Protein Information |
|
|---|---|
| Protein Name | Translin-associated protein X |
| Accession Code | Q99598 |
| Gene | TSNAX |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 290) | |
|
MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSA PDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDNG KENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVS KKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS |
|
Structure Viewer (PDB: 3QB5) |
|---|
Description |
||
|---|---|---|
| Cytoplasm, perinuclear region. Golgi apparatus {By Similarity}. Nucleus. Note=Accumulate in the Golgi complex of mid- late pachytene spermatocytes (By similarity). Expressed in the cytoplasm in the presence of TSN. {By Similarity}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) Endoribonuclease Complex (GO:1902555) Golgi Apparatus (GO:0005794) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) |
|
Description |
|
|---|---|
| Acts in combination with TSN as an endonuclease involved in the activation of the RNA-induced silencing complex (RISC). Possible role in spermatogenesis. {Experimental EvidencePubMed:12036294, Experimental EvidencePubMed:21552258}. | Assigned Ontology terms |
| Biological Process | Cell Differentiation (GO:0030154) SiRNA Processing (GO:0030422) Spermatogenesis (GO:0007283) |
| Molecular Function | A2A Adenosine Receptor Binding (GO:0031687) DNA Binding (GO:0003677) Endoribonuclease Activity (GO:0004521) Metal Ion Binding (GO:0046872) Protein-Containing Complex Binding (GO:0044877) RNA Binding (GO:0003723) Sequence-Specific DNA Binding (GO:0043565) Single-Stranded DNA Binding (GO:0003697) |
Interactions with Nuclear Envelope proteins (10 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| Q99598 | Self | EBI-7635031 | 0.22 |
| P41208 | Centrin-2 | EBI-11044893 | 0.35 |
| Q07065 | Cytoskeleton-associated protein 4 | EBI-3936346 | 0.37 |
| O75190 | DnaJ homolog subfamily B member 6 | EBI-25909865 | 0.56 |
| Q53GS7 | mRNA export factor GLE1 | EBI-25859066 | 0.56 |
| Q92993 | Histone acetyltransferase KAT5 | EBI-25912186 | 0.56 |
| P07948 | Tyrosine-protein kinase Lyn | EBI-11044893 | 0.35 |
| P35240 | Merlin | EBI-25878206 | 0.56 |
| Q9BVL2 | Nucleoporin p58/p45 | EBI-25907995 | 0.56 |
| P01112 | GTPase HRas, N-terminally processed | EBI-25868927 | 0.56 | Interactions with other proteins (125 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q15631 | Translin (EC 3.1.-.-) (Component 3 of promoter of RISC) (C3PO) | EBI-7635091 | 0.90 |
| O95257 | Growth arrest and DNA damage-inducible protein GADD45 gamma (Cytokine-responsive protein CR6) (DNA damage-inducible transcript 2 protein) (DDIT-2) | EBI-753271 | 0.67 |
| Q96AQ6 | Pre-B-cell leukemia transcription factor-interacting protein 1 (Hematopoietic PBX-interacting protein) | EBI-756436 | 0.37 |
| Q96HT8 | MORF4 family-associated protein 1-like 1 | EBI-757081 | 0.37 |
| Q14164 | Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i) | EBI-1081213 | 0.00 |
| Q96GY3 | Protein lin-37 homolog (Antolefinin) | EBI-1389981 | 0.35 |
| Q86SE5 | RNA-binding Raly-like protein (hRALYL) (Heterogeneous nuclear ribonucleoprotein C-like 3) (hnRNP core protein C-like 3) | EBI-2320509 | 0.37 |
| Q09019 | Dystrophia myotonica WD repeat-containing protein (Dystrophia myotonica-containing WD repeat motif protein) (Protein 59) (Protein DMR-N9) | EBI-2515767 | 0.40 |
| Q00987 | E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) | EBI-2685764 | 0.00 |
| Q5NHY7 | Fumarate hydratase class II (Fumarase C) (EC 4.2.1.2) (Aerobic fumarase) (Iron-independent fumarase) | EBI-2800088 | 0.00 |
| Q5NIJ6 | Citrate synthase | EBI-2800081 | 0.00 |
| A0A6L8PNZ7 | DUF664 domain-containing protein | EBI-2812187 | 0.00 |
| A0A6L8PSD4 | Glycosyl transferase, group 1 family protein | EBI-2813947 | 0.00 |
| A0A6L7HFM3 | Pyruvate carboxylase (EC 6.4.1.1) | EBI-2819985 | 0.00 |
| A0A6L7H9A7 | UvrABC system protein A (UvrA protein) (Excinuclease ABC subunit A) | EBI-2819971 | 0.00 |
| A0A6L8PSA0 | Putative aminoglycoside 6-adenylyltransferase | EBI-2819978 | 0.00 |
| A0A2B8HUE3 | Organic hydroperoxide resistance protein | EBI-2819964 | 0.00 |
| P40127 | Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase) | EBI-2844107 | 0.00 |
| Q8CZK5 | Biphosphate aldolase (Putative class-II fructose-bisphosphate aldolase) | EBI-2851318 | 0.00 |
| Q09472 | Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A-associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1.-) (Histone crotonyltransferase p300) (EC 2.3.1.-) (Protein 2-hydroxyisobutyryltransferase p300) (EC 2.3.1.-) (Protein lactyltransferas p300) (EC 2.3.1.-) (Protein propionyltransferase p300) (EC 2.3.1.-) | EBI-3940497 | 0.37 |
| Q6P597 | Kinesin light chain 3 (KLC2-like) (kinesin light chain 2) | EBI-25263666 | 0.63 |
| Q8TDH9 | Biogenesis of lysosome-related organelles complex 1 subunit 5 (BLOC-1 subunit 5) (Protein Muted homolog) | EBI-10274996 | 0.72 |
| Q12904 | Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (Multisynthase complex auxiliary component p43) [Cleaved into: Endothelial monocyte-activating polypeptide 2 (EMAP-2) (Endothelial monocyte-activating polypeptide II) (EMAP-II) (Small inducible cytokine subfamily E member 1)] | EBI-10294455 | 0.56 |
| Q99081 | Transcription factor 12 (TCF-12) (Class B basic helix-loop-helix protein 20) (bHLHb20) (DNA-binding protein HTF4) (E-box-binding protein) (Transcription factor HTF-4) | EBI-10294477 | 0.56 |
| Q9BRK4 | Leucine zipper putative tumor suppressor 2 (hLZTS2) (Protein LAPSER1) | EBI-10294487 | 0.56 |
| Q9H257 | Caspase recruitment domain-containing protein 9 (hCARD9) | EBI-10294499 | 0.56 |
| P62070 | Ras-related protein R-Ras2 (EC 3.6.5.-) (Ras-like protein TC21) (Teratocarcinoma oncogene) | EBI-11044893 | 0.35 |
| O60506 | Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) (Glycine- and tyrosine-rich RNA-binding protein) (GRY-RBP) (NS1-associated protein 1) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) | EBI-11044893 | 0.35 |
| P07686 | Beta-hexosaminidase subunit beta (EC 3.2.1.52) (Beta-N-acetylhexosaminidase subunit beta) (Hexosaminidase subunit B) (Cervical cancer proto-oncogene 7 protein) (HCC-7) (N-acetyl-beta-glucosaminidase subunit beta) [Cleaved into: Beta-hexosaminidase subunit beta chain B; Beta-hexosaminidase subunit beta chain A] | EBI-11044893 | 0.35 |
| Q5BKY9 | Protein FAM133B | EBI-11044893 | 0.35 |
| P06241 | Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn) | EBI-11044893 | 0.35 |
| O15427 | Monocarboxylate transporter 4 (MCT 4) (Solute carrier family 16 member 3) | EBI-11044893 | 0.35 |
| O75223 | Gamma-glutamylcyclotransferase (EC 4.3.2.9) (Cytochrome c-releasing factor 21) | EBI-11044893 | 0.35 |
| O00139 | Kinesin-like protein KIF2A (Kinesin-2) (hK2) | EBI-11044893 | 0.35 |
| Q9HBH1 | Peptide deformylase, mitochondrial (EC 3.5.1.88) (Polypeptide deformylase) | EBI-11044893 | 0.35 |
| Q02040 | A-kinase anchor protein 17A (AKAP-17A) (721P) (B-lymphocyte antigen) (Protein XE7) (Protein kinase A-anchoring protein 17A) (PRKA17A) (Splicing factor, arginine/serine-rich 17A) | EBI-11044893 | 0.35 |
| O43929 | Origin recognition complex subunit 4 | EBI-11044893 | 0.35 |
| P63167 | Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) | EBI-11044893 | 0.35 |
| Q5T7B8 | Kinesin-like protein KIF24 | EBI-11044893 | 0.35 |
| P14373 | Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (RING-type E3 ubiquitin transferase TRIM27) (Ret finger protein) (Tripartite motif-containing protein 27) | EBI-11044893 | 0.35 |
| Q14165 | Malectin | EBI-11044893 | 0.35 |
| Q15024 | Exosome complex component RRP42 (Exosome component 7) (Ribosomal RNA-processing protein 42) (p8) | EBI-11044893 | 0.35 |
| O95985 | DNA topoisomerase 3-beta-1 (EC 5.6.2.1) (DNA topoisomerase III beta-1) | EBI-11044893 | 0.35 |
| Q9H857 | 5'-nucleotidase domain-containing protein 2 (EC 3.1.3.-) | EBI-11044893 | 0.35 |
| P83876 | Thioredoxin-like protein 4A (DIM1 protein homolog) (Spliceosomal U5 snRNP-specific 15 kDa protein) (Thioredoxin-like U5 snRNP protein U5-15kD) | EBI-11044893 | 0.35 |
| Q92817 | Envoplakin (210 kDa cornified envelope precursor protein) (210 kDa paraneoplastic pemphigus antigen) (p210) | EBI-11044893 | 0.35 |
| Q5VYK3 | Proteasome adapter and scaffold protein ECM29 (Ecm29 proteasome adapter and scaffold) (Proteasome-associated protein ECM29 homolog) | EBI-11044893 | 0.35 |
| O60218 | Aldo-keto reductase family 1 member B10 (EC 1.1.1.300) (EC 1.1.1.54) (ARL-1) (Aldose reductase-like) (Aldose reductase-related protein) (ARP) (hARP) (Small intestine reductase) (SI reductase) | EBI-11044893 | 0.35 |
| Q03060 | cAMP-responsive element modulator (Inducible cAMP early repressor) (ICER) | EBI-11044893 | 0.35 |
| Q15058 | Kinesin-like protein KIF14 | EBI-11044893 | 0.35 |
| Q15544 | Transcription initiation factor TFIID subunit 11 (TFIID subunit p30-beta) (Transcription initiation factor TFIID 28 kDa subunit) (TAF(II)28) (TAFII-28) (TAFII28) | EBI-11044893 | 0.35 |
| Q96DV4 | 39S ribosomal protein L38, mitochondrial (L38mt) (MRP-L38) (Mitochondrial large ribosomal subunit protein mL38) | EBI-11044893 | 0.35 |
| O75947 | ATP synthase subunit d, mitochondrial (ATPase subunit d) (ATP synthase peripheral stalk subunit d) | EBI-11044893 | 0.35 |
| Q2TAY7 | WD40 repeat-containing protein SMU1 (Smu-1 suppressor of mec-8 and unc-52 protein homolog) [Cleaved into: WD40 repeat-containing protein SMU1, N-terminally processed] | EBI-11044893 | 0.35 |
| Q92552 | 28S ribosomal protein S27, mitochondrial (MRP-S27) (S27mt) (Mitochondrial ribosomal protein S27) (Mitochondrial small ribosomal subunit protein mS27) | EBI-11044893 | 0.35 |
| Q9BTL3 | RNA guanine-N7 methyltransferase activating subunit (Protein FAM103A1) (RNA guanine-7 methyltransferase activating subunit) (RNMT-activating mRNA cap methyltransferase subunit) (RNMT-activating mini protein) (RAM) | EBI-11044893 | 0.35 |
| Q9BXY0 | Protein MAK16 homolog (NNP78) (Protein RBM13) | EBI-11044893 | 0.35 |
| Q9UBK8 | Methionine synthase reductase (MSR) (EC 1.16.1.8) (Aquacobalamin reductase) (AqCbl reductase) | EBI-11044893 | 0.35 |
| Q9BQ70 | Transcription factor 25 (TCF-25) (Nuclear localized protein 1) | EBI-11044893 | 0.35 |
| O43251 | RNA binding protein fox-1 homolog 2 (Fox-1 homolog B) (Hexaribonucleotide-binding protein 2) (RNA-binding motif protein 9) (RNA-binding protein 9) (Repressor of tamoxifen transcriptional activity) | EBI-11044893 | 0.35 |
| Q06830 | Peroxiredoxin-1 (EC 1.11.1.24) (Natural killer cell-enhancing factor A) (NKEF-A) (Proliferation-associated gene protein) (PAG) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Thioredoxin-dependent peroxiredoxin 1) | EBI-11044893 | 0.35 |
| Q5T280 | Putative methyltransferase C9orf114 (EC 2.1.1.-) (Centromere protein 32) (CENP-32) (Kinetochore-associated protein) (SPOUT domain-containing methyltransferase 1) | EBI-11044893 | 0.35 |
| F8W6N3 | Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12) | EBI-11044893 | 0.35 |
| P23396 | 40S ribosomal protein S3 (EC 4.2.99.18) (Small ribosomal subunit protein uS3) | EBI-11044893 | 0.35 |
| O94964 | Protein SOGA1 (SOGA family member 1) (Suppressor of glucose by autophagy) (Suppressor of glucose, autophagy-associated protein 1) [Cleaved into: N-terminal form; C-terminal 80 kDa form (80-kDa SOGA fragment)] | EBI-25257469 | 0.56 |
| P51114 | RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p) | EBI-11044893 | 0.35 |
| Q9NY12 | H/ACA ribonucleoprotein complex subunit 1 (Nucleolar protein family A member 1) (snoRNP protein GAR1) | EBI-11044893 | 0.35 |
| Q16514 | Transcription initiation factor TFIID subunit 12 (Transcription initiation factor TFIID 20/15 kDa subunits) (TAFII-20/TAFII-15) (TAFII20/TAFII15) | EBI-11044893 | 0.35 |
| Q5VTR2 | E3 ubiquitin-protein ligase BRE1A (BRE1-A) (hBRE1) (EC 2.3.2.27) (RING finger protein 20) (RING-type E3 ubiquitin transferase BRE1A) | EBI-11044893 | 0.35 |
| O75400 | Pre-mRNA-processing factor 40 homolog A (Fas ligand-associated factor 1) (Formin-binding protein 11) (Formin-binding protein 3) (Huntingtin yeast partner A) (Huntingtin-interacting protein 10) (HIP-10) (Huntingtin-interacting protein A) (Renal carcinoma antigen NY-REN-6) | EBI-11044893 | 0.35 |
| P62258 | 14-3-3 protein epsilon (14-3-3E) | EBI-11044893 | 0.35 |
| P04003 | C4b-binding protein alpha chain (C4bp) (Proline-rich protein) (PRP) | EBI-11044893 | 0.35 |
| Q15029 | 116 kDa U5 small nuclear ribonucleoprotein component (Elongation factor Tu GTP-binding domain-containing protein 2) (SNU114 homolog) (hSNU114) (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa) | EBI-11044893 | 0.35 |
| Q69YN4 | Protein virilizer homolog | EBI-11044893 | 0.35 |
| H7C1U3 | Coiled-coil and C2 domain-containing protein 1B | EBI-11044893 | 0.35 |
| O75340 | Programmed cell death protein 6 (Apoptosis-linked gene 2 protein homolog) (ALG-2) | EBI-11044893 | 0.35 |
| Q01081 | Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) | EBI-11044893 | 0.35 |
| P36896 | Activin receptor type-1B (EC 2.7.11.30) (Activin receptor type IB) (ACTR-IB) (Activin receptor-like kinase 4) (ALK-4) (Serine/threonine-protein kinase receptor R2) (SKR2) | EBI-11044893 | 0.35 |
| Q08378 | Golgin subfamily A member 3 (Golgi complex-associated protein of 170 kDa) (GCP170) (Golgin-160) | EBI-11044893 | 0.35 |
| P17858 | ATP-dependent 6-phosphofructokinase, liver type (ATP-PFK) (PFK-L) (EC 2.7.1.11) (6-phosphofructokinase type B) (Phosphofructo-1-kinase isozyme B) (PFK-B) (Phosphohexokinase) | EBI-11044893 | 0.35 |
| P51116 | RNA-binding protein FXR2 (FMR1 autosomal homolog 2) | EBI-11044893 | 0.35 |
| Q9BZD4 | Kinetochore protein Nuf2 (hNuf2) (hNuf2R) (hsNuf2) (Cell division cycle-associated protein 1) | EBI-11044893 | 0.35 |
| Q6ZU80 | Centrosomal protein of 128 kDa (Cep128) | EBI-21647598 | 0.35 |
| P48606 | Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) | EBI-11532699 | 0.56 |
| Q96HA8 | Protein N-terminal glutamine amidohydrolase (EC 3.5.1.122) (Protein NH2-terminal glutamine deamidase) (N-terminal Gln amidase) (Nt(Q)-amidase) (WDYHV motif-containing protein 1) | EBI-24331255 | 0.56 |
| Q9UK41 | Vacuolar protein sorting-associated protein 28 homolog (H-Vps28) (ESCRT-I complex subunit VPS28) | EBI-24345182 | 0.56 |
| Q4V328 | GRIP1-associated protein 1 (GRASP-1) [Cleaved into: GRASP-1 C-terminal chain (30kDa C-terminus form)] | EBI-24489906 | 0.56 |
| O95751 | Protein LDOC1 (Leucine zipper protein down-regulated in cancer cells) | EBI-24498070 | 0.56 |
| Q15323 | Keratin, type I cuticular Ha1 (Hair keratin, type I Ha1) (Keratin-31) (K31) | EBI-24502549 | 0.56 |
| Q7Z698 | Sprouty-related, EVH1 domain-containing protein 2 (Spred-2) | EBI-24507839 | 0.56 |
| Q76N32 | Centrosomal protein of 68 kDa (Cep68) | EBI-24509377 | 0.56 |
| P26583 | High mobility group protein B2 (High mobility group protein 2) (HMG-2) | EBI-24528704 | 0.56 |
| Q9NW75 | G patch domain-containing protein 2 | EBI-24732854 | 0.56 |
| Q6PIF2 | Synaptonemal complex central element protein 2 (Central element synaptonemal complex protein 1) | EBI-24736580 | 0.56 |
| P40937 | Replication factor C subunit 5 (Activator 1 36 kDa subunit) (A1 36 kDa subunit) (Activator 1 subunit 5) (Replication factor C 36 kDa subunit) (RF-C 36 kDa subunit) (RFC36) | EBI-24406909 | 0.56 |
| Q9Y2V7 | Conserved oligomeric Golgi complex subunit 6 (COG complex subunit 6) (Component of oligomeric Golgi complex 6) | EBI-24413259 | 0.56 |
| O43679 | LIM domain-binding protein 2 (LDB-2) (Carboxyl-terminal LIM domain-binding protein 1) (CLIM-1) (LIM domain-binding factor CLIM1) | EBI-24417525 | 0.67 |
| Q6P1K2 | Polyamine-modulated factor 1 (PMF-1) | EBI-24420500 | 0.67 |
| Q99633 | Pre-mRNA-splicing factor 18 (PRP18 homolog) (hPRP18) | EBI-24542654 | 0.56 |
| Q9BSW7 | Synaptotagmin-17 (Protein B/K) (Synaptotagmin XVII) (SytXVII) | EBI-24561089 | 0.56 |
| Q9NUJ3 | T-complex protein 11-like protein 1 | EBI-24572508 | 0.56 |
| Q00994 | Protein BEX3 (Brain-expressed X-linked protein 3) (Nerve growth factor receptor-associated protein 1) (Ovarian granulosa cell 13.0 kDa protein HGR74) (p75NTR-associated cell death executor) | EBI-24574129 | 0.56 |
| Q9Y6C2 | EMILIN-1 (Elastin microfibril interface-located protein 1) (Elastin microfibril interfacer 1) | EBI-24745963 | 0.56 |
| P0C862 | Complement C1q and tumor necrosis factor-related protein 9A (Complement C1q and tumor necrosis factor-related protein 9) | EBI-21600656 | 0.35 |
| Q9Y3F4 | Serine-threonine kinase receptor-associated protein (MAP activator with WD repeats) (UNR-interacting protein) (WD-40 repeat protein PT-WD) | EBI-21647598 | 0.35 |
| Q99666 | RANBP2-like and GRIP domain-containing protein 5/6 (Ran-binding protein 2-like 1/2) (RanBP2-like 1/2) (RanBP2L1) (RanBP2L2) (Sperm membrane protein BS-63) | EBI-21647598 | 0.35 |
| Q92540 | Nonsense-mediated mRNA decay factor SMG7 (SMG-7 homolog) (hSMG-7) | EBI-21647598 | 0.35 |
| O95613 | Pericentrin (Kendrin) (Pericentrin-B) | EBI-21647598 | 0.35 |
| O14715 | RANBP2-like and GRIP domain-containing protein 8 (Ran-binding protein 2-like 3) (RanBP2-like 3) (RanBP2L3) | EBI-21647598 | 0.35 |
| Q8IV20 | Purine nucleoside phosphorylase LACC1 (EC 2.4.2.1) (Adenosine deaminase LACC1) (EC 3.5.4.4) (Fatty acid metabolism-immunity nexus) (Guanosine phosphorylase LACC1) (Laccase domain-containing protein 1) (S-methyl-5'-thioadenosine phosphorylase LACC1) (EC 2.4.2.28) | EBI-21810059 | 0.35 |
| P25205 | DNA replication licensing factor MCM3 (EC 3.6.4.12) (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) (RLF subunit beta) (p102) | EBI-21865186 | 0.35 |
| Q9UKV8 | Protein argonaute-2 (Argonaute2) (hAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF-2C 2) (eIF2C 2) (PAZ Piwi domain protein) (PPD) (Protein slicer) | EBI-15925341 | 0.35 |
| O00499 | Myc box-dependent-interacting protein 1 (Amphiphysin II) (Amphiphysin-like protein) (Box-dependent myc-interacting protein 1) (Bridging integrator 1) | EBI-21387969 | 0.00 |
| P28329 | Choline O-acetyltransferase (CHOACTase) (ChAT) (Choline acetylase) (EC 2.3.1.6) | EBI-25837768 | 0.56 |
| P22607 | Fibroblast growth factor receptor 3 (FGFR-3) (EC 2.7.10.1) (CD antigen CD333) | EBI-25853632 | 0.56 |
| P14136 | Glial fibrillary acidic protein (GFAP) | EBI-25857834 | 0.56 |
| P06396 | Gelsolin (AGEL) (Actin-depolymerizing factor) (ADF) (Brevin) | EBI-25863662 | 0.56 |
| Q16637 | Survival motor neuron protein (Component of gems 1) (Gemin-1) | EBI-25891706 | 0.56 |
| Q9Y649 | GW128 | EBI-25900825 | 0.56 |
| P61981 | 14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed] | EBI-25902060 | 0.56 |
| P46379 | Large proline-rich protein BAG6 (BAG family molecular chaperone regulator 6) (BCL2-associated athanogene 6) (BAG-6) (HLA-B-associated transcript 3) (Protein G3) (Protein Scythe) | EBI-25903723 | 0.56 |
| O14901 | Krueppel-like factor 11 (Transforming growth factor-beta-inducible early growth response protein 2) (TGFB-inducible early growth response protein 2) (TIEG-2) | EBI-25904874 | 0.56 |
| Q15047 | Histone-lysine N-methyltransferase SETDB1 (EC 2.1.1.366) (ERG-associated protein with SET domain) (ESET) (Histone H3-K9 methyltransferase 4) (H3-K9-HMTase 4) (Lysine N-methyltransferase 1E) (SET domain bifurcated 1) | EBI-25909011 | 0.56 |
| Q8TAP4 | LIM domain only protein 3 (LMO-3) (Neuronal-specific transcription factor DAT1) (Rhombotin-3) | EBI-25925906 | 0.56 |
| Q7Z699 | Sprouty-related, EVH1 domain-containing protein 1 (Spred-1) (hSpred1) | EBI-25931052 | 0.56 |
Database | Links |
| UNIPROT | Q99598 B1APC6 |
| PDB | 3PJA 3QB5 |
| Pfam | PF01997 |
| OMIM | 602964 |
| DisGeNET | 7257 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory