cleft lips are associated with cleft palate in two-third of cases. A cleft lip can occur on one or both sides and range in severity from a simple notch in the upper lip to a complete opening in the lip extending into the floor of the nostril and involving the upper gum. {Experimental EvidencePubMed:16990542}. Note=The disease is caused by variants affecting the gene represented in this entry. A chromosomal aberration involving SUMO1 is the cause of OFC10. Translocation t(2;8)(q33.1;q24.3). The breakpoint occurred in the SUMO1 gene and resulted in haploinsufficiency confirmed by protein assays. | Database Associations |
| OMIM | 601912 613705 |
| DisGeNET | 7341 |
Interactions with Nuclear Envelope proteins (18 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| P63279 | SUMO-conjugating enzyme UBC9 | EBI-7406754 | 0.95 |
| P63165 | Self | EBI-1559403 | 0.37 |
| Q9BUZ4 | TNF receptor-associated factor 4 | EBI-10299128 | 0.56 |
| Q06787 | Fragile X messenger ribonucleoprotein 1 | EBI-21388180 | 0.00 |
| Q00613 | Heat shock factor protein 1 | EBI-15799774 | 0.44 |
| Q14974 | Importin subunit beta-1 | EBI-11115566 | 0.35 |
| P59595 | Nucleoprotein | EBI-7602710 | 0.54 |
| P57740 | Nuclear pore complex protein Nup107 | EBI-11160436 | 0.35 |
| Q8BH74 | Nuclear pore complex protein Nup107 | EBI-10997196 | 0.35 |
| P49790 | Nuclear pore complex protein Nup153 | EBI-11076796 | 0.35 |
| Q99P88 | Nuclear pore complex protein Nup155 | EBI-10997466 | 0.35 |
| Q6PFD9 | Nuclear pore complex protein Nup96 | EBI-10994876 | 0.35 |
| Q06609 | DNA repair protein RAD51 homolog 1 | EBI-15819689 | 0.44 |
| P46060 | Ran GTPase-activating protein 1 | EBI-7036555 | 0.96 |
| P49792 | E3 SUMO-protein ligase RanBP2 | EBI-30826718 | 0.44 |
| Q9ERU9 | E3 SUMO-protein ligase RanBP2 | EBI-2555617 | 0.56 |
| Q96EE3 | Nucleoporin SEH1 | EBI-11086798 | 0.35 |
| Q9HC62 | Sentrin-specific protease 2 | EBI-1039804 | 0.62 | Interactions with other proteins (176 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q9UBC3 | DNA (cytosine-5)-methyltransferase 3B (Dnmt3b) (EC 2.1.1.37) (DNA methyltransferase HsaIIIB) (DNA MTase HsaIIIB) (M.HsaIIIB) | EBI-80165 | 0.70 |
| Q9UER7 | Death domain-associated protein 6 (Daxx) (hDaxx) (ETS1-associated protein 1) (EAP1) (Fas death domain-associated protein) | EBI-367065 | 0.78 |
| P29590 | Protein PML (E3 SUMO-protein ligase PML) (EC 2.3.2.-) (Promyelocytic leukemia protein) (RING finger protein 71) (RING-type E3 SUMO transferase PML) (Tripartite motif-containing protein 19) (TRIM19) | EBI-367073 | 0.83 |
| Q9H2X6 | Homeodomain-interacting protein kinase 2 (hHIPk2) (EC 2.7.11.1) | EBI-7631580 | 0.54 |
| Q9P0U3 | Sentrin-specific protease 1 (EC 3.4.22.-) (Sentrin/SUMO-specific protease SENP1) | EBI-7631805 | 0.87 |
| Q96GM8 | Target of EGR1 protein 1 | EBI-736070 | 0.00 |
| Q8NCR3 | Protein MFI (Mitochondrial fission factor interactor) | EBI-754177 | 0.37 |
| P23497 | Nuclear autoantigen Sp-100 (Nuclear dot-associated Sp100 protein) (Speckled 100 kDa) | EBI-759019 | 0.76 |
| P03116 | Replication protein E1 (EC 3.6.4.12) (ATP-dependent helicase E1) | EBI-7316595 | 0.40 |
| P56693 | Transcription factor SOX-10 | EBI-8087462 | 0.44 |
| Q13569 | G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG) | EBI-8543687 | 0.67 |
| Q9UBE0 | SUMO-activating enzyme subunit 1 (Ubiquitin-like 1-activating enzyme E1A) [Cleaved into: SUMO-activating enzyme subunit 1, N-terminally processed] | EBI-1037073 | 0.66 |
| P19419 | ETS domain-containing protein Elk-1 | EBI-7035798 | 0.66 |
| Q02078 | Myocyte-specific enhancer factor 2A (Serum response factor-like protein 1) | EBI-15799620 | 0.54 |
| P21359 | Neurofibromin (Neurofibromatosis-related protein NF-1) [Cleaved into: Neurofibromin truncated] | EBI-7036435 | 0.40 |
| Q96ST3 | Paired amphipathic helix protein Sin3a (Histone deacetylase complex subunit Sin3a) (Transcriptional corepressor Sin3a) | EBI-7036520 | 0.40 |
| Q9UIS9 | Methyl-CpG-binding domain protein 1 (CXXC-type zinc finger protein 3) (Methyl-CpG-binding protein MBD1) (Protein containing methyl-CpG-binding domain 1) | EBI-7060348 | 0.52 |
| Q8N1G0 | Zinc finger protein 687 | EBI-1210299 | 0.00 |
| Q9C0J8 | pre-mRNA 3' end processing protein WDR33 (WD repeat-containing protein 33) (WD repeat-containing protein of 146 kDa) | EBI-1210299 | 0.00 |
| O15294 | UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (EC 2.4.1.255) (O-GlcNAc transferase subunit p110) (O-linked N-acetylglucosamine transferase 110 kDa subunit) (OGT) | EBI-1210299 | 0.00 |
| Q96QC0 | Serine/threonine-protein phosphatase 1 regulatory subunit 10 (MHC class I region proline-rich protein CAT53) (PP1-binding protein of 114 kDa) (Phosphatase 1 nuclear targeting subunit) (Protein FB19) (p99) | EBI-1210299 | 0.00 |
| Q5VWQ0 | Lysine-specific demethylase 9 (KDM9) (EC 1.14.11.-) (Round spermatid basic protein 1) | EBI-1210299 | 0.00 |
| P54886 | Delta-1-pyrroline-5-carboxylate synthase (P5CS) (Aldehyde dehydrogenase family 18 member A1) [Includes: Glutamate 5-kinase (GK) (EC 2.7.2.11) (Gamma-glutamyl kinase); Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase)] | EBI-1210299 | 0.00 |
| Q15697 | Zinc finger protein 174 (AW-1) (Zinc finger and SCAN domain-containing protein 8) | EBI-1210299 | 0.00 |
| Q96JM2 | Zinc finger protein 462 (Zinc finger PBX1-interacting protein) (ZFPIP) | EBI-1210299 | 0.00 |
| O14874 | [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial (EC 2.7.11.4) (Branched-chain alpha-ketoacid dehydrogenase kinase) (BCKD-kinase) (BCKDHKIN) | EBI-1210299 | 0.00 |
| Q92610 | Zinc finger protein 592 | EBI-1210299 | 0.00 |
| Q7Z7K6 | Centromere protein V (CENP-V) (Nuclear protein p30) (Proline-rich protein 6) | EBI-1210299 | 0.00 |
| Q9NYW8 | RB-associated KRAB zinc finger protein (RB-associated KRAB repressor) (hRBaK) (Zinc finger protein 769) | EBI-1210299 | 0.00 |
| O14647 | Chromodomain-helicase-DNA-binding protein 2 (CHD-2) (EC 3.6.4.12) (ATP-dependent helicase CHD2) | EBI-1210299 | 0.00 |
| Q01082 | Spectrin beta chain, non-erythrocytic 1 (Beta-II spectrin) (Fodrin beta chain) (Spectrin, non-erythroid beta chain 1) | EBI-1210299 | 0.00 |
| Q5T0B9 | Zinc finger protein 362 | EBI-1210299 | 0.00 |
| Q9NX05 | Constitutive coactivator of PPAR-gamma-like protein 2 (Protein FAM120C) (Tumor antigen BJ-HCC-21) | EBI-1210299 | 0.00 |
| O43309 | Zinc finger and SCAN domain-containing protein 12 (Zinc finger protein 305) (Zinc finger protein 96) | EBI-1210299 | 0.00 |
| Q96PQ6 | Zinc finger protein 317 | EBI-1210299 | 0.00 |
| Q9H0J9 | Protein mono-ADP-ribosyltransferase PARP12 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 12) (ARTD12) (Poly [ADP-ribose] polymerase 12) (PARP-12) (Zinc finger CCCH domain-containing protein 1) | EBI-1210299 | 0.00 |
| Q92766 | Ras-responsive element-binding protein 1 (RREB-1) (Finger protein in nuclear bodies) (Raf-responsive zinc finger protein LZ321) (Zinc finger motif enhancer-binding protein 1) (Zep-1) | EBI-1210299 | 0.00 |
| Q9H5H4 | Zinc finger protein 768 | EBI-1210299 | 0.00 |
| Q9NS39 | Double-stranded RNA-specific editase B2 (EC 3.5.-.-) (RNA-dependent adenosine deaminase 3) (RNA-editing deaminase 2) (RNA-editing enzyme 2) (dsRNA adenosine deaminase B2) | EBI-1210299 | 0.00 |
| Q5BJG6 | ZMYND11 protein | EBI-1210299 | 0.00 |
| Q14865 | AT-rich interactive domain-containing protein 5B (ARID domain-containing protein 5B) (MRF1-like protein) (Modulator recognition factor 2) (MRF-2) | EBI-1210299 | 0.00 |
| Q9C086 | INO80 complex subunit B (High mobility group AT-hook 1-like 4) (IES2 homolog) (hIes2) (PAP-1-associated protein 1) (PAPA-1) (Zinc finger HIT domain-containing protein 4) | EBI-1210299 | 0.00 |
| Q5T5X7 | BEN domain-containing protein 3 | EBI-1210299 | 0.00 |
| Q16778 | Histone H2B type 2-E (H2B-clustered histone 21) (Histone H2B-GL105) (Histone H2B.q) (H2B/q) | EBI-1210299 | 0.00 |
| O43290 | U4/U6.U5 tri-snRNP-associated protein 1 (SNU66 homolog) (hSnu66) (Squamous cell carcinoma antigen recognized by T-cells 1) (SART-1) (hSART-1) (U4/U6.U5 tri-snRNP-associated 110 kDa protein) (allergen Hom s 1) | EBI-1211852 | 0.50 |
| Q7L2E3 | ATP-dependent RNA helicase DHX30 (EC 3.6.4.13) (DEAH box protein 30) | EBI-1210299 | 0.00 |
| P05187 | Alkaline phosphatase, placental type (EC 3.1.3.1) (Alkaline phosphatase Regan isozyme) (Placental alkaline phosphatase 1) (PLAP-1) | EBI-1210299 | 0.00 |
| P27105 | Stomatin (Erythrocyte band 7 integral membrane protein) (Erythrocyte membrane protein band 7.2) (Protein 7.2b) | EBI-1210299 | 0.00 |
| Q9H2Y7 | Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) | EBI-1210299 | 0.00 |
| Q9HCK8 | Chromodomain-helicase-DNA-binding protein 8 (CHD-8) (EC 3.6.4.12) (ATP-dependent helicase CHD8) (Helicase with SNF2 domain 1) | EBI-1210299 | 0.00 |
| Q9Y3V2 | RWD domain-containing protein 3 (RWD domain-containing sumoylation enhancer) (RSUME) | EBI-1549907 | 0.44 |
| P25445 | Tumor necrosis factor receptor superfamily member 6 (Apo-1 antigen) (Apoptosis-mediating surface antigen FAS) (FASLG receptor) (CD antigen CD95) | EBI-1559446 | 0.37 |
| Q92786 | Prospero homeobox protein 1 (Homeobox prospero-like protein PROX1) (PROX-1) | EBI-8463533 | 0.40 |
| Q00653 | Nuclear factor NF-kappa-B p100 subunit (DNA-binding factor KBF2) (H2TF1) (Lymphocyte translocation chromosome 10 protein) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2) (Oncogene Lyt-10) (Lyt10) [Cleaved into: Nuclear factor NF-kappa-B p52 subunit] | EBI-8017134 | 0.40 |
| P18146 | Early growth response protein 1 (EGR-1) (AT225) (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24) | EBI-8513652 | 0.40 |
| Q969V5 | Mitochondrial ubiquitin ligase activator of NFKB 1 (EC 2.3.2.27) (E3 SUMO-protein ligase MUL1) (E3 ubiquitin-protein ligase MUL1) (Growth inhibition and death E3 ligase) (Mitochondrial-anchored protein ligase) (Protein Hades) (Putative NF-kappa-B-activating protein 266) (RING finger protein 218) (RING-type E3 ubiquitin transferase NFKB 1) | EBI-6987810 | 0.35 |
| Q99856 | AT-rich interactive domain-containing protein 3A (ARID domain-containing protein 3A) (B-cell regulator of IgH transcription) (Bright) (Dead ringer-like protein 1) (E2F-binding protein 1) | EBI-8566246 | 0.35 |
| Q07832 | Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13) | EBI-2560950 | 0.40 |
| P06730 | Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (eIF-4F 25 kDa subunit) (mRNA cap-binding protein) | EBI-7852202 | 0.40 |
| Q81KT8 | Septation ring formation regulator EzrA | EBI-2821603 | 0.00 |
| Q99459 | Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein) | EBI-7954144 | 0.35 |
| P09874 | Poly [ADP-ribose] polymerase 1 (PARP-1) (EC 2.4.2.30) (ADP-ribosyltransferase diphtheria toxin-like 1) (ARTD1) (DNA ADP-ribosyltransferase PARP1) (EC 2.4.2.-) (NAD(+) ADP-ribosyltransferase 1) (ADPRT 1) (Poly[ADP-ribose] synthase 1) (Protein poly-ADP-ribosyltransferase PARP1) (EC 2.4.2.-) [Cleaved into: Poly [ADP-ribose] polymerase 1, processed C-terminus (Poly [ADP-ribose] polymerase 1, 89-kDa form); Poly [ADP-ribose] polymerase 1, processed N-terminus (NT-PARP-1) (Poly [ADP-ribose] polymerase 1, 24-kDa form) (Poly [ADP-ribose] polymerase 1, 28-kDa form)] | EBI-7258849 | 0.40 |
| Q16665 | Hypoxia-inducible factor 1-alpha (HIF-1-alpha) (HIF1-alpha) (ARNT-interacting protein) (Basic-helix-loop-helix-PAS protein MOP1) (Class E basic helix-loop-helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain-containing protein 8) | EBI-2940265 | 0.69 |
| Q99814 | Endothelial PAS domain-containing protein 1 (EPAS-1) (Basic-helix-loop-helix-PAS protein MOP2) (Class E basic helix-loop-helix protein 73) (bHLHe73) (HIF-1-alpha-like factor) (HLF) (Hypoxia-inducible factor 2-alpha) (HIF-2-alpha) (HIF2-alpha) (Member of PAS protein 2) (PAS domain-containing protein 2) | EBI-2941366 | 0.40 |
| Q9H160 | Inhibitor of growth protein 2 (Inhibitor of growth 1-like protein) (ING1Lp) (p32) (p33ING2) | EBI-3400801 | 0.40 |
| P10242 | Transcriptional activator Myb (Proto-oncogene c-Myb) | EBI-3505387 | 0.54 |
| P01104 | Transforming protein Myb | EBI-3505439 | 0.40 |
| O88846 | E3 ubiquitin-protein ligase RNF4 (EC 2.3.2.27) (RING finger protein 4) (Small nuclear ring finger protein) (Protein SNURF) | EBI-8568973 | 0.40 |
| Q8NCN4 | E3 ubiquitin-protein ligase RNF169 (EC 2.3.2.27) (RING finger protein 169) (RING-type E3 ubiquitin transferase RNF169) | EBI-8569133 | 0.35 |
| Q92844 | TRAF family member-associated NF-kappa-B activator (TRAF-interacting protein) (I-TRAF) | EBI-8557085 | 0.35 |
| Q14164 | Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i) | EBI-8557104 | 0.35 |
| Q9UHD2 | Serine/threonine-protein kinase TBK1 (EC 2.7.11.1) (NF-kappa-B-activating kinase) (T2K) (TANK-binding kinase 1) | EBI-8557104 | 0.35 |
| Q9Y6K9 | NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | EBI-8557226 | 0.56 |
| Q60953 | Protein PML | EBI-4408663 | 0.40 |
| P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | EBI-3904089 | 0.60 |
| Q13489 | Baculoviral IAP repeat-containing protein 3 (EC 2.3.2.27) (Apoptosis inhibitor 2) (API2) (Cellular inhibitor of apoptosis 2) (C-IAP2) (IAP homolog C) (Inhibitor of apoptosis protein 1) (hIAP-1) (hIAP1) (RING finger protein 49) (RING-type E3 ubiquitin transferase BIRC3) (TNFR2-TRAF-signaling complex protein 1) | EBI-3926841 | 0.37 |
| O75928 | E3 SUMO-protein ligase PIAS2 (EC 2.3.2.-) (Androgen receptor-interacting protein 3) (ARIP3) (DAB2-interacting protein) (DIP) (E3 SUMO-protein transferase PIAS2) (Msx-interacting zinc finger protein) (Miz1) (PIAS-NY protein) (Protein inhibitor of activated STAT x) (Protein inhibitor of activated STAT2) | EBI-3934352 | 0.78 |
| Q60636 | PR domain zinc finger protein 1 (EC 2.1.1.-) (B lymphocyte-induced maturation protein 1) (Blimp-1) (Beta-interferon gene positive regulatory domain I-binding factor) (PR domain-containing protein 1) | EBI-7000799 | 0.40 |
| Q01826 | DNA-binding protein SATB1 (Special AT-rich sequence-binding protein 1) | EBI-4391866 | 0.51 |
| Q9H6Y7 | E3 ubiquitin-protein ligase RNF167 (EC 2.3.2.27) (RING finger protein 167) | EBI-5663462 | 0.00 |
| Q8BID6 | Zinc finger and BTB domain-containing protein 46 (BTB-ZF protein expressed in effector lymphocytes) (BZEL) (BTB/POZ domain-containing protein 4) | EBI-7769112 | 0.40 |
| O88898 | Tumor protein 63 (p63) (Transformation-related protein 63) (TP63) (Tumor protein p73-like) (p73L) | EBI-7769233 | 0.40 |
| O75475 | PC4 and SFRS1-interacting protein (CLL-associated antigen KW-7) (Dense fine speckles 70 kDa protein) (DFS 70) (Lens epithelium-derived growth factor) (Transcriptional coactivator p75/p52) | EBI-7946621 | 0.43 |
| O75626 | PR domain zinc finger protein 1 (EC 2.1.1.-) (BLIMP-1) (Beta-interferon gene positive regulatory domain I-binding factor) (PR domain-containing protein 1) (Positive regulatory domain I-binding factor 1) (PRDI-BF1) (PRDI-binding factor 1) | EBI-7839462 | 0.40 |
| Q5W0Q7 | SUMO-specific isopeptidase USPL1 (EC 3.4.22.-) (Ubiquitin-specific peptidase-like protein 1) (USP-like 1) | EBI-8017558 | 0.61 |
| Q6DRC5 | SUMO-specific isopeptidase USPL1 (EC 3.4.22.-) (Ubiquitin-specific peptidase-like protein 1) | EBI-8018170 | 0.44 |
| P61978 | Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (Transformation up-regulated nuclear protein) (TUNP) | EBI-8102993 | 0.40 |
| Q8UN00 | Gag-Pol polyprotein | EBI-6693059 | 0.40 |
| Q92793 | CREB-binding protein (Histone lysine acetyltransferase CREBBP) (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | EBI-9208489 | 0.40 |
| P17655 | Calpain-2 catalytic subunit (EC 3.4.22.53) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (Calpain large polypeptide L2) (Calpain-2 large subunit) (Millimolar-calpain) (M-calpain) | EBI-9212484 | 0.40 |
| P45481 | Histone lysine acetyltransferase CREBBP (EC 2.3.1.48) (Protein-lysine acetyltransferase CREBBP) (EC 2.3.1.-) | EBI-9210386 | 0.40 |
| P15884 | Transcription factor 4 (TCF-4) (Class B basic helix-loop-helix protein 19) (bHLHb19) (Immunoglobulin transcription factor 2) (ITF-2) (SL3-3 enhancer factor 2) (SEF-2) | EBI-9210401 | 0.40 |
| P10276 | Retinoic acid receptor alpha (RAR-alpha) (Nuclear receptor subfamily 1 group B member 1) | EBI-9520823 | 0.56 |
| P0C206 | Protein Rex (Rev homolog) (Rex-1) (p27Rex) | EBI-9675643 | 0.49 |
| O14964 | Hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) (Protein pp110) | EBI-10181926 | 0.56 |
| O95073 | Fibrinogen silencer-binding protein | EBI-10191069 | 0.56 |
| P07910 | Heterogeneous nuclear ribonucleoproteins C1/C2 (hnRNP C1/C2) | EBI-10195362 | 0.72 |
| P15336 | Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response element-binding protein CRE-BP1) | EBI-10198728 | 0.72 |
| P48431 | Transcription factor SOX-2 | EBI-10210270 | 0.67 |
| G2XKQ0 | Small ubiquitin-related modifier 5 (SUMO-5) (SUMO1 pseudogene 1) (Ubiquitin-like 2) (Ubiquitin-like 6) | EBI-10220500 | 0.56 |
| Q12800 | Alpha-globin transcription factor CP2 (SAA3 enhancer factor) (Transcription factor LSF) | EBI-10220534 | 0.56 |
| Q7KZS0 | Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) (Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform CRA_b) | EBI-10220546 | 0.72 |
| Q8WWZ3 | Ectodysplasin-A receptor-associated adapter protein (EDAR-associated death domain protein) (Protein crinkled homolog) | EBI-10220556 | 0.56 |
| Q9HCK0 | Zinc finger and BTB domain-containing protein 26 (Zinc finger protein 481) (Zinc finger protein Bioref) | EBI-10220566 | 0.72 |
| Q05D60 | Deuterosome assembly protein 1 (Coiled-coil domain-containing protein 67) | EBI-10223856 | 0.56 |
| Q15916 | Zinc finger and BTB domain-containing protein 6 (Zinc finger protein 482) (Zinc finger protein with interaction domain) | EBI-10237252 | 0.56 |
| Q53SE7 | Germ cell-less homolog 1 (Drosophila) (Uncharacterized protein FLJ13057) | EBI-10242759 | 0.56 |
| Q59GP6 | Polyhomeotic-like protein 1 variant | EBI-10243451 | 0.56 |
| Q96B23 | Uncharacterized protein C18orf25 (ARKadia-like protein 1) | EBI-10243503 | 0.79 |
| Q6PEW1 | Zinc finger CCHC domain-containing protein 12 (Smad-interacting zinc finger protein 1) | EBI-10253312 | 0.72 |
| Q86UW9 | Probable E3 ubiquitin-protein ligase DTX2 (EC 2.3.2.27) (Protein deltex-2) (Deltex2) (hDTX2) (RING finger protein 58) (RING-type E3 ubiquitin transferase DTX2) | EBI-10259108 | 0.56 |
| Q8NDC0 | MAPK-interacting and spindle-stabilizing protein-like (Mitogen-activated protein kinase 1-interacting protein 1-like) | EBI-10269510 | 0.56 |
| Q8TES7 | Fas-binding factor 1 (FBF-1) (Protein albatross) | EBI-10275280 | 0.56 |
| Q9BPY3 | Protein FAM118B | EBI-10295861 | 0.56 |
| Q9BQY4 | Rhox homeobox family member 2 (Paired-like homeobox protein PEPP-2) (Testis homeobox gene 1) | EBI-10296568 | 0.56 |
| Q9H257 | Caspase recruitment domain-containing protein 9 (hCARD9) | EBI-10305541 | 0.56 |
| Q9UBT2 | SUMO-activating enzyme subunit 2 (EC 2.3.2.-) (Anthracycline-associated resistance ARX) (Ubiquitin-like 1-activating enzyme E1B) (Ubiquitin-like modifier-activating enzyme 2) | EBI-10319390 | 0.85 |
| Q9UJ78 | Zinc finger MYM-type protein 5 (Zinc finger protein 198-like 1) (Zinc finger protein 237) | EBI-10322298 | 0.68 |
| Q9Y4B4 | Helicase ARIP4 (EC 3.6.4.12) (Androgen receptor-interacting protein 4) (RAD54-like protein 2) | EBI-10328076 | 0.72 |
| Q7Z333 | Probable helicase senataxin (EC 3.6.4.-) (Amyotrophic lateral sclerosis 4 protein) (SEN1 homolog) (Senataxin) | EBI-10093988 | 0.37 |
| Q8VE37 | Regulator of chromosome condensation (Chromosome condensation protein 1) | EBI-11043815 | 0.35 |
| P63280 | SUMO-conjugating enzyme UBC9 (EC 2.3.2.-) (RING-type E3 SUMO transferase UBC9) (SUMO-protein ligase) (Ubiquitin carrier protein 9) (mUBC9) (Ubiquitin carrier protein I) (Ubiquitin-conjugating enzyme E2 I) (Ubiquitin-protein ligase I) | EBI-11044140 | 0.35 |
| A0A0S2Z4M1 | Axin-1 (Axis inhibition protein 1) | EBI-16430011 | 0.56 |
| A0A0S2Z3N6 | Ets variant 6 isoform 2 | EBI-16434661 | 0.56 |
| O15169 | Axin-1 (Axis inhibition protein 1) (hAxin) | EBI-16434639 | 0.56 |
| Q9QXY6 | EH domain-containing protein 3 | EBI-11685546 | 0.44 |
| Q8N680 | Zinc finger and BTB domain-containing protein 2 | EBI-24293200 | 0.56 |
| Q9Y2F9 | BTB/POZ domain-containing protein 3 | EBI-25246984 | 0.56 |
| O75360 | Homeobox protein prophet of Pit-1 (PROP-1) (Pituitary-specific homeodomain factor) | EBI-25255095 | 0.56 |
| O00463 | TNF receptor-associated factor 5 (RING finger protein 84) | EBI-24610292 | 0.56 |
| Q8N3Z6 | Zinc finger CCHC domain-containing protein 7 (TRAMP-like complex RNA-binding factor ZCCHC7) | EBI-24712488 | 0.56 |
| Q96MM3 | Zinc finger protein 42 homolog (Zfp-42) (Reduced expression protein 1) (REX-1) (hREX-1) (Zinc finger protein 754) | EBI-24434806 | 0.56 |
| P78317 | E3 ubiquitin-protein ligase RNF4 (EC 2.3.2.27) (RING finger protein 4) (Small nuclear ring finger protein) (Protein SNURF) | EBI-24572385 | 0.68 |
| Q12933 | TNF receptor-associated factor 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF2) (RING-type E3 ubiquitin transferase TRAF2) (Tumor necrosis factor type 2 receptor-associated protein 3) | EBI-24596054 | 0.56 |
| P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | EBI-15584314 | 0.72 |
| P22460 | Potassium voltage-gated channel subfamily A member 5 (HPCN1) (Voltage-gated potassium channel HK2) (Voltage-gated potassium channel subunit Kv1.5) | EBI-15620361 | 0.40 |
| P03243 | E1B 55 kDa protein (E1B-55K) (E1B protein, large T-antigen) (E1B-495R) | EBI-15631628 | 0.40 |
| P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | EBI-15640342 | 0.52 |
| P10914 | Interferon regulatory factor 1 (IRF-1) | EBI-15666674 | 0.54 |
| P38398 | Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING-type E3 ubiquitin transferase BRCA1) | EBI-15822830 | 0.60 |
| Q12888 | TP53-binding protein 1 (53BP1) (p53-binding protein 1) (p53BP1) | EBI-15823042 | 0.54 |
| O00180 | Potassium channel subfamily K member 1 (Inward rectifying potassium channel protein TWIK-1) (Potassium channel K2P1) (Potassium channel KCNO1) | EBI-15855964 | 0.51 |
| P26367 | Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) | EBI-15892992 | 0.44 |
| Q12873 | Chromodomain-helicase-DNA-binding protein 3 (CHD-3) (EC 3.6.4.12) (ATP-dependent helicase CHD3) (Mi-2 autoantigen 240 kDa protein) (Mi2-alpha) (Zinc finger helicase) (hZFH) | EBI-15930412 | 0.44 |
| Q13263 | Transcription intermediary factor 1-beta (TIF1-beta) (E3 SUMO-protein ligase TRIM28) (EC 2.3.2.27) (KRAB-associated protein 1) (KAP-1) (KRAB-interacting protein 1) (KRIP-1) (Nuclear corepressor KAP-1) (RING finger protein 96) (RING-type E3 ubiquitin transferase TIF1-beta) (Tripartite motif-containing protein 28) | EBI-15930462 | 0.40 |
| O75030 | Microphthalmia-associated transcription factor (Class E basic helix-loop-helix protein 32) (bHLHe32) | EBI-15949109 | 0.40 |
| Q61686 | Chromobox protein homolog 5 (Heterochromatin protein 1 homolog alpha) (HP1 alpha) | EBI-15972508 | 0.40 |
| P11474 | Steroid hormone receptor ERR1 (Estrogen receptor-like 1) (Estrogen-related receptor alpha) (ERR-alpha) (Nuclear receptor subfamily 3 group B member 1) | EBI-20303027 | 0.44 |
| P62508 | Estrogen-related receptor gamma (ERR gamma-2) (Estrogen receptor-related protein 3) (Nuclear receptor subfamily 3 group B member 3) | EBI-20303735 | 0.44 |
| P46013 | Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67) | EBI-20562326 | 0.35 |
| P41597 | C-C chemokine receptor type 2 (C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (Monocyte chemoattractant protein 1 receptor) (MCP-1-R) (CD antigen CD192) | EBI-20804248 | 0.37 |
| Q8WWM9 | Cytoglobin (Histoglobin) (HGb) (Stellate cell activation-associated protein) | EBI-21174846 | 0.35 |
| P17676 | CCAAT/enhancer-binding protein beta (C/EBP beta) (Liver activator protein) (LAP) (Liver-enriched inhibitory protein) (LIP) (Nuclear factor NF-IL6) (Transcription factor 5) (TCF-5) | EBI-21288928 | 0.60 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-21301141 | 0.35 |
| O00257 | E3 SUMO-protein ligase CBX4 (EC 2.3.2.-) (Chromobox protein homolog 4) (Polycomb 2 homolog) (Pc2) (hPc2) | EBI-21306927 | 0.46 |
| P42858 | Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment] | EBI-25952752 | 0.56 |
| Q9BYX4 | Interferon-induced helicase C domain-containing protein 1 (EC 3.6.4.13) (Clinically amyopathic dermatomyositis autoantigen 140 kDa) (CADM-140 autoantigen) (Helicase with 2 CARD domains) (Helicard) (Interferon-induced with helicase C domain protein 1) (Melanoma differentiation-associated protein 5) (MDA-5) (Murabutide down-regulated protein) (RIG-I-like receptor 2) (RLR-2) (RNA helicase-DEAD box protein 116) | EBI-26884401 | 0.40 |
| P53350 | Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13) | EBI-28938281 | 0.35 |
| Q92630 | Dual specificity tyrosine-phosphorylation-regulated kinase 2 (EC 2.7.12.1) | EBI-28952196 | 0.27 |
| O15083 | ERC protein 2 | EBI-30826674 | 0.44 |
| O75925 | E3 SUMO-protein ligase PIAS1 (EC 2.3.2.-) (DEAD/H box-binding protein 1) (E3 SUMO-protein transferase PIAS1) (Gu-binding protein) (GBP) (Protein inhibitor of activated STAT protein 1) (RNA helicase II-binding protein) | EBI-30826685 | 0.44 |
| Q08379 | Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95) | EBI-30826740 | 0.44 |
| P16220 | Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1) | EBI-30826696 | 0.44 |
| P18846 | Cyclic AMP-dependent transcription factor ATF-1 (cAMP-dependent transcription factor ATF-1) (Activating transcription factor 1) (Protein TREB36) | EBI-30826707 | 0.44 |
| Q6N043 | Zinc finger protein 280D (Suppressor of hairy wing homolog 4) (Zinc finger protein 634) | EBI-30826751 | 0.44 |
| Q6ZNA4 | E3 ubiquitin-protein ligase Arkadia (EC 2.3.2.27) (RING finger protein 111) (hRNF111) (RING-type E3 ubiquitin transferase Arkadia) | EBI-30826762 | 0.44 |
| Q9H4L7 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 (EC 3.6.4.12) (ATP-dependent helicase 1) (hHEL1) | EBI-30826828 | 0.44 |
| Q96QT4 | Transient receptor potential cation channel subfamily M member 7 (EC 2.7.11.1) (Channel-kinase 1) (Long transient receptor potential channel 7) (LTrpC-7) (LTrpC7) | EBI-30826806 | 0.44 |
| Q9BWV3 | Cytidine and dCMP deaminase domain-containing protein 1 (EC 3.5.4.5) (Cytidine deaminase) (Testis development protein NYD-SP15) | EBI-30826817 | 0.44 |
| Q8IV16 | Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPI-HBP1) (GPI-anchored HDL-binding protein 1) (High density lipoprotein-binding protein 1) | EBI-30826773 | 0.44 |
| Q8N2W9 | E3 SUMO-protein ligase PIAS4 (EC 2.3.2.27) (PIASy) (Protein inhibitor of activated STAT protein 4) (Protein inhibitor of activated STAT protein gamma) (PIAS-gamma) | EBI-30826784 | 0.44 |
| Q9NPG4 | Protocadherin-12 (Vascular cadherin-2) (Vascular endothelial cadherin-2) (VE-cad-2) (VE-cadherin-2) [Cleaved into: Protocadherin-12, secreted form] | EBI-30826839 | 0.44 |
| Q9UNY4 | Transcription termination factor 2 (EC 3.6.4.-) (Lodestar homolog) (RNA polymerase II termination factor) (Transcription release factor 2) (F2) (HuF2) | EBI-30826872 | 0.44 |
| Q9Y6X2 | E3 SUMO-protein ligase PIAS3 (EC 2.3.2.-) (E3 SUMO-protein transferase PIAS3) (Protein inhibitor of activated STAT protein 3) | EBI-30826883 | 0.44 |
| P10070 | Zinc finger protein GLI2 (GLI family zinc finger protein 2) (Tax helper protein) | EBI-29016408 | 0.27 |
| Q5W0V3 | FHF complex subunit HOOK interacting protein 2A (FHIP2A) | EBI-34574999 | 0.27 |
Database | Links |
| UNIPROT | P63165 A8MUS8 B2R4I5 P55856 Q6FGG0 Q6NZ62 Q93068 |
| PDB | 1A5R 1TGZ 1WYW 1Y8R 1Z5S 2ASQ 2BF8 2G4D 2IO2 2IY0 2IY1 2KQS 2LAS 2MW5 2N1A 2N1V 2PE6 2UYZ 2VRR 3KYC 3KYD 3RZW 3UIP 4WJN 4WJO 4WJP 4WJQ 5AEK 5B7A 5ELJ 5GHD 6EOP 6EOT 6J4I 6JXU 6JXV 6K5T 6TRW 6UYO 6UYP 6UYQ 6UYR 6UYS 6UYT 6UYU 6UYV 6UYX 6UYY 6UYZ 6V7P 6V7Q 6V7R 6V7S 6WW3 6XOG 6XOH 6XOI |
| Pfam | PF11976 |
| PROSITE | PS50053 |
| OMIM | 601912 613705 |
| DisGeNET | 7341 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory