SNARE-associated protein Snapin - Homo sapiens

SNARE-associated protein Snapin (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	SNARE-associated protein Snapin
Accession Code	O95295
Gene	SNAPIN
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 136)
MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYP PGSPGK

Subcellular Location

Description
Membrane {By SimilarityUniProtKB:Q9Z266}; Peripheral membrane protein {By SimilarityUniProtKB:Q9Z266}; Cytoplasmic side {By SimilarityUniProtKB:Q9Z266}. Cytoplasm, cytosol {By SimilarityUniProtKB:Q9Z266}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:18167355, Experimental EvidencePubMed:19168546, ECO:0000269\|PubMed:21102408}. Golgi apparatus membrane {By SimilarityUniProtKB:Q9Z266}. Lysosome membrane {ECO:0000305\|PubMed:25898167}. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane {ECO:0000305\|PubMed:21102408}. Note=Colocalizes with NANOS1 and PUM2 in the perinuclear region of germ cells. {Experimental EvidencePubMed:19168546}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	By Similarity {ECO:0000250\|UniProtKB:Q9Z266}
Assigned Ontology terms

Cellular Component	Acrosomal Vesicle (GO:0001669) Anchoring Junction (GO:0070161) Axon Cytoplasm (GO:1904115) BLOC-1 Complex (GO:0031083) BORC Complex (GO:0099078) Cytoplasmic Side Of Lysosomal Membrane (GO:0098574) Cytosol (GO:0005829) Golgi Membrane (GO:0000139) Manchette (GO:0002177) Perinuclear Region Of Cytoplasm (GO:0048471) Secretory Granule (GO:0030141) Synapse (GO:0045202) Synaptic Vesicle (GO:0008021) Synaptic Vesicle Membrane (GO:0030672)

Biology & Function

Description
Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking and synaptic vesicle recycling. May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release through its ability to potentiate the interaction of synaptotagmin with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE- mediated membrane fusion in non-neuronal cells (PubMed:17182842, PubMed:18167355). As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor (PubMed:25898167). {Experimental EvidencePubMed:17182842, Experimental EvidencePubMed:18167355, Experimental EvidencePubMed:25898167}.
Assigned Ontology terms

Biological Process	Anterograde Axonal Transport (GO:0008089) Anterograde Synaptic Vesicle Transport (GO:0048490) Autophagosome Maturation (GO:0097352) Endosome To Lysosome Transport (GO:0008333) Intracellular Protein Transport (GO:0006886) Late Endosome To Lysosome Transport (GO:1902774) Lysosomal Lumen Acidification (GO:0007042) Lysosome Localization (GO:0032418) Lysosome Organization (GO:0007040) Melanosome Organization (GO:0032438) Negative Regulation Of Neuron Projection Development (GO:0010977) Neuron Cellular Homeostasis (GO:0070050) Neuron Projection Development (GO:0031175) Neurotransmitter Secretion (GO:0007269) Organelle Transport Along Microtubule (GO:0072384) Positive Regulation Of Late Endosome To Lysosome Transport (GO:1902824) Protein Maturation (GO:0051604) Protein-Containing Complex Localization (GO:0031503) Regulation Of Endosome Size (GO:0051036) Regulation Of Lysosome Size (GO:0062196) Regulation Of Protein Binding (GO:0043393) Regulation Of Synaptic Vesicle Exocytosis (GO:2000300) Retrograde Axonal Transport (GO:0008090) Synaptic Vesicle Exocytosis (GO:0016079) Synaptic Vesicle Fusion To Presynaptic Active Zone Membrane (GO:0031629) Synaptic Vesicle Maturation (GO:0016188) Synaptic Vesicle Transport (GO:0048489) Terminal Button Organization (GO:0072553)
Molecular Function	SNARE Binding (GO:0000149)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (8 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P60881	Synaptosomal-associated protein 25	EBI-8753069	0.40
Q8N3K9	Cardiomyopathy-associated protein 5	EBI-5664244	0.00
Q03001	Dystonin	EBI-5664296	0.00
Q9NV70	Exocyst complex component 1	EBI-21673234	0.35
A1L4K1	Fibronectin type III and SPRY domain-containing protein 2	EBI-24500672	0.56
Q14974	Importin subunit beta-1	EBI-5664409	0.00
Q92993	Histone acetyltransferase KAT5	EBI-730852	0.00
P20700	Lamin-B1	EBI-24720012	0.56
Interactions with other proteins (113 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9Y561	Low-density lipoprotein receptor-related protein 12 (LDLR-related protein 12) (LRP-12) (Suppressor of tumorigenicity 7 protein)	EBI-296734	0.37
Q9NUP1	Biogenesis of lysosome-related organelles complex 1 subunit 4 (BLOC-1 subunit 4) (Protein cappuccino homolog)	EBI-465885	0.37
Q6QNY1	Biogenesis of lysosome-related organelles complex 1 subunit 2 (BLOC-1 subunit 2) (Centrosome-associated protein)	EBI-465893	0.83
Q96EV8	Dysbindin (Biogenesis of lysosome-related organelles complex 1 subunit 8) (BLOC-1 subunit 8) (Dysbindin-1) (Dystrobrevin-binding protein 1) (Hermansky-Pudlak syndrome 7 protein) (HPS7 protein)	EBI-465897	0.82
P78537	Biogenesis of lysosome-related organelles complex 1 subunit 1 (BLOC-1 subunit 1) (GCN5-like protein 1) (Protein RT14)	EBI-465910	0.76
Q9UL45	Biogenesis of lysosome-related organelles complex 1 subunit 6 (BLOC-1 subunit 6) (Pallid protein homolog) (Pallidin) (Syntaxin 13-interacting protein)	EBI-466025	0.53
Q6QNY0	Biogenesis of lysosome-related organelles complex 1 subunit 3 (BLOC-1 subunit 3)	EBI-466164	0.35
Q15796	Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2)	EBI-7225073	0.37
Q08345	Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protein-tyrosine kinase 3A) (Protein-tyrosine kinase RTK-6) (TRK E) (Tyrosine kinase DDR) (Tyrosine-protein kinase CAK) (CD antigen CD167a)	EBI-728871	0.00
O95163	Elongator complex protein 1 (ELP1) (IkappaB kinase complex-associated protein) (IKK complex-associated protein) (p150)	EBI-729336	0.00
P26641	Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma)	EBI-730846	0.00
P54257	Huntingtin-associated protein 1 (HAP-1) (Neuroan 1)	EBI-730849	0.00
Q16891	MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89)	EBI-730855	0.00
O95251	Histone acetyltransferase KAT7 (EC 2.3.1.48) (Histone acetyltransferase binding to ORC1) (Lysine acetyltransferase 7) (MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2) (MYST-2)	EBI-730858	0.00
Q96AW1	Vesicular, overexpressed in cancer, prosurvival protein 1 (EGFR-coamplified and overexpressed protein) (ECop) (Glioblastoma-amplified secreted protein) (Putative NF-kappa-B-activating protein 055N)	EBI-733337	0.00
O60282	Kinesin heavy chain isoform 5C (EC 3.6.4.-) (Kinesin heavy chain neuron-specific 2) (Kinesin-1)	EBI-733340	0.00
Q96R06	Sperm-associated antigen 5 (Astrin) (Deepest) (Mitotic spindle-associated protein p126) (MAP126)	EBI-733343	0.00
P11047	Laminin subunit gamma-1 (Laminin B2 chain) (Laminin-1 subunit gamma) (Laminin-10 subunit gamma) (Laminin-11 subunit gamma) (Laminin-2 subunit gamma) (Laminin-3 subunit gamma) (Laminin-4 subunit gamma) (Laminin-6 subunit gamma) (Laminin-7 subunit gamma) (Laminin-8 subunit gamma) (Laminin-9 subunit gamma) (S-laminin subunit gamma) (S-LAM gamma)	EBI-735808	0.00
Q15849	Urea transporter 2 (Solute carrier family 14 member 2) (Urea transporter, kidney)	EBI-1573308	0.60
Q62668	Urea transporter 2 (Solute carrier family 14 member 2) (Urea transporter, kidney)	EBI-1573609	0.62
Q08850	Syntaxin-4	EBI-1573773	0.35
O70377	Synaptosomal-associated protein 23 (SNAP-23) (Vesicle-membrane fusion protein SNAP-23)	EBI-1573773	0.35
Q16539	Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (Cytokine suppressive anti-inflammatory drug-binding protein) (CSAID-binding protein) (CSBP) (MAP kinase MXI2) (MAX-interacting protein 2) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha) (Stress-activated protein kinase 2a) (SAPK2a)	EBI-2116941	0.00
Q96L14	Cep170-like protein (CEP170 pseudogene 1)	EBI-2554834	0.56
Q9D0F1	Kinetochore protein NDC80 homolog (Kinetochore protein Hec1) (Kinetochore-associated protein 2)	EBI-2558810	0.40
Q6A065	Centrosomal protein of 170 kDa (Cep170)	EBI-2563315	0.40
Q8CZZ7	DNA repair protein RecN (Recombination protein N)	EBI-2855566	0.00
Q7Z465	Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein	EBI-3943766	0.37
O75923	Dysferlin (Dystrophy-associated fer-1-like protein) (Fer-1-like protein 1)	EBI-5357023	0.50
Q9BZ29	Dedicator of cytokinesis protein 9 (Cdc42 guanine nucleotide exchange factor zizimin-1) (Zizimin-1)	EBI-5656556	0.00
P13929	Beta-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Enolase 3) (Muscle-specific enolase) (MSE) (Skeletal muscle enolase)	EBI-5658499	0.00
P35609	Alpha-actinin-2 (Alpha-actinin skeletal muscle isoform 2) (F-actin cross-linking protein)	EBI-5664140	0.00
P05023	Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1)	EBI-5664157	0.00
O00499	Myc box-dependent-interacting protein 1 (Amphiphysin II) (Amphiphysin-like protein) (Box-dependent myc-interacting protein 1) (Bridging integrator 1)	EBI-5664176	0.00
Q5VT25	Serine/threonine-protein kinase MRCK alpha (EC 2.7.11.1) (CDC42-binding protein kinase alpha) (DMPK-like alpha) (Myotonic dystrophy kinase-related CDC42-binding kinase alpha) (MRCK alpha) (Myotonic dystrophy protein kinase-like alpha)	EBI-5664210	0.00
Q5SW79	Centrosomal protein of 170 kDa (Cep170) (KARP-1-binding protein) (KARP1-binding protein)	EBI-21644990	0.55
P17661	Desmin	EBI-5664261	0.00
P50570	Dynamin-2 (EC 3.6.5.5)	EBI-5664279	0.00
Q8IWE2	Protein NOXP20 (Nervous system overexpressed protein 20) (Protein FAM114A1)	EBI-5664349	0.00
Q9H6L5	Reticulophagy regulator 1 (Reticulophagy receptor 1)	EBI-5664367	0.00
Q04695	Keratin, type I cytoskeletal 17 (39.1) (Cytokeratin-17) (CK-17) (Keratin-17) (K17)	EBI-5664449	0.00
P24043	Laminin subunit alpha-2 (Laminin M chain) (Laminin-12 subunit alpha) (Laminin-2 subunit alpha) (Laminin-4 subunit alpha) (Merosin heavy chain)	EBI-5664487	0.00
Q9UPN3	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4/5 (620 kDa actin-binding protein) (ABP620) (Actin cross-linking family protein 7) (Macrophin-1) (Trabeculin-alpha)	EBI-5664521	0.00
Q7Z406	Myosin-14 (Myosin heavy chain 14) (Myosin heavy chain, non-muscle IIc) (Non-muscle myosin heavy chain IIc) (NMHC II-C)	EBI-5664555	0.00
P11055	Myosin-3 (Muscle embryonic myosin heavy chain) (Myosin heavy chain 3) (Myosin heavy chain, fast skeletal muscle, embryonic) (SMHCE)	EBI-5664573	0.00
P12883	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain, cardiac muscle beta isoform) (MyHC-beta)	EBI-5664609	0.00
Q14511	Enhancer of filamentation 1 (hEF1) (CRK-associated substrate-related protein) (CAS-L) (CasL) (Cas scaffolding protein family member 2) (CASS2) (Neural precursor cell expressed developmentally down-regulated protein 9) (NEDD-9) (Renal carcinoma antigen NY-REN-12) (p105) [Cleaved into: Enhancer of filamentation 1 p55]	EBI-5664643	0.00
Q15149	Plectin (PCN) (PLTN) (Hemidesmosomal protein 1) (HD1) (Plectin-1)	EBI-5664660	0.00
Q15276	Rab GTPase-binding effector protein 1 (Rabaptin-4) (Rabaptin-5) (Rabaptin-5alpha) (Renal carcinoma antigen NY-REN-17)	EBI-5664677	0.00
Q9UJ41	Rab5 GDP/GTP exchange factor (RAP1) (Rabaptin-5-associated exchange factor for Rab5) (Rabex-5)	EBI-24270079	0.56
Q96Q15	Serine/threonine-protein kinase SMG1 (SMG-1) (hSMG-1) (EC 2.7.11.1) (Lambda/iota protein kinase C-interacting protein) (Lambda-interacting protein) (Nonsense mediated mRNA decay-associated PI3K-related kinase SMG1)	EBI-5664713	0.00
P11277	Spectrin beta chain, erythrocytic (Beta-I spectrin)	EBI-5664730	0.00
Q01082	Spectrin beta chain, non-erythrocytic 1 (Beta-II spectrin) (Fodrin beta chain) (Spectrin, non-erythroid beta chain 1)	EBI-5664785	0.00
O94826	Mitochondrial import receptor subunit TOM70 (Mitochondrial precursor proteins import receptor) (Translocase of outer membrane 70 kDa subunit) (Translocase of outer mitochondrial membrane protein 70)	EBI-5664802	0.00
P09493	Tropomyosin alpha-1 chain (Alpha-tropomyosin) (Tropomyosin-1)	EBI-5664819	0.00
P07951	Tropomyosin beta chain (Beta-tropomyosin) (Tropomyosin-2)	EBI-24798942	0.56
Q969Q1	E3 ubiquitin-protein ligase TRIM63 (EC 2.3.2.27) (Iris RING finger protein) (Muscle-specific RING finger protein 1) (MuRF-1) (MuRF1) (RING finger protein 28) (RING-type E3 ubiquitin transferase TRIM63) (Striated muscle RING zinc finger protein) (Tripartite motif-containing protein 63)	EBI-5664873	0.00
P62258	14-3-3 protein epsilon (14-3-3E)	EBI-5664890	0.00
P63104	14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1)	EBI-5664907	0.00
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-8752670	0.66
H7BX26	Centrosomal protein of 170 kDa	EBI-11021989	0.35
Q96NL6	Sodium channel and clathrin linker 1 (Sodium channel-associated protein 1)	EBI-11396361	0.27
P48039	Melatonin receptor type 1A (Mel-1A-R) (Mel1a receptor)	EBI-11576732	0.00
P08779	Keratin, type I cytoskeletal 16 (Cytokeratin-16) (CK-16) (Keratin-16) (K16)	EBI-24330490	0.56
Q9UBB9	Tuftelin-interacting protein 11 (Septin and tuftelin-interacting protein 1) (STIP-1)	EBI-24341172	0.56
Q7Z3Y8	Keratin, type I cytoskeletal 27 (Cytokeratin-27) (CK-27) (Keratin-25C) (K25C) (Keratin-27) (K27) (Type I inner root sheath-specific keratin-K25irs3)	EBI-24484835	0.56
P19012	Keratin, type I cytoskeletal 15 (Cytokeratin-15) (CK-15) (Keratin-15) (K15)	EBI-24486820	0.56
P08727	Keratin, type I cytoskeletal 19 (Cytokeratin-19) (CK-19) (Keratin-19) (K19)	EBI-24509579	0.56
Q7Z3Y9	Keratin, type I cytoskeletal 26 (Cytokeratin-26) (CK-26) (Keratin-25B) (K25B) (Keratin-26) (K26) (Type I inner root sheath-specific keratin-K25irs2)	EBI-22754657	0.56
P51946	Cyclin-H (MO15-associated protein) (p34) (p37)	EBI-22754942	0.56
Q63ZY3	KN motif and ankyrin repeat domain-containing protein 2 (Ankyrin repeat domain-containing protein 25) (Matrix-remodeling-associated protein 3) (SRC-1-interacting protein) (SIP) (SRC-interacting protein) (SRC1-interacting protein)	EBI-24665653	0.56
Q12934	Filensin (Beaded filament structural protein 1) (Lens fiber cell beaded-filament structural protein CP 115) (CP115) (Lens intermediate filament-like heavy) (LIFL-H) [Cleaved into: Filensin C-terminal fragment; Filensin N-terminal fragment]	EBI-24669400	0.56
Q9Y3C0	WASH complex subunit 3 (Coiled-coil domain-containing protein 53)	EBI-24672862	0.56
Q9H1M0	Nucleoporin-62 C-terminal-like protein	EBI-24680175	0.56
Q7Z6G3	N-terminal EF-hand calcium-binding protein 2 (EF-hand calcium-binding protein 2) (Neuronal calcium-binding protein 2) (Synaptotagmin-interacting protein 2) (Stip-2)	EBI-24691932	0.56
P49585	Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A)	EBI-24694444	0.56
Q8N9N5	Protein BANP (BEN domain-containing protein 1) (Btg3-associated nuclear protein) (Scaffold/matrix-associated region-1-binding protein)	EBI-23767493	0.56
Q8IV53	DENN domain-containing protein 1C (Connecdenn 3) (Protein FAM31C)	EBI-23774805	0.56
P06753	Tropomyosin alpha-3 chain (Gamma-tropomyosin) (Tropomyosin-3) (Tropomyosin-5) (hTM5)	EBI-23779263	0.56
P67936	Tropomyosin alpha-4 chain (TM30p1) (Tropomyosin-4)	EBI-24766526	0.56
Q70UQ0	Inhibitor of nuclear factor kappa-B kinase-interacting protein (I kappa-B kinase-interacting protein) (IKBKB-interacting protein) (IKK-interacting protein)	EBI-24768892	0.67
Q13515	Phakinin (49 kDa cytoskeletal protein) (Beaded filament structural protein 2) (Lens fiber cell beaded filament protein CP 47) (CP47) (Lens fiber cell beaded filament protein CP 49) (CP49) (Lens intermediate filament-like light) (LIFL-L)	EBI-24778153	0.56
Q68D86	Coiled-coil domain-containing protein 102B	EBI-24778626	0.56
P35900	Keratin, type I cytoskeletal 20 (Cytokeratin-20) (CK-20) (Keratin-20) (K20) (Protein IT)	EBI-24793035	0.56
Q5JTB6	Placenta-specific protein 9	EBI-25276210	0.56
Q9NYB9	Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1)	EBI-24602317	0.56
Q99816	Tumor susceptibility gene 101 protein (ESCRT-I complex subunit TSG101)	EBI-23929943	0.56
Q9UPT5	Exocyst complex component 7 (Exocyst complex component Exo70)	EBI-25288795	0.56
Q2M2I5	Keratin, type I cytoskeletal 24 (Cytokeratin-24) (CK-24) (Keratin-24) (K24) (Type I keratin-24)	EBI-24455909	0.60
Q2T9L4	Inhibitory synaptic factor 1 (InSyn1)	EBI-24558210	0.56
Q96BD8	Spindle and kinetochore-associated protein 1	EBI-24594639	0.56
Q8IYW4	ENTH domain-containing protein 1 (Epsin-2B)	EBI-25161488	0.56
Q9Y5B8	Nucleoside diphosphate kinase 7 (NDK 7) (NDP kinase 7) (EC 2.7.4.6) (nm23-H7)	EBI-24760105	0.56
A1L168	Uncharacterized protein C20orf202	EBI-24806766	0.56
Q86WT6	E3 ubiquitin-protein ligase TRIM69 (EC 2.3.2.27) (RFP-like domain-containing protein trimless) (RING finger protein 36) (RING-type E3 ubiquitin transferase TRIM69) (Tripartite motif-containing protein 69)	EBI-21541317	0.35
Q8TDR4	T-complex protein 10A homolog 1 (T-complex protein 10A-1) (TCP10A-1) (TCP10-like)	EBI-21617027	0.35
Q9Y2V7	Conserved oligomeric Golgi complex subunit 6 (COG complex subunit 6) (Component of oligomeric Golgi complex 6)	EBI-21673529	0.35
Q9UJT2	Testis-specific serine kinase substrate (Testis-specific kinase substrate) (STK22 substrate 1)	EBI-21696311	0.35
Q9NX95	Syntabulin (Golgi-localized syntaphilin-related protein) (Syntaxin-1-binding protein)	EBI-21720503	0.35
O60296	Trafficking kinesin-binding protein 2 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 3 protein)	EBI-21729552	0.35
Q8WVE6	Transmembrane protein 171	EBI-21754350	0.35
Q9UIL1	Short coiled-coil protein	EBI-21762105	0.35
Q07866	Kinesin light chain 1 (KLC 1)	EBI-21768919	0.35
A5D8V7	Outer dynein arm-docking complex subunit 3 (Coiled-coil domain-containing protein 151)	EBI-21779481	0.35
Q8N7C3	Probable E3 ubiquitin-protein ligase TRIML2 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIML2) (SPRY domain-containing protein 6) (Tripartite motif family-like protein 2)	EBI-21782264	0.35
Q96GS4	BLOC-1-related complex subunit 6 (Lysosome-dispersing protein) (Lyspersin)	EBI-21795617	0.35
Q5T0J7	Testis-expressed protein 35	EBI-21813461	0.35
Q8TDM0	Breast carcinoma-amplified sequence 4	EBI-21813727	0.35
P51151	Ras-related protein Rab-9A	EBI-16798325	0.27
O43493	Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2)	EBI-16800265	0.27
Q19QW5	ORF6 protein (Accessory protein 6) (Non-structural protein 6)	EBI-25649498	0.37
Q7TLC7	Uncharacterized protein 14	EBI-26377368	0.35
P26583	High mobility group protein B2 (High mobility group protein 2) (HMG-2)	EBI-26436206	0.37

Cross-References

Database	Links
UNIPROT	O95295 D3DV56 Q5SXU8
Pfam	PF14712
OMIM	607007
DisGeNET	23557

SNARE-associated protein Snapin (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (8 interactors)

Interactions with other proteins (113 interactors)

Cross-References

Database

Links

Description

Description