Endoribonuclease Dicer - Homo sapiens

Endoribonuclease Dicer (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Endoribonuclease Dicer
Accession Code	Q9UPY3
Gene	DICER1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 1922)
MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKE LSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLK NGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDL VVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADK VAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEW YNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFIT GHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNY IMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCAR LPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETV KYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPRPDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTR CFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSLQMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLP LNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKF PSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAI HPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGVGVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDN YCKHSTIVPENAAHQGANRTSSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYDLANRDFCQGN QLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAVMPGTTDTIQVLKGRMDSEQS PSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLG KKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYED DFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSSLGSMPFSSDFEDFDYSSWDAMCYLDPSKAVEE DDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDRE KALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNK AYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKA VSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRP LIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVP NS

Structure Viewer (PDB: 4WYQ)

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:16424907}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:19022417}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) RISC Complex (GO:0016442) RISC-Loading Complex (GO:0070578)

Biology & Function

Description
Double-stranded RNA (dsRNA) endoribonuclease playing a central role in short dsRNA-mediated post-transcriptional gene silencing. Cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation. Gene silencing mediated by siRNAs, also called RNA interference, controls the elimination of transcripts from mobile and repetitive DNA elements of the genome but also the degradation of exogenous RNA of viral origin for instance. The miRNA pathway on the other side is a mean to specifically regulate the expression of target genes. {Experimental EvidencePubMed:15242644, Experimental EvidencePubMed:15973356, Experimental EvidencePubMed:16142218, Experimental EvidencePubMed:16271387, Experimental EvidencePubMed:16289642, Experimental EvidencePubMed:16357216, Experimental EvidencePubMed:16424907, Experimental EvidencePubMed:17452327, Experimental EvidencePubMed:18178619}.
Assigned Ontology terms

Biological Process	Apoptotic DNA Fragmentation (GO:0006309) Global Gene Silencing By MRNA Cleavage (GO:0098795) MiRNA Metabolic Process (GO:0010586) MiRNA Processing (GO:0035196) Negative Regulation Of Gene Expression (GO:0010629) Negative Regulation Of Schwann Cell Proliferation (GO:0010626) Negative Regulation Of Transcription By RNA Polymerase II (GO:0000122) Negative Regulation Of Tumor Necrosis Factor Production (GO:0032720) Nerve Development (GO:0021675) Neuron Projection Morphogenesis (GO:0048812) NIK/NF-KappaB Signaling (GO:0038061) Peripheral Nervous System Myelin Formation (GO:0032290) Positive Regulation Of Myelination (GO:0031643) Positive Regulation Of Schwann Cell Differentiation (GO:0014040) Pre-MiRNA Processing (GO:0031054) RISC Complex Assembly (GO:0070922) RNA Phosphodiester Bond Hydrolysis (GO:0090501) RNA Phosphodiester Bond Hydrolysis, Endonucleolytic (GO:0090502) SiRNA Processing (GO:0030422) TRNA Catabolic Process (GO:0016078)
Molecular Function	ATP Binding (GO:0005524) Deoxyribonuclease I Activity (GO:0004530) DNA Binding (GO:0003677) Double-Stranded RNA Binding (GO:0003725) Endoribonuclease Activity (GO:0004521) Helicase Activity (GO:0004386) Metal Ion Binding (GO:0046872) Pre-MiRNA Binding (GO:0070883) Protein Domain Specific Binding (GO:0019904) Ribonuclease III Activity (GO:0004525) RNA Binding (GO:0003723) SiRNA Binding (GO:0035197)

Disease associations

Description
Pleuropulmonary blastoma (PPB) [MIM:601200]: A rare pediatric intrathoracic neoplasm. The tumor arises from the lung, pleura, or both, and appears to be purely mesenchymal in phenotype. It lacks malignant epithelial elements, a feature that distinguishes it from the classic adult-type pulmonary blastoma. It arises during fetal lung development and is often part of an inherited cancer syndrome. The tumor contain both epithelial and mesenchymal cells. Early in tumorigenesis, cysts form in lung airspaces, and these cysts are lined with benign-appearing epithelium. Mesenchymal cells susceptible to malignant transformation reside within the cyst walls and form a dense layer beneath the epithelial lining. In a subset of patients, overgrowth of the mesenchymal cells produces a sarcoma, a transition that is associated with a poorer prognosis. Some patients have multilocular cystic nephroma, a benign kidney tumor. {Experimental EvidencePubMed:19556464}. Note=The disease is caused by variants affecting the gene represented in this entry. Goiter multinodular 1, with or without Sertoli-Leydig cell tumors (MNG1) [MIM:138800]: A common disorder characterized by nodular overgrowth of the thyroid gland. Some individuals may also develop Sertoli-Leydig cell tumors, usually of the ovary. {Experimental EvidencePubMed:21205968}. Note=The disease is caused by variants affecting the gene represented in this entry. Rhabdomyosarcoma, embryonal, 2 (RMSE2) [MIM:180295]: A form of rhabdomyosarcoma, a highly malignant tumor of striated muscle derived from primitive mesenchymal cells and exhibiting differentiation along rhabdomyoblastic lines. Rhabdomyosarcoma is one of the most frequently occurring soft tissue sarcomas and the most common in children. It occurs in four forms: alveolar, pleomorphic, embryonal and botryoidal rhabdomyosarcomas. {Experimental EvidencePubMed:21882293}. Note=The disease is caused by variants affecting the gene represented in this entry. Global developmental delay, lung cysts, overgrowth, and Wilms tumor (GLOW) [MIM:618272]: A disease characterized by the association of congenital nephromegaly, bilateral Wilms tumor, somatic overgrowth, developmental delay, macrocephaly, and bilateral lung cysts. {Experimental EvidencePubMed:24676357}. Note=The disease is caused by variants affecting the gene represented in this entry. Note=DICER1 mutations have been found in uterine cervix embryonal rhabdomyosarcoma, primitive neuroectodermal tumor, Wilms tumor, pulmonary sequestration and juvenile intestinal polyp (PubMed:21882293). Somatic missense mutations affecting the RNase IIIb domain of DICER1 are common in non-epithelial ovarian tumors. These mutations do not abolish DICER1 function but alter it in specific cell types, a novel mechanism through which perturbation of microRNA processing may be oncogenic (PubMed:22187960). {Experimental EvidencePubMed:21882293, ECO:0000269\|PubMed:22187960}.
Database Associations
OMIM	138800 180295 601200 606241 618272
DisGeNET	23405

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (25 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
A0A142I5B9	RNA-directed RNA polymerase NS5	EBI-20625330	0.35
K9N7C7	2'-O-methyltransferase	EBI-27129420	0.35
O15027	Protein transport protein Sec16A	EBI-20621391	0.35
O75569	Interferon-inducible double-stranded RNA-dependent protein kinase activator A	EBI-8031519	0.74
P0C6X1	Putative 2'-O-methyl transferase	EBI-27129362	0.35
P0C6X4	2'-O-methyltransferase	EBI-27128759	0.35
P0C6X5	Putative 2'-O-methyl transferase	EBI-27128956	0.35
P0C6X6	2'-O-methyltransferase	EBI-27128688	0.35
P19525	Interferon-induced, double-stranded RNA-activated protein kinase	EBI-6116026	0.50
P27958	RNA-directed RNA polymerase	EBI-9392140	0.40
P35658	Nuclear pore complex protein Nup214	EBI-20621391	0.35
P49790	Nuclear pore complex protein Nup153	EBI-20621330	0.50
P52948	Nuclear pore complex protein Nup96	EBI-20621391	0.35
P55735	Protein SEC13 homolog	EBI-20621391	0.35
Q06787	Fragile X messenger ribonucleoprotein 1	EBI-20621391	0.35
Q14974	Importin subunit beta-1	EBI-20621330	0.35
Q15633	RISC-loading complex subunit TARBP2	EBI-8031567	0.96
Q8TB72	Pumilio homolog 2	EBI-20621391	0.35
Q92900	Regulator of nonsense transcripts 1	EBI-20621391	0.35
Q99523	Sortilin	EBI-11154667	0.35
Q99567	Nuclear pore complex protein Nup88	EBI-20621391	0.35
Q9H6S0	3'-5' RNA helicase YTHDC2	EBI-20621391	0.35
Q9NZI8	Insulin-like growth factor 2 mRNA-binding protein 1	EBI-20621391	0.35
O15234	Protein CASC3	EBI-20621391	0.35
Q61496	ATP-dependent RNA helicase DDX4	EBI-15569634	0.54
Interactions with other proteins (119 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9NWA0	Mediator of RNA polymerase II transcription subunit 9 (Mediator complex subunit 9)	EBI-394834	0.35
Q9NX70	Mediator of RNA polymerase II transcription subunit 29 (Intersex-like protein) (Mediator complex subunit 29)	EBI-394875	0.35
Q96J94	Piwi-like protein 1 (EC 3.1.26.-)	EBI-527373	0.50
Q9UKV8	Protein argonaute-2 (Argonaute2) (hAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF-2C 2) (eIF2C 2) (PAZ Piwi domain protein) (PPD) (Protein slicer)	EBI-527585	0.94
Q7Z3Z4	Piwi-like protein 4	EBI-528620	0.37
Q9UL18	Protein argonaute-1 (Argonaute1) (hAgo1) (Argonaute RISC catalytic component 1) (Eukaryotic translation initiation factor 2C 1) (eIF-2C 1) (eIF2C 1) (Putative RNA-binding protein Q99)	EBI-528294	0.72
Q8CJG0	Protein argonaute-2 (Argonaute2) (mAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF-2C 2) (eIF2C 2) (Piwi/argonaute family protein meIF2C2) (Protein slicer)	EBI-528561	0.52
P02768	Albumin	EBI-1222961	0.35
Q70CQ1	Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.4.19.12) (Deubiquitinating enzyme 49) (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49)	EBI-2512828	0.40
P0C205	Protein Rex (Rev homolog) (Rex-1) (p27Rex)	EBI-8332957	0.61
O43741	5'-AMP-activated protein kinase subunit beta-2 (AMPK subunit beta-2)	EBI-3937984	0.37
Q96C10	ATP-dependent RNA helicase DHX58 (EC 3.6.4.13) (ATP-dependent helicase LGP2) (Protein D11Lgp2 homolog) (RIG-I-like receptor 3) (RLR-3) (RIG-I-like receptor LGP2) (RLR)	EBI-6115711	0.50
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
Q96DB2	Histone deacetylase 11 (HD11) (EC 3.5.1.98)	EBI-6598272	0.46
Q9UHI6	Probable ATP-dependent RNA helicase DDX20 (EC 3.6.1.15) (EC 3.6.4.13) (Component of gems 3) (DEAD box protein 20) (DEAD box protein DP 103) (Gemin-3)	EBI-6598911	0.35
P57678	Gem-associated protein 4 (Gemin-4) (Component of gems 4) (p97)	EBI-6598937	0.35
P55265	Double-stranded RNA-specific adenosine deaminase (DRADA) (EC 3.5.4.37) (136 kDa double-stranded RNA-binding protein) (p136) (Interferon-inducible protein 4) (IFI-4) (K88DSRBP)	EBI-6913036	0.65
Q14686	Nuclear receptor coactivator 6 (Activating signal cointegrator 2) (ASC-2) (Amplified in breast cancer protein 3) (Cancer-amplified transcriptional coactivator ASC-2) (Nuclear receptor coactivator RAP250) (NRC RAP250) (Nuclear receptor-activating protein, 250 kDa) (Peroxisome proliferator-activated receptor-interacting protein) (PPAR-interacting protein) (PRIP) (Thyroid hormone receptor-binding protein)	EBI-8756175	0.44
P16150	Leukosialin (GPL115) (Galactoglycoprotein) (GALGP) (Leukocyte sialoglycoprotein) (Sialophorin) (CD antigen CD43) [Cleaved into: CD43 cytoplasmic tail (CD43-ct) (CD43ct)]	EBI-10049049	0.35
Q9UI95	Mitotic spindle assembly checkpoint protein MAD2B (Mitotic arrest deficient 2-like protein 2) (MAD2-like protein 2) (REV7 homolog) (hREV7)	EBI-11059438	0.35
Q9H9G7	Protein argonaute-3 (Argonaute3) (hAgo3) (EC 3.1.26.n2) (Argonaute RISC catalytic component 3) (Eukaryotic translation initiation factor 2C 3) (eIF-2C 3) (eIF2C 3)	EBI-11090247	0.35
Q9Y5L4	Mitochondrial import inner membrane translocase subunit Tim13	EBI-11125620	0.35
Q96EQ0	Small glutamine-rich tetratricopeptide repeat-containing protein beta (Beta-SGT) (Small glutamine-rich protein with tetratricopeptide repeats 2)	EBI-11152414	0.35
Q14103	Heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) (AU-rich element RNA-binding protein 1)	EBI-11152836	0.35
O60506	Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) (Glycine- and tyrosine-rich RNA-binding protein) (GRY-RBP) (NS1-associated protein 1) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein)	EBI-11153302	0.53
P22415	Upstream stimulatory factor 1 (Class B basic helix-loop-helix protein 11) (bHLHb11) (Major late transcription factor 1)	EBI-11158458	0.35
Q9H9F9	Actin-related protein 5 (hARP5) (Sarcoma antigen NY-SAR-16)	EBI-11160007	0.35
P61224	Ras-related protein Rap-1b (EC 3.6.5.2) (GTP-binding protein smg p21B)	EBI-11160765	0.35
Q96LK0	Centrosomal protein of 19 kDa (Cep19)	EBI-11376319	0.27
Q9Y6A4	Cilia- and flagella-associated protein 20 (Basal body up-regulated protein 22) (Transcription factor IIB)	EBI-12449464	0.51
C5E524	Non-structural protein 1 (NS1)	EBI-12584280	0.35
Q8IWL3	Iron-sulfur cluster co-chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial]	EBI-13943458	0.35
A2AM67	Vascular SH2 domain-containing protein	EBI-15101712	0.35
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-16398399	0.35
Q9H0B3	IQ domain-containing protein N	EBI-21526575	0.35
P13727	Bone marrow proteoglycan (BMPG) (Proteoglycan 2) [Cleaved into: Eosinophil granule major basic protein (EMBP) (MBP) (Pregnancy-associated major basic protein)]	EBI-21570605	0.35
Q8N490	Probable hydrolase PNKD (EC 3.-.-.-) (Myofibrillogenesis regulator 1) (MR-1) (Paroxysmal nonkinesiogenic dyskinesia protein) (Trans-activated by hepatitis C virus core protein 2)	EBI-21596986	0.35
Q8IZ69	tRNA (uracil-5-)-methyltransferase homolog A (EC 2.1.1.35) (mRNA (uracil-5-)-methyltransferase TRMT2A) (EC 2.1.1.-)	EBI-21636338	0.35
Q8WV44	E3 ubiquitin-protein ligase TRIM41 (EC 2.3.2.27) (RING finger-interacting protein with C kinase) (RINCK) (Tripartite motif-containing protein 41)	EBI-21636495	0.35
O14965	Aurora kinase A (EC 2.7.11.1) (Aurora 2) (Aurora/IPL1-related kinase 1) (ARK-1) (Aurora-related kinase 1) (Breast tumor-amplified kinase) (Ipl1- and aurora-related kinase 1) (Serine/threonine-protein kinase 15) (Serine/threonine-protein kinase 6) (Serine/threonine-protein kinase Ayk1) (Serine/threonine-protein kinase aurora-A)	EBI-21639587	0.53
O75173	A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAM-TS 4) (ADAM-TS4) (ADAMTS-4) (EC 3.4.24.82) (ADMP-1) (Aggrecanase-1)	EBI-21640424	0.35
P61313	60S ribosomal protein L15 (Large ribosomal subunit protein eL15)	EBI-21697528	0.35
Q3SYB3	Forkhead box protein D4-like 6 (FOXD4-like 6)	EBI-21720692	0.35
Q8N4T0	Carboxypeptidase A6 (EC 3.4.17.-)	EBI-21731449	0.35
Q96SI9	Spermatid perinuclear RNA-binding protein	EBI-21752787	0.35
Q8N1E6	F-box/LRR-repeat protein 14 (F-box and leucine-rich repeat protein 14)	EBI-21820146	0.35
Q92945	Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH type-splicing regulatory protein) (KSRP) (p75)	EBI-15781931	0.40
O14980	Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog)	EBI-15819105	0.35
P04156	Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230)	EBI-15979960	0.35
P24928	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase II subunit A) (DNA-directed RNA polymerase III largest subunit) (RNA-directed RNA polymerase II subunit RPB1) (EC 2.7.7.48)	EBI-16106916	0.50
P35637	RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)	EBI-20621391	0.35
P23396	40S ribosomal protein S3 (EC 4.2.99.18) (Small ribosomal subunit protein uS3)	EBI-20621391	0.35
P62917	60S ribosomal protein L8 (Large ribosomal subunit protein uL2)	EBI-20621391	0.35
P62701	40S ribosomal protein S4, X isoform (SCR10) (Single copy abundant mRNA protein) (Small ribosomal subunit protein eS4)	EBI-20621391	0.35
P61247	40S ribosomal protein S3a (Small ribosomal subunit protein eS1) (v-fos transformation effector protein) (Fte-1)	EBI-20621391	0.35
P15880	40S ribosomal protein S2 (40S ribosomal protein S4) (Protein LLRep3) (Small ribosomal subunit protein uS5)	EBI-20621391	0.35
P12236	ADP/ATP translocase 3 (ADP,ATP carrier protein 3) (ADP,ATP carrier protein, isoform T2) (ANT 2) (Adenine nucleotide translocator 3) (ANT 3) (Solute carrier family 25 member 6) [Cleaved into: ADP/ATP translocase 3, N-terminally processed]	EBI-20621391	0.35
P05141	ADP/ATP translocase 2 (ADP,ATP carrier protein 2) (ADP,ATP carrier protein, fibroblast isoform) (Adenine nucleotide translocator 2) (ANT 2) (Solute carrier family 25 member 5) [Cleaved into: ADP/ATP translocase 2, N-terminally processed]	EBI-20621391	0.35
P07910	Heterogeneous nuclear ribonucleoproteins C1/C2 (hnRNP C1/C2)	EBI-20621391	0.35
P22626	Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1)	EBI-20621391	0.35
Q15365	Poly(rC)-binding protein 1 (Alpha-CP1) (Heterogeneous nuclear ribonucleoprotein E1) (hnRNP E1) (Nucleic acid-binding protein SUB2.3)	EBI-20621391	0.35
Q8IU99	Calcium homeostasis modulator protein 1 (Protein FAM26C)	EBI-20621391	0.35
P09651	Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed]	EBI-20621391	0.35
P38159	RNA-binding motif protein, X chromosome (Glycoprotein p43) (Heterogeneous nuclear ribonucleoprotein G) (hnRNP G) [Cleaved into: RNA-binding motif protein, X chromosome, N-terminally processed]	EBI-20621391	0.35
Q9UN86	Ras GTPase-activating protein-binding protein 2 (G3BP-2) (GAP SH3 domain-binding protein 2)	EBI-20621391	0.35
P10809	60 kDa heat shock protein, mitochondrial (EC 5.6.1.7) (60 kDa chaperonin) (Chaperonin 60) (CPN60) (Heat shock protein 60) (HSP-60) (Hsp60) (HuCHA60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein)	EBI-20621391	0.35
Q96I24	Far upstream element-binding protein 3 (FUSE-binding protein 3)	EBI-20621391	0.35
Q9Y5A9	YTH domain-containing family protein 2 (DF2) (CLL-associated antigen KW-14) (High-glucose-regulated protein 8) (Renal carcinoma antigen NY-REN-2)	EBI-20621391	0.35
O00425	Insulin-like growth factor 2 mRNA-binding protein 3 (IGF2 mRNA-binding protein 3) (IMP-3) (IGF-II mRNA-binding protein 3) (KH domain-containing protein overexpressed in cancer) (hKOC) (VICKZ family member 3)	EBI-20621391	0.35
Q7Z739	YTH domain-containing family protein 3 (DF3)	EBI-20621391	0.35
Q9Y6M1	Insulin-like growth factor 2 mRNA-binding protein 2 (IGF2 mRNA-binding protein 2) (IMP-2) (Hepatocellular carcinoma autoantigen p62) (IGF-II mRNA-binding protein 2) (VICKZ family member 2)	EBI-20621391	0.35
Q4G0J3	La-related protein 7 (La ribonucleoprotein domain family member 7) (hLARP7) (P-TEFb-interaction protein for 7SK stability) (PIP7S)	EBI-20621391	0.35
Q96AE4	Far upstream element-binding protein 1 (FBP) (FUSE-binding protein 1) (DNA helicase V) (hDH V)	EBI-20621391	0.35
Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	EBI-20621391	0.35
P17844	Probable ATP-dependent RNA helicase DDX5 (EC 3.6.4.13) (DEAD box protein 5) (RNA helicase p68)	EBI-20621391	0.35
Q96PK6	RNA-binding protein 14 (Paraspeckle protein 2) (PSP2) (RNA-binding motif protein 14) (RRM-containing coactivator activator/modulator) (Synaptotagmin-interacting protein) (SYT-interacting protein)	EBI-20621391	0.35
P51114	RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p)	EBI-20621391	0.35
P11940	Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1)	EBI-20621391	0.35
Q13310	Polyadenylate-binding protein 4 (PABP-4) (Poly(A)-binding protein 4) (Activated-platelet protein 1) (APP-1) (Inducible poly(A)-binding protein) (iPABP)	EBI-20621391	0.35
P11142	Heat shock cognate 71 kDa protein (EC 3.6.4.10) (Heat shock 70 kDa protein 8) (Lipopolysaccharide-associated protein 1) (LAP-1) (LPS-associated protein 1)	EBI-20621391	0.35
O43390	Heterogeneous nuclear ribonucleoprotein R (hnRNP R)	EBI-20621391	0.35
Q92841	Probable ATP-dependent RNA helicase DDX17 (EC 3.6.4.13) (DEAD box protein 17) (DEAD box protein p72) (DEAD box protein p82) (RNA-dependent helicase p72)	EBI-20621391	0.35
P38646	Stress-70 protein, mitochondrial (75 kDa glucose-regulated protein) (GRP-75) (Heat shock 70 kDa protein 9) (Mortalin) (MOT) (Peptide-binding protein 74) (PBP74)	EBI-20621391	0.35
P51116	RNA-binding protein FXR2 (FMR1 autosomal homolog 2)	EBI-20621391	0.35
O75746	Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial (Araceli hiperlarga) (Aralar) (Aralar1) (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12)	EBI-20621391	0.35
P23246	Splicing factor, proline- and glutamine-rich (100 kDa DNA-pairing protein) (hPOMp100) (DNA-binding p52/p100 complex, 100 kDa subunit) (Polypyrimidine tract-binding protein-associated-splicing factor) (PSF) (PTB-associated-splicing factor)	EBI-20621391	0.35
P52272	Heterogeneous nuclear ribonucleoprotein M (hnRNP M)	EBI-20621391	0.35
Q14444	Caprin-1 (Cell cycle-associated protein 1) (Cytoplasmic activation- and proliferation-associated protein 1) (GPI-anchored membrane protein 1) (GPI-anchored protein p137) (GPI-p137) (p137GPI) (Membrane component chromosome 11 surface marker 1) (RNA granule protein 105)	EBI-20621391	0.35
Q92499	ATP-dependent RNA helicase DDX1 (EC 3.6.4.13) (DEAD box protein 1) (DEAD box protein retinoblastoma) (DBP-RB)	EBI-20621391	0.35
Q00839	Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (GRIP120) (Nuclear p120 ribonucleoprotein) (Scaffold-attachment factor A) (SAF-A) (p120) (pp120)	EBI-20621391	0.35
O43143	ATP-dependent RNA helicase DHX15 (EC 3.6.4.13) (ATP-dependent RNA helicase #46) (DEAH box protein 15) (Splicing factor Prp43) (hPrp43)	EBI-20621391	0.35
P43243	Matrin-3	EBI-20621391	0.35
Q9Y2W1	Thyroid hormone receptor-associated protein 3 (BCLAF1 and THRAP3 family member 2) (Thyroid hormone receptor-associated protein complex 150 kDa component) (Trap150)	EBI-20621391	0.35
Q8WWM7	Ataxin-2-like protein (Ataxin-2 domain protein) (Ataxin-2-related protein)	EBI-20621391	0.35
Q14157	Ubiquitin-associated protein 2-like (Protein NICE-4)	EBI-20621391	0.35
Q5T6F2	Ubiquitin-associated protein 2 (UBAP-2)	EBI-20621391	0.35
Q99700	Ataxin-2 (Spinocerebellar ataxia type 2 protein) (Trinucleotide repeat-containing gene 13 protein)	EBI-20621391	0.35
Q9NZB2	Constitutive coactivator of PPAR-gamma-like protein 1 (Oxidative stress-associated Src activator) (Protein FAM120A)	EBI-20621391	0.35
Q14671	Pumilio homolog 1 (HsPUM) (Pumilio-1)	EBI-20621391	0.35
Q7L2E3	ATP-dependent RNA helicase DHX30 (EC 3.6.4.13) (DEAH box protein 30)	EBI-20621391	0.35
Q08211	ATP-dependent RNA helicase A (EC 3.6.4.13) (DEAH box protein 9) (DExH-box helicase 9) (Leukophysin) (LKP) (Nuclear DNA helicase II) (NDH II) (RNA helicase A)	EBI-20621391	0.35
Q6Y7W6	GRB10-interacting GYF protein 2 (PERQ amino acid-rich with GYF domain-containing protein 2) (Trinucleotide repeat-containing gene 15 protein)	EBI-20621391	0.35
Q6P158	Putative ATP-dependent RNA helicase DHX57 (EC 3.6.4.13) (DEAH box protein 57)	EBI-20621391	0.35
Q9BY12	S phase cyclin A-associated protein in the endoplasmic reticulum (S phase cyclin A-associated protein in the ER) (Zinc finger protein 291)	EBI-20621391	0.35
Q04637	Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G 1) (eIF-4G1) (p220)	EBI-20621391	0.35
Q9UPQ9	Trinucleotide repeat-containing gene 6B protein	EBI-20621391	0.35
P48634	Protein PRRC2A (HLA-B-associated transcript 2) (Large proline-rich protein BAT2) (Proline-rich and coiled-coil-containing protein 2A) (Protein G2)	EBI-20621391	0.35
Q15077	P2Y purinoceptor 6 (P2Y6)	EBI-21262943	0.35
Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	EBI-21265942	0.35
O43508	Tumor necrosis factor ligand superfamily member 12 (APO3 ligand) (TNF-related weak inducer of apoptosis) (TWEAK) [Cleaved into: Tumor necrosis factor ligand superfamily member 12, membrane form; Tumor necrosis factor ligand superfamily member 12, secreted form]	EBI-21195246	0.54
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-21301141	0.35
A0A0H3LBU6	HNHc domain-containing protein	EBI-25402078	0.35
P59633	ORF3b protein (Accessory protein 3b) (Non-structural protein 3b) (ns3b) (Protein X2)	EBI-25688366	0.35
Q9IK90	Matrix protein (Protein M)	EBI-25747350	0.50
K9N4V0	Non-structural protein ORF4a (ORF4a)	EBI-26375098	0.35
P98179	RNA-binding protein 3 (RNA-binding motif protein 3) (RNPL)	EBI-26967387	0.35
Q96T52	Mitochondrial inner membrane protease subunit 2 (EC 3.4.21.-) (IMP2-like protein)	EBI-27050444	0.35
P35226	Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51)	EBI-27108918	0.35
P53350	Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13)	EBI-28938281	0.35

Cross-References

Database	Links
UNIPROT	Q9UPY3 A7E2D3 B3KRG4 E0AD28 O95943 Q9UQ02
PDB	2EB1 4NGB 4NGC 4NGD 4NGF 4NGG 4NH3 4NH5 4NH6 4NHA 4WYQ 5ZAK 5ZAL 5ZAM
Pfam	PF00271 PF02170 PF04851 PF00636
PROSITE	PS51327 PS50137 PS51192 PS51194 PS50821 PS00517 PS50142
OMIM	138800 180295 601200 606241 618272
DisGeNET	23405

Endoribonuclease Dicer (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 4WYQ)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (25 interactors)

Interactions with other proteins (119 interactors)

Cross-References

Database

Links

Description

Description