Protein Information |
|
---|---|
Protein Name | Apoptosis-stimulating of p53 protein 2 |
Accession Code | Q13625 |
Gene | TP53BP2 |
Organism | Homo sapiens | Human (Taxonomy: 9606) |
Part of Reference Proteome? | Yes |
Sequence (Length: 1128) | |
MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVRFFL RHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVNSPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLK QQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTR QLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQ QKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQ TKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQS SEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIP SVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPH FSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEA LRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEV VSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPE GPGEDSVSMRPPEITGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGI TALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGY TQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRI KPRQRSLA |
Structure Viewer (PDB: 6GHM) |
---|
Description |
||
---|---|---|
Cytoplasm, perinuclear region. Nucleus. Note=Predominantly found in the perinuclear region. Some small fraction is nuclear. Sequester in the cytoplasm on overexpression of DDX42. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
Topology | Source | Annotation Type |
Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
Cellular Component | Cell Junction (GO:0030054) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) |
Description |
|
---|---|
Regulator that plays a central role in regulation of apoptosis and cell growth via its interactions with proteins such as TP53 (PubMed:12524540). Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters of proapoptotic genes in vivo. Inhibits the ability of NAE1 to conjugate NEDD8 to CUL1, and thereby decreases NAE1 ability to induce apoptosis. Impedes cell cycle progression at G2/M. Its apoptosis-stimulating activity is inhibited by its interaction with DDX42. {Experimental EvidencePubMed:11684014, Experimental EvidencePubMed:12524540, Experimental EvidencePubMed:12694406, Experimental EvidencePubMed:19377511}. | Assigned Ontology terms |
Biological Process | Cell Cycle (GO:0007049) Intrinsic Apoptotic Signaling Pathway By P53 Class Mediator (GO:0072332) Negative Regulation Of Cell Cycle (GO:0045786) Positive Regulation Of Execution Phase Of Apoptosis (GO:1900119) Signal Transduction (GO:0007165) |
Molecular Function | Identical Protein Binding (GO:0042802) NF-KappaB Binding (GO:0051059) P53 Binding (GO:0002039) SH3 Domain Binding (GO:0017124) |
Interactions with Nuclear Envelope proteins (13 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
P10415 | Apoptosis regulator Bcl-2 | EBI-15723849 | 0.65 |
P27958 | RNA-directed RNA polymerase | EBI-9389968 | 0.64 |
P29991 | RNA-directed RNA polymerase NS5 | EBI-8828390 | 0.37 |
P49790 | Nuclear pore complex protein Nup153 | EBI-9688225 | 0.35 |
P61970 | Nuclear transport factor 2 | EBI-9688225 | 0.35 |
P62826 | GTP-binding nuclear protein Ran | EBI-9692277 | 0.64 |
Q07817 | Bcl-2-like protein 1 | EBI-15723914 | 0.56 |
Q12840 | Kinesin heavy chain isoform 5A | EBI-731035 | 0.00 |
Q13625 | Self | EBI-7907803 | 0.62 |
Q9WMX2 | RNA-directed RNA polymerase | EBI-9082105 | 0.37 |
Q9BUZ4 | TNF receptor-associated factor 4 | EBI-10299140 | 0.56 |
Q9UBU9 | Nuclear RNA export factor 1 | EBI-10319914 | 0.56 |
O95996 | Adenomatous polyposis coli protein 2 | EBI-8830464 | 0.54 | Interactions with other proteins (122 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
P05067 | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] | EBI-77660 | 0.58 |
P62136 | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16) | EBI-7267006 | 0.86 |
P68104 | Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor Tu) (EF-Tu) (Eukaryotic elongation factor 1 A-1) (eEF1A-1) (Leukocyte receptor cluster member 7) | EBI-731032 | 0.00 |
P21246 | Pleiotrophin (PTN) (Heparin-binding brain mitogen) (HBBM) (Heparin-binding growth factor 8) (HBGF-8) (Heparin-binding growth-associated molecule) (HB-GAM) (Heparin-binding neurite outgrowth-promoting factor) (HBNF) (Heparin-binding neurite outgrowth-promoting factor 1) (HBNF-1) (Osteoblast-specific factor 1) (OSF-1) | EBI-731038 | 0.00 |
Q9BVJ6 | U3 small nucleolar RNA-associated protein 14 homolog A (Antigen NY-CO-16) (Serologically defined colon cancer antigen 16) | EBI-731041 | 0.00 |
Q13432 | Protein unc-119 homolog A (Retinal protein 4) (hRG4) | EBI-731044 | 0.00 |
Q9BYC9 | 39S ribosomal protein L20, mitochondrial (L20mt) (MRP-L20) (Mitochondrial large ribosomal subunit protein bL20m) | EBI-733610 | 0.00 |
Q13107 | Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.4.19.12) (Deubiquitinating enzyme 4) (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Ubiquitous nuclear protein homolog) | EBI-736082 | 0.00 |
O15265 | Ataxin-7 (Spinocerebellar ataxia type 7 protein) | EBI-952468 | 0.00 |
P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | EBI-1026207 | 0.90 |
P46937 | Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog) | EBI-6912563 | 0.78 |
P46936 | Transcriptional coactivator YAP1 (Yes-associated protein 1) (65 kDa Yes-associated protein) (YAP65) (Protein yorkie homolog) | EBI-7804125 | 0.40 |
P63104 | 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1) | EBI-7195756 | 0.67 |
P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | EBI-1960202 | 0.40 |
Q04917 | 14-3-3 protein eta (Protein AS1) | EBI-1644092 | 0.64 |
Q04206 | Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) | EBI-1749490 | 0.56 |
P35570 | Insulin receptor substrate 1 (IRS-1) (pp185) | EBI-1751169 | 0.57 |
P81122 | Insulin receptor substrate 2 (IRS-2) (4PS) | EBI-1751281 | 0.48 |
O08724 | Insulin receptor substrate-3 | EBI-1751296 | 0.35 |
O14654 | Insulin receptor substrate 4 (IRS-4) (160 kDa phosphotyrosine protein) (py160) (Phosphoprotein of 160 kDa) (pp160) | EBI-1751296 | 0.35 |
P35569 | Insulin receptor substrate 1 (IRS-1) | EBI-1751450 | 0.52 |
P36873 | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit) | EBI-7908028 | 0.85 |
Q92843 | Bcl-2-like protein 2 (Bcl2-L-2) (Apoptosis regulator Bcl-W) | EBI-7908070 | 0.68 |
Q81ZG1 | DNA ligase (EC 6.5.1.2) (Polydeoxyribonucleotide synthase [NAD(+)]) | EBI-2838000 | 0.00 |
Q14457 | Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa] | EBI-3257986 | 0.35 |
P31016 | Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90) | EBI-7966630 | 0.44 |
Q09472 | Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) | EBI-8632299 | 0.50 |
Q8IUQ4 | E3 ubiquitin-protein ligase SIAH1 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase SIAH1) (Seven in absentia homolog 1) (Siah-1) (Siah-1a) | EBI-10261292 | 0.56 |
P67870 | Casein kinase II subunit beta (CK II beta) (Phosvitin) (Protein G5a) | EBI-7137665 | 0.37 |
Q13387 | C-Jun-amino-terminal kinase-interacting protein 2 (JIP-2) (JNK-interacting protein 2) (Islet-brain-2) (IB-2) (JNK MAP kinase scaffold protein 2) (Mitogen-activated protein kinase 8-interacting protein 2) | EBI-7240832 | 0.37 |
P53350 | Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13) | EBI-7314465 | 0.37 |
Q8NEY8 | Periphilin-1 (CDC7 expression repressor) (CR) (Gastric cancer antigen Ga50) | EBI-7317291 | 0.37 |
Q8TEW0 | Partitioning defective 3 homolog (PAR-3) (PARD-3) (Atypical PKC isotype-specific-interacting protein) (ASIP) (CTCL tumor antigen se2-5) (PAR3-alpha) | EBI-6911368 | 0.53 |
A6NKD9 | Coiled-coil domain-containing protein 85C | EBI-6911368 | 0.35 |
P41236 | Protein phosphatase inhibitor 2 (IPP-2) | EBI-6911368 | 0.35 |
O75901 | Ras association domain-containing protein 9 (PAM COOH-terminal interactor protein 1) (P-CIP1) (Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor) | EBI-6911368 | 0.35 |
Q9H3G5 | Probable serine carboxypeptidase CPVL (EC 3.4.16.-) (Carboxypeptidase, vitellogenic-like) (Vitellogenic carboxypeptidase-like protein) (VCP-like protein) (hVLP) | EBI-6911368 | 0.35 |
P34932 | Heat shock 70 kDa protein 4 (HSP70RY) (Heat shock 70-related protein APG-2) | EBI-6911368 | 0.35 |
P62140 | Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53) | EBI-6911368 | 0.67 |
Q8NHQ8 | Ras association domain-containing protein 8 (Carcinoma-associated protein HOJ-1) | EBI-6911368 | 0.53 |
Q92598 | Heat shock protein 105 kDa (Antigen NY-CO-25) (Heat shock 110 kDa protein) | EBI-6911368 | 0.35 |
Q02833 | Ras association domain-containing protein 7 (HRAS1-related cluster protein 1) | EBI-6911368 | 0.35 |
Q15834 | Coiled-coil domain-containing protein 85B (Hepatitis delta antigen-interacting protein A) (Delta-interacting protein A) | EBI-6911368 | 0.35 |
P04083 | Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) [Cleaved into: Annexin Ac2-26] | EBI-6911368 | 0.35 |
A6NK89 | Ras association domain-containing protein 10 | EBI-6912271 | 0.35 |
P31946 | 14-3-3 protein beta/alpha (Protein 1054) (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein beta/alpha, N-terminally processed] | EBI-8796749 | 0.35 |
Q9Y2J4 | Angiomotin-like protein 2 (Leman coiled-coil protein) (LCCP) | EBI-8797381 | 0.35 |
Q7TSJ6 | Serine/threonine-protein kinase LATS2 (EC 2.7.11.1) (Kinase phosphorylated during mitosis protein) (Large tumor suppressor homolog 2) (Serine/threonine-protein kinase kpm) | EBI-8798662 | 0.27 |
Q4VCS5 | Angiomotin | EBI-8799893 | 0.27 |
Q2TBE0 | CWF19-like protein 2 | EBI-10175037 | 0.56 |
Q8WWY3 | U4/U6 small nuclear ribonucleoprotein Prp31 (Pre-mRNA-processing factor 31) (Serologically defined breast cancer antigen NY-BR-99) (U4/U6 snRNP 61 kDa protein) (Protein 61K) (hPrp31) | EBI-10177388 | 0.56 |
O14777 | Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC) | EBI-10181501 | 0.56 |
P17031 | Zinc finger protein 26 (Zinc finger protein KOX20) | EBI-10199685 | 0.56 |
P40222 | Alpha-taxilin | EBI-10207929 | 0.56 |
P56279 | T-cell leukemia/lymphoma protein 1A (Oncogene TCL-1) (Oncogene TCL1) (Protein p14 TCL1) | EBI-10215275 | 0.56 |
P57075 | Ubiquitin-associated and SH3 domain-containing protein A (Cbl-interacting protein 4) (CLIP4) (Suppressor of T-cell receptor signaling 2) (STS-2) (T-cell ubiquitin ligand 1) (TULA-1) | EBI-10215824 | 0.56 |
P61968 | LIM domain transcription factor LMO4 (Breast tumor autoantigen) (LIM domain only protein 4) (LMO-4) | EBI-10219004 | 0.56 |
P62807 | Histone H2B type 1-C/E/F/G/I (Histone H2B.1 A) (Histone H2B.a) (H2B/a) (Histone H2B.g) (H2B/g) (Histone H2B.h) (H2B/h) (Histone H2B.k) (H2B/k) (Histone H2B.l) (H2B/l) | EBI-10219796 | 0.56 |
P62875 | DNA-directed RNA polymerases I, II, and III subunit RPABC5 (RNA polymerases I, II, and III subunit ABC5) (DNA-directed RNA polymerase III subunit L) (RNA polymerase II 7.6 kDa subunit) (RPB7.6) (RPB10 homolog) | EBI-10219932 | 0.56 |
P62993 | Growth factor receptor-bound protein 2 (Adapter protein GRB2) (Protein Ash) (SH2/SH3 adapter GRB2) | EBI-10220253 | 0.56 |
Q86Y26 | NUT family member 1 (Nuclear protein in testis) | EBI-10230509 | 0.56 |
Q494U1 | Pleckstrin homology domain-containing family N member 1 (PH domain-containing family N member 1) (Cardiolipin and phosphatidic acid-binding protein) | EBI-10241572 | 0.56 |
Q53HC0 | Coiled-coil domain-containing protein 92 (Limkain beta-2) | EBI-10242635 | 0.56 |
Q8N5A5 | Zinc finger CCCH-type with G patch domain-containing protein (G patch domain-containing protein 6) (Zinc finger CCCH domain-containing protein 9) (Zinc finger and G patch domain-containing protein) | EBI-10265979 | 0.56 |
Q8N5M1 | ATP synthase mitochondrial F1 complex assembly factor 2 (ATP12 homolog) | EBI-10266628 | 0.56 |
Q8NCE2 | Myotubularin-related protein 14 (EC 3.1.3.-) (HCV NS5A-transactivated protein 4 splice variant A-binding protein 1) (NS5ATP4ABP1) (hJumpy) | EBI-10269256 | 0.56 |
Q92844 | TRAF family member-associated NF-kappa-B activator (TRAF-interacting protein) (I-TRAF) | EBI-10279575 | 0.56 |
Q96DC9 | Ubiquitin thioesterase OTUB2 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB2) (OTU domain-containing ubiquitin aldehyde-binding protein 2) (Otubain-2) (Ubiquitin-specific-processing protease OTUB2) | EBI-10284602 | 0.56 |
Q96GG9 | DCN1-like protein 1 (DCNL1) (DCUN1 domain-containing protein 1) (Defective in cullin neddylation protein 1-like protein 1) (Squamous cell carcinoma-related oncogene) | EBI-10286368 | 0.56 |
Q9BUJ2 | Heterogeneous nuclear ribonucleoprotein U-like protein 1 (Adenovirus early region 1B-associated protein 5) (E1B-55 kDa-associated protein 5) (E1B-AP5) | EBI-10298924 | 0.56 |
Q9NU19 | TBC1 domain family member 22B | EBI-10313701 | 0.56 |
Q9UQB8 | Brain-specific angiogenesis inhibitor 1-associated protein 2 (BAI-associated protein 2) (BAI1-associated protein 2) (Protein BAP2) (Fas ligand-associated factor 3) (FLAF3) (Insulin receptor substrate p53/p58) (IRS-58) (IRSp53/58) (Insulin receptor substrate protein of 53 kDa) (IRSp53) (Insulin receptor substrate p53) | EBI-10324972 | 0.56 |
Q9Y2D8 | Afadin- and alpha-actinin-binding protein (ADIP) (Afadin DIL domain-interacting protein) (SSX2-interacting protein) | EBI-10326054 | 0.56 |
Q96J02 | E3 ubiquitin-protein ligase Itchy homolog (Itch) (EC 2.3.2.26) (Atrophin-1-interacting protein 4) (AIP4) (HECT-type E3 ubiquitin transferase Itchy homolog) (NFE2-associated polypeptide 1) (NAPP1) | EBI-10635597 | 0.40 |
Q9BYG5 | Partitioning defective 6 homolog beta (PAR-6 beta) (PAR-6B) | EBI-11002976 | 0.35 |
Q9NPB6 | Partitioning defective 6 homolog alpha (PAR-6) (PAR-6 alpha) (PAR-6A) (PAR6C) (Tax interaction protein 40) (TIP-40) | EBI-11011731 | 0.35 |
Q9JK83 | Partitioning defective 6 homolog beta (PAR-6 beta) (PAR-6B) | EBI-11052294 | 0.35 |
P46938 | Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog) | EBI-11138299 | 0.35 |
O75665 | Centriole and centriolar satellite protein OFD1 (Oral-facial-digital syndrome 1 protein) (Protein 71-7A) | EBI-11365691 | 0.27 |
Q15154 | Pericentriolar material 1 protein (PCM-1) (hPCM-1) | EBI-11366535 | 0.27 |
Q5BJF6 | Outer dense fiber protein 2 (Cenexin) (Outer dense fiber of sperm tails protein 2) | EBI-11367291 | 0.27 |
Q5JU00 | Dynein regulatory complex subunit 5 (T-complex-associated testis-expressed protein 1) (Tcte-1) | EBI-11367780 | 0.27 |
Q6ZU80 | Centrosomal protein of 128 kDa (Cep128) | EBI-11370150 | 0.27 |
Q7Z7A1 | Centriolin (Centrosomal protein 1) (Centrosomal protein of 110 kDa) (Cep110) | EBI-11371427 | 0.27 |
Q8N4C6 | Ninein (hNinein) (Glycogen synthase kinase 3 beta-interacting protein) (GSK3B-interacting protein) | EBI-11374469 | 0.27 |
Q8TES7 | Fas-binding factor 1 (FBF-1) (Protein albatross) | EBI-11374846 | 0.27 |
Q96KN7 | X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 (RPGR-interacting protein 1) | EBI-11376202 | 0.27 |
Q96NL6 | Sodium channel and clathrin linker 1 (Sodium channel-associated protein 1) | EBI-11376636 | 0.27 |
Q96ST8 | Centrosomal protein of 89 kDa (Cep89) (Centrosomal protein 123) (Cep123) (Coiled-coil domain-containing protein 123) | EBI-11377220 | 0.27 |
Q9Y2I6 | Ninein-like protein | EBI-11379511 | 0.27 |
O60308 | Centrosomal protein of 104 kDa (Cep104) | EBI-11380299 | 0.27 |
O94986 | Centrosomal protein of 152 kDa (Cep152) | EBI-11381405 | 0.27 |
Q5TB80 | Centrosomal protein of 162 kDa (Cep162) (Protein QN1 homolog) | EBI-11385924 | 0.27 |
Q66GS9 | Centrosomal protein of 135 kDa (Cep135) (Centrosomal protein 4) | EBI-11386281 | 0.27 |
Q68CZ1 | Protein fantom (Nephrocystin-8) (RPGR-interacting protein 1-like protein) (RPGRIP1-like protein) | EBI-11386978 | 0.27 |
Q8IW35 | Centrosomal protein of 97 kDa (Cep97) (Leucine-rich repeat and IQ domain-containing protein 2) | EBI-11391901 | 0.27 |
Q8N137 | Centrobin (Centrosomal BRCA2-interacting protein) (LYST-interacting protein 8) | EBI-11392655 | 0.27 |
Q8N960 | Centrosomal protein of 120 kDa (Cep120) (Coiled-coil domain-containing protein 100) | EBI-11393386 | 0.27 |
Q9C0F1 | Centrosomal protein of 44 kDa (Cep44) (HBV PreS1-transactivated protein 3) (PS1TP3) | EBI-11397104 | 0.27 |
Q9HC77 | Centromere protein J (CENP-J) (Centrosomal P4.1-associated protein) (LAG-3-associated protein) (LYST-interacting protein 1) | EBI-11397411 | 0.27 |
Q15435 | Protein phosphatase 1 regulatory subunit 7 (Protein phosphatase 1 regulatory subunit 22) | EBI-12451625 | 0.51 |
O43295 | SLIT-ROBO Rho GTPase-activating protein 3 (srGAP3) (Mental disorder-associated GAP) (Rho GTPase-activating protein 14) (WAVE-associated Rac GTPase-activating protein) (WRP) | EBI-21563971 | 0.35 |
Q7Z4N8 | Prolyl 4-hydroxylase subunit alpha-3 (4-PH alpha-3) (EC 1.14.11.2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-3) | EBI-21583801 | 0.35 |
Q86YM7 | Homer protein homolog 1 (Homer-1) | EBI-21671273 | 0.35 |
Q9UMS4 | Pre-mRNA-processing factor 19 (EC 2.3.2.27) (Nuclear matrix protein 200) (PRP19/PSO4 homolog) (hPso4) (RING-type E3 ubiquitin transferase PRP19) (Senescence evasion factor) | EBI-21763056 | 0.35 |
Q96ES7 | SAGA-associated factor 29 (Coiled-coil domain-containing protein 101) (SAGA complex-associated factor 29) | EBI-21781962 | 0.35 |
Q96NE9 | FERM domain-containing protein 6 (Willin) | EBI-21880697 | 0.35 |
P61981 | 14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed] | EBI-21905461 | 0.35 |
Q8N3R9 | Protein PALS1 (MAGUK p55 subfamily member 5) (Membrane protein, palmitoylated 5) (Protein associated with Lin-7 1) | EBI-21911830 | 0.35 |
Q9H3D4 | Tumor protein 63 (p63) (Chronic ulcerative stomatitis protein) (CUSP) (Keratinocyte transcription factor KET) (Transformation-related protein 63) (TP63) (Tumor protein p73-like) (p73L) (p40) (p51) | EBI-15685239 | 0.44 |
O15350 | Tumor protein p73 (p53-like transcription factor) (p53-related protein) | EBI-15685344 | 0.44 |
P12830 | Cadherin-1 (CAM 120/80) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-16124887 | 0.35 |
P35222 | Catenin beta-1 (Beta-catenin) | EBI-16124887 | 0.58 |
Q05086 | Ubiquitin-protein ligase E3A (EC 2.3.2.26) (E6AP ubiquitin-protein ligase) (HECT-type ubiquitin transferase E3A) (Human papillomavirus E6-associated protein) (Oncogenic protein-associated protein E6-AP) (Renal carcinoma antigen NY-REN-54) | EBI-16814851 | 0.35 |
P16403 | Histone H1.2 (Histone H1c) (Histone H1d) (Histone H1s-1) | EBI-20919284 | 0.40 |
Q15149 | Plectin (PCN) (PLTN) (Hemidesmosomal protein 1) (HD1) (Plectin-1) | EBI-20926194 | 0.40 |
Q9NPJ6 | Mediator of RNA polymerase II transcription subunit 4 (Activator-recruited cofactor 36 kDa component) (ARC36) (Mediator complex subunit 4) (TRAP/SMCC/PC2 subunit p36 subunit) (Vitamin D3 receptor-interacting protein complex 36 kDa component) (DRIP36) | EBI-25472202 | 0.27 |
Q6NSK7 | RIN3 protein | EBI-21387894 | 0.00 |
P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
P46934 | E3 ubiquitin-protein ligase NEDD4 (EC 2.3.2.26) (Cell proliferation-inducing gene 53 protein) (HECT-type E3 ubiquitin transferase NEDD4) (Neural precursor cell expressed developmentally down-regulated protein 4) (NEDD-4) | EBI-30832503 | 0.44 |
P11362 | Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331) | EBI-32721578 | 0.27 |
Database | Links |
UNIPROT | Q13625 B4DG66 Q12892 Q86X75 Q96KQ3 |
PDB | 1YCS 2UWQ 4A63 4IRV 6GHM 6HKP |
Pfam | PF12796 PF00018 |
PROSITE | PS50297 PS50088 PS50002 |
OMIM | 602143 |
DisGeNET | 7159 |