National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory
Protein Information |
|
|---|---|
| Protein Name | Ran GTPase-activating protein 1 |
| Accession Code | P46060 |
| Gene | RANGAP1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 587) | |
|
MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELK RCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGK ILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAFAVNPLLRV INLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADK AELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDDEDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQ RGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVF KDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLL AFVTKPNSALESCSFARHSLLQTLYKV |
|
Structure Viewer (PDB: 2IO3) |
|---|
Description |
||
|---|---|---|
| Cytoplasm {Experimental EvidencePubMed:15037602, Curator InferencePubMed:8146159}. Nucleus, nucleoplasm {Experimental EvidencePubMed:8146159}. Nucleus envelope {Experimental EvidencePubMed:11854305, Experimental EvidencePubMed:15037602}. Chromosome, centromere, kinetochore {Experimental EvidencePubMed:11854305}. Cytoplasm, cytoskeleton, spindle {Experimental EvidencePubMed:11854305, Experimental EvidencePubMed:15037602}. Note=Cytoplasmic during interphase. Detected at the nuclear envelope during interphase (PubMed:11854305, PubMed:15037602). Targeted to the nuclear pores after sumoylation (PubMed:11854305). During mitosis, associates with mitotic spindles, but is essentially not detected at the spindle poles (PubMed:11854305, PubMed:15037602). Association with kinetochores appears soon after nuclear envelope breakdown and persists until late anaphase (PubMed:11854305). Mitotic location also requires sumoylation (PubMed:11854305). {Experimental EvidencePubMed:11854305, Experimental EvidencePubMed:15037602}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Aggresome (GO:0016235) Axon Cytoplasm (GO:1904115) Cytoplasm (GO:0005737) Cytoplasmic Periphery Of The Nuclear Pore Complex (GO:1990723) Cytosol (GO:0005829) Dendrite (GO:0030425) Intracellular Membrane-Bounded Organelle (GO:0043231) Kinetochore (GO:0000776) Mitotic Spindle (GO:0072686) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Pore (GO:0005643) Nuclear Pore Cytoplasmic Filaments (GO:0044614) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) SUMO Ligase Complex (GO:0106068) |
|
Interactions with Nuclear Envelope proteins (17 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| P63279 | SUMO-conjugating enzyme UBC9 | EBI-7036111 | 0.95 |
| P63165 | Small ubiquitin-related modifier 1 | EBI-7036555 | 0.96 |
| Q9ERU9 | E3 SUMO-protein ligase RanBP2 | EBI-2555617 | 0.56 |
| Q96EE3 | Nucleoporin SEH1 | EBI-11086798 | 0.35 |
| P62826 | GTP-binding nuclear protein Ran | EBI-21557447 | 0.35 |
| Q9HC62 | Sentrin-specific protease 2 | EBI-15612044 | 0.59 |
| P49792 | E3 SUMO-protein ligase RanBP2 | EBI-21928721 | 0.62 |
| Q921C5 | Protein bicaudal D homolog 2 | EBI-15847893 | 0.35 |
| Q14974 | Importin subunit beta-1 | EBI-11115566 | 0.35 |
| O14524 | Nuclear envelope integral membrane protein 1 | EBI-21695903 | 0.35 |
| P57740 | Nuclear pore complex protein Nup107 | EBI-11160436 | 0.35 |
| Q8BH74 | Nuclear pore complex protein Nup107 | EBI-10997196 | 0.35 |
| P49790 | Nuclear pore complex protein Nup153 | EBI-11076796 | 0.35 |
| Q99P88 | Nuclear pore complex protein Nup155 | EBI-10997466 | 0.35 |
| Q80U93 | Nuclear pore complex protein Nup214 | EBI-11014856 | 0.35 |
| Q6PFD9 | Nuclear pore complex protein Nup96 | EBI-10994876 | 0.35 |
| Q9UBU9 | Nuclear RNA export factor 1 | EBI-6262548 | 0.53 | Interactions with other proteins (76 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| A0JLT2 | Mediator of RNA polymerase II transcription subunit 19 (Lung cancer metastasis-related protein 1) (Mediator complex subunit 19) | EBI-394580 | 0.35 |
| P60520 | Gamma-aminobutyric acid receptor-associated protein-like 2 (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16) (MAP1 light chain 3-related protein) | EBI-1064937 | 0.00 |
| Q9HC24 | Protein lifeguard 4 (Golgi anti-apoptotic protein) (Protein S1R) (Transmembrane BAX inhibitor motif-containing protein 4) (Z-protein) | EBI-1065758 | 0.00 |
| P01889 | HLA class I histocompatibility antigen, B alpha chain (Human leukocyte antigen B) (HLA-B) | EBI-1074789 | 0.00 |
| Q9Y4K3 | TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6) | EBI-1077160 | 0.00 |
| Q9Y478 | 5'-AMP-activated protein kinase subunit beta-1 (AMPK subunit beta-1) (AMPKb) | EBI-1081606 | 0.00 |
| P55854 | Small ubiquitin-related modifier 3 (SUMO-3) (SMT3 homolog 1) (SUMO-2) (Ubiquitin-like protein SMT3A) (Smt3A) | EBI-1210650 | 0.00 |
| P32121 | Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3) | EBI-1642567 | 0.35 |
| Q8IY92 | Structure-specific endonuclease subunit SLX4 (BTB/POZ domain-containing protein 12) | EBI-2371263 | 0.35 |
| Q9NWV8 | BRISC and BRCA1-A complex member 1 (Mediator of RAP80 interactions and targeting subunit of 40 kDa) (New component of the BRCA1-A complex) | EBI-2514464 | 0.40 |
| Q9QWT9 | Kinesin-like protein KIFC1 | EBI-2558911 | 0.40 |
| Q07832 | Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13) | EBI-2560950 | 0.40 |
| Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | EBI-7950968 | 0.35 |
| Q99459 | Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein) | EBI-7954144 | 0.35 |
| P08754 | Guanine nucleotide-binding protein G(i) subunit alpha-3 (G(i) alpha-3) | EBI-3930105 | 0.37 |
| P63096 | Guanine nucleotide-binding protein G(i) subunit alpha-1 (Adenylate cyclase-inhibiting G alpha protein) | EBI-3930075 | 0.44 |
| P13501 | C-C motif chemokine 5 (EoCP) (Eosinophil chemotactic cytokine) (SIS-delta) (Small-inducible cytokine A5) (T cell-specific protein P228) (TCP228) (T-cell-specific protein RANTES) [Cleaved into: RANTES(3-68); RANTES(4-68)] | EBI-3933514 | 0.37 |
| Q9UBE8 | Serine/threonine-protein kinase NLK (EC 2.7.11.24) (Nemo-like kinase) (Protein LAK1) | EBI-6381385 | 0.35 |
| Q9Y2T1 | Axin-2 (Axin-like protein) (Axil) (Axis inhibition protein 2) (Conductin) | EBI-8993980 | 0.37 |
| Q96QB1 | Rho GTPase-activating protein 7 (Deleted in liver cancer 1 protein) (DLC-1) (HP protein) (Rho-type GTPase-activating protein 7) (START domain-containing protein 12) (StARD12) (StAR-related lipid transfer protein 12) | EBI-8994097 | 0.37 |
| Q15198 | Platelet-derived growth factor receptor-like protein (PDGFR-like protein) (PDGF receptor beta-like tumor suppressor) | EBI-8994216 | 0.37 |
| Q13043 | Serine/threonine-protein kinase 4 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 1) (MST-1) (STE20-like kinase MST1) (Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit (MST1/N); Serine/threonine-protein kinase 4 18kDa subunit (MST1/C)] | EBI-10049645 | 0.35 |
| Q96FW1 | Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1) | EBI-10770198 | 0.35 |
| Q99853 | Forkhead box protein B1 (Transcription factor FKH-5) | EBI-11317404 | 0.35 |
| O00358 | Forkhead box protein E1 (Forkhead box protein E2) (Forkhead-related protein FKHL15) (HFKH4) (HNF-3/fork head-like protein 5) (HFKL5) (Thyroid transcription factor 2) (TTF-2) | EBI-11317831 | 0.35 |
| Q9UPW0 | Forkhead box protein J3 | EBI-11318497 | 0.35 |
| Q12952 | Forkhead box protein L1 (Forkhead-related protein FKHL11) (Forkhead-related transcription factor 7) (FREAC-7) | EBI-11318689 | 0.35 |
| Q9C009 | Forkhead box protein Q1 (HNF-3/forkhead-like protein 1) (HFH-1) (Hepatocyte nuclear factor 3 forkhead homolog 1) | EBI-11319301 | 0.35 |
| P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11319716 | 0.46 |
| Q06330 | Recombining binding protein suppressor of hairless (CBF-1) (J kappa-recombination signal-binding protein) (RBP-J kappa) (RBP-J) (RBP-JK) (Renal carcinoma antigen NY-REN-30) | EBI-11320091 | 0.35 |
| E9PUA5 | Kinesin-like protein | EBI-11016929 | 0.35 |
| Q92614 | Unconventional myosin-XVIIIa (Molecule associated with JAK3 N-terminus) (MAJN) (Myosin containing a PDZ domain) (Surfactant protein receptor SP-R210) (SP-R210) | EBI-11030093 | 0.35 |
| P62627 | Dynein light chain roadblock-type 1 (Dynein light chain 2A, cytoplasmic) | EBI-11032607 | 0.35 |
| O75787 | Renin receptor (ATPase H(+)-transporting lysosomal accessory protein 2) (ATPase H(+)-transporting lysosomal-interacting protein 2) (ER-localized type I transmembrane adapter) (Embryonic liver differentiation factor 10) (N14F) (Renin/prorenin receptor) (Vacuolar ATP synthase membrane sector-associated protein M8-9) (ATP6M8-9) (V-ATPase M8.9 subunit) [Cleaved into: Renin receptor N-terminal fragment; Renin receptor C-terminal fragment] | EBI-11037152 | 0.35 |
| Q8VE37 | Regulator of chromosome condensation (Chromosome condensation protein 1) | EBI-11043815 | 0.35 |
| P63280 | SUMO-conjugating enzyme UBC9 (EC 2.3.2.-) (RING-type E3 SUMO transferase UBC9) (SUMO-protein ligase) (Ubiquitin carrier protein 9) (mUBC9) (Ubiquitin carrier protein I) (Ubiquitin-conjugating enzyme E2 I) (Ubiquitin-protein ligase I) | EBI-11044140 | 0.35 |
| Q8CBY8 | Dynactin subunit 4 (Dynactin subunit p62) | EBI-11074062 | 0.35 |
| Q5EG47 | 5'-AMP-activated protein kinase catalytic subunit alpha-1 (AMPK subunit alpha-1) (EC 2.7.11.1) (Acetyl-CoA carboxylase kinase) (ACACA kinase) (EC 2.7.11.27) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase) (EC 2.7.11.31) (Tau-protein kinase PRKAA1) (EC 2.7.11.26) | EBI-11114972 | 0.35 |
| Q8IVT5 | Kinase suppressor of Ras 1 (EC 2.7.11.1) | EBI-14035152 | 0.35 |
| P18754 | Regulator of chromosome condensation (Cell cycle regulatory protein) (Chromosome condensation protein 1) | EBI-21567271 | 0.35 |
| P61769 | Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3] | EBI-21675069 | 0.35 |
| Q8N3R9 | Protein PALS1 (MAGUK p55 subfamily member 5) (Membrane protein, palmitoylated 5) (Protein associated with Lin-7 1) | EBI-21911830 | 0.35 |
| Q9P0U3 | Sentrin-specific protease 1 (EC 3.4.22.-) (Sentrin/SUMO-specific protease SENP1) | EBI-15611754 | 0.59 |
| P61956 | Small ubiquitin-related modifier 2 (SUMO-2) (HSMT3) (SMT3 homolog 2) (SUMO-3) (Sentrin-2) (Ubiquitin-like protein SMT3B) (Smt3B) | EBI-15612001 | 0.75 |
| Q9BTM9 | Ubiquitin-related modifier 1 | EBI-15902832 | 0.35 |
| Q08345 | Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protein-tyrosine kinase 3A) (Protein-tyrosine kinase RTK-6) (TRK E) (Tyrosine kinase DDR) (Tyrosine-protein kinase CAK) (CD antigen CD167a) | EBI-22227061 | 0.35 |
| Q6ZNJ1 | Neurobeachin-like protein 2 | EBI-16749633 | 0.35 |
| Q96JN8 | Neuralized-like protein 4 | EBI-16813376 | 0.35 |
| P09622 | Dihydrolipoyl dehydrogenase, mitochondrial (EC 1.8.1.4) (Dihydrolipoamide dehydrogenase) (Glycine cleavage system L protein) | EBI-20304669 | 0.35 |
| P36957 | Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K) | EBI-20305285 | 0.35 |
| P08559 | Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I) | EBI-20306509 | 0.35 |
| P03427 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-25769583 | 0.37 |
| Q96NK8 | Neurogenic differentiation factor 6 (NeuroD6) (Class A basic helix-loop-helix protein 2) (bHLHa2) (Protein atonal homolog 2) | EBI-20917522 | 0.40 |
| Q92794 | Histone acetyltransferase KAT6A (EC 2.3.1.48) (MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3) (MYST-3) (Monocytic leukemia zinc finger protein) (Runt-related transcription factor-binding protein 2) (Zinc finger protein 220) | EBI-20928992 | 0.40 |
| Q15172 | Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform (PP2A B subunit isoform B'-alpha) (PP2A B subunit isoform B56-alpha) (PP2A B subunit isoform PR61-alpha) (PR61alpha) (PP2A B subunit isoform R5-alpha) | EBI-20937820 | 0.40 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-21360986 | 0.35 |
| Q15077 | P2Y purinoceptor 6 (P2Y6) | EBI-21262943 | 0.35 |
| Q9NQB0 | Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) | EBI-21265942 | 0.35 |
| P49768 | Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) [Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)] | EBI-21132675 | 0.35 |
| P42858 | Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment] | EBI-21132926 | 0.67 |
| Q15052 | Rho guanine nucleotide exchange factor 6 (Alpha-Pix) (COOL-2) (PAK-interacting exchange factor alpha) (Rac/Cdc42 guanine nucleotide exchange factor 6) | EBI-25409952 | 0.35 |
| Q8WUY9 | DEP domain-containing protein 1B (HBV X-transactivated gene 8 protein) (HBV XAg-transactivated protein 8) | EBI-25411615 | 0.35 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| P22492 | Histone H1t (Testicular H1 histone) | EBI-25479342 | 0.35 |
| Q9H3R0 | Lysine-specific demethylase 4C (EC 1.14.11.66) (Gene amplified in squamous cell carcinoma 1 protein) (GASC-1 protein) (JmjC domain-containing histone demethylation protein 3C) (Jumonji domain-containing protein 2C) ([histone H3]-trimethyl-L-lysine(9) demethylase 4C) | EBI-25479978 | 0.35 |
| Q9C0B5 | Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375) | EBI-25636144 | 0.35 |
| P48431 | Transcription factor SOX-2 | EBI-26574478 | 0.35 |
| Q9NRI5 | Disrupted in schizophrenia 1 protein | EBI-26610849 | 0.40 |
| F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
| Q96QK1 | Vacuolar protein sorting-associated protein 35 (hVPS35) (Maternal-embryonic 3) (Vesicle protein sorting 35) | EBI-27081274 | 0.35 |
| O75582 | Ribosomal protein S6 kinase alpha-5 (S6K-alpha-5) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 5) (Nuclear mitogen- and stress-activated protein kinase 1) (RSK-like protein kinase) (RSKL) | EBI-28931316 | 0.35 |
| P11274 | Breakpoint cluster region protein (EC 2.7.11.1) (Renal carcinoma antigen NY-REN-26) | EBI-28931791 | 0.35 |
| P53350 | Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13) | EBI-28938281 | 0.35 |
| Q96GD4 | Aurora kinase B (EC 2.7.11.1) (Aurora 1) (Aurora- and IPL1-like midbody-associated protein 1) (AIM-1) (Aurora/IPL1-related kinase 2) (ARK-2) (Aurora-related kinase 2) (STK-1) (Serine/threonine-protein kinase 12) (Serine/threonine-protein kinase 5) (Serine/threonine-protein kinase aurora-B) | EBI-28944360 | 0.35 |
| Q8NCK7 | Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11) | EBI-27103180 | 0.35 |
| Q05D32 | CTD small phosphatase-like protein 2 (CTDSP-like 2) (EC 3.1.3.-) | EBI-27113232 | 0.35 |
Database | Links |
| UNIPROT | P46060 Q96JJ2 |
| PDB | 1Z5S 2GRN 2GRO 2GRP 2GRQ 2GRR 2IO2 2IO3 2IY0 3UIN 3UIO 3UIP 5D2M |
| Pfam | PF13516 PF07834 |
| OMIM | 602362 |
| DisGeNET | 5905 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory