Nucleoporin NDC1 - Homo sapiens

Nucleoporin NDC1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Nucleoporin NDC1
Accession Code	Q9BTX1
Gene	NDC1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 674)
MATAVSRPCAGRSRDILWRVLGWRIVASIVWSVLFLPICTTVFIIFSRIDLFHPIQWLSDSFSDLYSSYVIFYFLLLSVVIIIISIFNVEFYAVVPSIPCSRLALIGKIIHPQQLMHSFIHAAMGMVMAW CAAVITQGQYSFLVVPCTGTNSFGSPAAQTCLNEYHLFFLLTGAFMGYSYSLLYFVNNMNYLPFPIIQQYKFLRFRRSLLLLVKHSCVESLFLVRNFCILYYFLGYIPKAWISTAMNLHIDEQVHRPLDT VSGLLNLSLLYHVWLCGVFLLTTWYVSWILFKIYATEAHVFPVQPPFAEGSDECLPKVLNSNPPPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPHNWTAISRECLNLLNGMTQKLILYQEAAATN GRVSSSYPVEPKKLNSPEETAFQTPKSSQMPRPSVPPLVKTSLFSSKLSTPDVVSPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRRGPRLWTSASDQQMTEFSNPSPSTSISAEGKTMRQPSVIYS WIQNKREQIKNFLSKRVLIMYFFSKHPEASIQAVFSDAQMHIWALEGLSHLVAASFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVDTSYKTLRFAFRASLKTAIYRITTTFG EHLNAVQASAEHQKRLQQFLEFKE

Subcellular Location

Description
Nucleus, nuclear pore complex. Nucleus membrane; Multi-pass membrane protein. Note=Central core structure of the nuclear pore complex.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Actin Cytoskeleton (GO:0015629) Cytoplasm (GO:0005737) Membrane (GO:0016020) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Pore (GO:0005643) Nuclear Pore Transmembrane Ring (GO:0070762) Plasma Membrane (GO:0005886)

Biology & Function

Description
Component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. Required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane. {Experimental EvidencePubMed:16600873, Experimental EvidencePubMed:16702233}.
Assigned Ontology terms

Biological Process	Homologous Chromosome Pairing At Meiosis (GO:0007129) MRNA Transport (GO:0051028) Nuclear Pore Complex Assembly (GO:0051292) Nuclear Pore Localization (GO:0051664) Nuclear Pore Organization (GO:0006999) Nucleocytoplasmic Transport (GO:0006913) Protein Transport (GO:0015031) Spermatogenesis (GO:0007283)
Molecular Function	Protein-Macromolecule Adaptor Activity (GO:0030674) Structural Constituent Of Nuclear Pore (GO:0017056)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (14 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
A0A142I5B9	RNA-directed RNA polymerase NS5	EBI-20626314	0.35
P49790	Nuclear pore complex protein Nup153	EBI-11076796	0.35
P57740	Nuclear pore complex protein Nup107	EBI-11160436	0.35
P63279	SUMO-conjugating enzyme UBC9	EBI-11105225	0.35
Q6PFD9	Nuclear pore complex protein Nup96	EBI-10994876	0.35
Q8BH74	Nuclear pore complex protein Nup107	EBI-10997196	0.35
Q8VCB1	Nucleoporin NDC1	EBI-2560113	0.40
Q96EE3	Nucleoporin SEH1	EBI-11086798	0.35
Q99P88	Nuclear pore complex protein Nup155	EBI-10997466	0.35
Q9ERU9	E3 SUMO-protein ligase RanBP2	EBI-10999306	0.35
Q9BVL2	Nucleoporin p58/p45	EBI-11077390	0.35
O95476	CTD nuclear envelope phosphatase 1	EBI-27115722	0.27
Q8WTR4	Glycerophosphodiester phosphodiesterase domain-containing protein 5	EBI-21566764	0.35
Q14974	Importin subunit beta-1	EBI-11115566	0.35
Interactions with other proteins (44 interactors)

Partner (UniProt)		IntAct	Confidence score
Q8IYM1	Septin-12	EBI-10819461	0.37
P36895	Bone morphogenetic protein receptor type-1A (BMP type-1A receptor) (BMPR-1A) (EC 2.7.11.30) (Activin receptor-like kinase 3) (ALK-3) (BMP-2/BMP-4 receptor) (Serine/threonine-protein kinase receptor R5) (SKR5) (CD antigen CD292)	EBI-11008521	0.35
Q8VE37	Regulator of chromosome condensation (Chromosome condensation protein 1)	EBI-11043815	0.35
P63280	SUMO-conjugating enzyme UBC9 (EC 2.3.2.-) (RING-type E3 SUMO transferase UBC9) (SUMO-protein ligase) (Ubiquitin carrier protein 9) (mUBC9) (Ubiquitin carrier protein I) (Ubiquitin-conjugating enzyme E2 I) (Ubiquitin-protein ligase I)	EBI-11044140	0.35
Q6NUS6	Tectonic-3	EBI-11368748	0.27
Q86X19	Transmembrane protein 17	EBI-11372615	0.27
Q96GX1	Tectonic-2	EBI-11375285	0.27
Q9P0N5	Transmembrane protein 216	EBI-11378021	0.27
Q86UK5	Limbin (Ellis-van Creveld syndrome protein 2) (EVC2)	EBI-11389870	0.27
Q8IWL3	Iron-sulfur cluster co-chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial]	EBI-13943458	0.35
O00322	Uroplakin-1a (UP1a) (Tetraspanin-21) (Tspan-21) (Uroplakin Ia) (UPIa) (UPKa)	EBI-21504674	0.35
P30825	High affinity cationic amino acid transporter 1 (CAT-1) (CAT1) (Ecotropic retroviral leukemia receptor homolog) (Ecotropic retrovirus receptor homolog) (Solute carrier family 7 member 1) (System Y+ basic amino acid transporter)	EBI-21505748	0.35
Q86UE6	Leucine-rich repeat transmembrane neuronal protein 1	EBI-21507777	0.35
Q9H8X2	Inositol-pentakisphosphate 2-kinase (EC 2.7.1.158) (IPK1 homolog) (Inositol-1,3,4,5,6-pentakisphosphate 2-kinase) (Ins(1,3,4,5,6)P5 2-kinase) (InsP5 2-kinase)	EBI-21509881	0.35
Q9Y282	Endoplasmic reticulum-Golgi intermediate compartment protein 3 (Serologically defined breast cancer antigen NY-BR-84)	EBI-21510632	0.35
P16444	Dipeptidase 1 (EC 3.4.13.19) (Beta-lactamase) (EC 3.5.2.6) (Dehydropeptidase-I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP)	EBI-21514808	0.35
Q16581	C3a anaphylatoxin chemotactic receptor (C3AR) (C3a-R)	EBI-21515265	0.35
Q6P5W5	Zinc transporter ZIP4 (Solute carrier family 39 member 4) (Zrt- and Irt-like protein 4) (ZIP-4)	EBI-21515976	0.35
P35414	Apelin receptor (Angiotensin receptor-like 1) (G-protein coupled receptor APJ) (G-protein coupled receptor HG11)	EBI-21559824	0.35
Q8WWF5	E3 ubiquitin-protein ligase ZNRF4 (EC 2.3.2.27) (Nixin) (RING finger protein 204) (RING-type E3 ubiquitin transferase ZNRF4) (Zinc/RING finger protein 4)	EBI-21589535	0.35
P62079	Tetraspanin-5 (Tspan-5) (Tetraspan NET-4) (Transmembrane 4 superfamily member 9)	EBI-21619035	0.35
Q6UWB1	Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Cytokine receptor WSX-1) (Cytokine receptor-like 1) (Type I T-cell cytokine receptor) (TCCR) (ZcytoR1)	EBI-21703330	0.35
P08754	Guanine nucleotide-binding protein G(i) subunit alpha-3 (G(i) alpha-3)	EBI-21709056	0.35
P28908	Tumor necrosis factor receptor superfamily member 8 (CD30L receptor) (Ki-1 antigen) (Lymphocyte activation antigen CD30) (CD antigen CD30)	EBI-21750180	0.35
Q9UQC9	Calcium-activated chloride channel regulator 2 (EC 3.4.-.-) (Calcium-activated chloride channel family member 2) (hCLCA2) (Calcium-activated chloride channel protein 3) (CaCC-3) (hCaCC-3) [Cleaved into: Calcium-activated chloride channel regulator 2, 109 kDa form; Calcium-activated chloride channel regulator 2, 35 kDa form]	EBI-21899358	0.40
P27824	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	EBI-16788621	0.27
E7ELX2	Genome polyprotein	EBI-20625922	0.35
A2A935	Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1)	EBI-21022882	0.35
P14404	Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog)	EBI-21026252	0.35
F5H1C8	Solute carrier family 15 member 3 (Solute carrier family 15, member 3, isoform CRA_a)	EBI-21264930	0.35
Q9H1C4	Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1)	EBI-21266770	0.35
Q15077	P2Y purinoceptor 6 (P2Y6)	EBI-21272198	0.35
P0DTD8	ORF7b protein (ORF7b) (Accessory protein 7b)	EBI-25687199	0.35
Q2TAZ0	Autophagy-related protein 2 homolog A	EBI-26443127	0.35
P01116	GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]	EBI-27041844	0.27
P01111	GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)	EBI-27042293	0.27
A0A0F6B5H5	Secreted effector protein	EBI-27033770	0.35
A0A0H3NB75	Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV)	EBI-27055718	0.42
Q9UM73	ALK tyrosine kinase receptor (EC 2.7.10.1) (Anaplastic lymphoma kinase) (CD antigen CD246)	EBI-32719830	0.27
P29322	Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK)	EBI-32721175	0.27
P08069	Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain]	EBI-32722947	0.27
P06213	Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta]	EBI-32723092	0.27
O15146	Muscle, skeletal receptor tyrosine-protein kinase (EC 2.7.10.1) (Muscle-specific tyrosine-protein kinase receptor) (MuSK) (Muscle-specific kinase receptor)	EBI-32724025	0.27
Q16288	NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)	EBI-32724526	0.27

Cross-References

Database	Links
UNIPROT	Q9BTX1 B4DHA3 B4DQQ5 G3XA81 Q8NB76 Q9H9T6 Q9NSG3 Q9NSG4 Q9NVZ7
Pfam	PF09531
OMIM	610115
DisGeNET	55706

Nucleoporin NDC1 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (14 interactors)

Interactions with other proteins (44 interactors)

Cross-References

Database

Links

Description

Description