Emerin - Homo sapiens

Emerin (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Emerin
Accession Code	P50402
Gene	EMD
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 254)
MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGDADMYDLPKKE DALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSA YQSITHYRPVSASRSSLDLSYYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLF FIYHFMQAEEGNPF

Structure Viewer (PDB: 2ODG)

Subcellular Location

Description
Nucleus inner membrane {Experimental EvidencePubMed:19167377}; Single-pass membrane protein; Nucleoplasmic side {Experimental EvidencePubMed:19167377}. Nucleus outer membrane. Note=Colocalized with BANF1 at the central region of the assembling nuclear rim, near spindle-attachment sites. The accumulation of different intermediates of prelamin-A/C (non-farnesylated or carboxymethylated farnesylated prelamin-A/C) in fibroblasts modify its localization in the nucleus.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Inner Membrane	SL-0179	The inner membrane of the nucleus is the membrane which separates the nuclear matrix from the intermembrane space. In mammals, the inner nuclear membrane is associated with heterochromatin and the nuclear lamina.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Nuclear Outer Membrane	SL-0183	The outer membrane of the nucleus is the membrane facing the cytoplasm. In mammals, the outer nuclear membrane is continuous in many places with the rough endoplasmic reticulum and is dotted with ribosomes.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Endoplasmic Reticulum (GO:0005783) Membrane (GO:0016020) Microtubule (GO:0005874) Nuclear Envelope (GO:0005635) Nuclear Inner Membrane (GO:0005637) Nuclear Membrane (GO:0031965) Nuclear Outer Membrane (GO:0005640) Nucleoplasm (GO:0005654) Spindle (GO:0005819)

Biology & Function

Description
Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta- catenin activity by preventing its accumulation in the nucleus. Acts by influencing the nuclear accumulation of beta-catenin through a CRM1- dependent export pathway. Links centrosomes to the nuclear envelope via a microtubule association. Required for proper localization of non- farnesylated prelamin-A/C. Together with NEMP1, contributes to nuclear envelope stiffness in germ cells (PubMed:32923640). EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD. {Experimental EvidencePubMed:15328537, Experimental EvidencePubMed:16680152, Experimental EvidencePubMed:16858403, Experimental EvidencePubMed:17785515, Experimental EvidencePubMed:19323649, Experimental EvidencePubMed:32923640}.
Assigned Ontology terms

Biological Process	Cellular Response To Growth Factor Stimulus (GO:0071363) Muscle Contraction (GO:0006936) Muscle Organ Development (GO:0007517) Negative Regulation Of Canonical Wnt Signaling Pathway (GO:0090090) Negative Regulation Of Fibroblast Proliferation (GO:0048147) Nuclear Membrane Organization (GO:0071763) Positive Regulation Of Protein Export From Nucleus (GO:0046827) Regulation Of Canonical Wnt Signaling Pathway (GO:0060828) Skeletal Muscle Cell Differentiation (GO:0035914)
Molecular Function	Actin Binding (GO:0003779) Beta-Tubulin Binding (GO:0048487) Cadherin Binding (GO:0045296)

Disease associations

Description
Emery-Dreifuss muscular dystrophy 1, X-linked (EDMD1) [MIM:310300]: A form of Emery-Dreifuss muscular dystrophy, a degenerative myopathy characterized by weakness and atrophy of muscle without involvement of the nervous system, early contractures of the elbows, Achilles tendons and spine, and cardiomyopathy associated with cardiac conduction defects. {Experimental EvidencePubMed:10323252, Experimental EvidencePubMed:11587540, Experimental EvidencePubMed:15009215, Experimental EvidencePubMed:15328537}. Note=The disease is caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	300384 310300
DisGeNET	2010

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (23 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
A1L3G9	Nuclear envelope integral membrane protein 1b	EBI-12595918	0.40
O94901	SUN domain-containing protein 1	EBI-22057164	0.46
P01112	GTPase HRas, N-terminally processed	EBI-27045317	0.27
P02545	Lamin-A/C	EBI-16795756	0.80
P04626	Receptor tyrosine-protein kinase erbB-2	EBI-32718334	0.35
P0DTC7	ORF7a protein	EBI-25510184	0.35
P13285	Latent membrane protein 2	EBI-11733017	0.35
P35240	Merlin	EBI-23824818	0.56
Q9UH99	SUN domain-containing protein 2	EBI-6753091	0.64
Q9D666	SUN domain-containing protein 1	EBI-6752609	0.52
P50402	Self	EBI-10484783	0.37
P53671	LIM domain kinase 2	EBI-10103591	0.35
Q8NF91	Nesprin-1	EBI-10759458	0.52
Q8WXH0	Nesprin-2	EBI-10760372	0.58
Q8N6L0	Protein KASH5	EBI-11774371	0.79
Q5JX71	Protein FAM209A	EBI-24763501	0.56
Q5SNT2	Transmembrane protein 201	EBI-24476865	0.68
Q9BTV4	Transmembrane protein 43	EBI-22085077	0.54
Q6P5Z2	Serine/threonine-protein kinase N3	EBI-28941754	0.35
O75531	Barrier-to-autointegration factor, N-terminally processed	EBI-10759397	0.94
Q7L5N1	COP9 signalosome complex subunit 6	EBI-731797	0.00
P03246	E1B protein, small T-antigen	EBI-11722343	0.35
P00533	Epidermal growth factor receptor	EBI-32717697	0.42
Interactions with other proteins (245 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9NYF8	Bcl-2-associated transcription factor 1 (Btf) (BCLAF1 and THRAP3 family member 1)	EBI-489904	0.59
Q7L190	Developmental pluripotency-associated protein 4	EBI-731800	0.00
Q99962	Endophilin-A1 (EEN-B1) (Endophilin-1) (SH3 domain protein 2A) (SH3 domain-containing GRB2-like protein 2)	EBI-710249	0.51
Q99963	Endophilin-A3 (EEN-B2) (Endophilin-3) (SH3 domain protein 2C) (SH3 domain-containing GRB2-like protein 3)	EBI-731806	0.00
Q969F0	Fetal and adult testis-expressed transcript protein (Cancer/testis antigen 43) (CT43) (Tumor antigen BJ-HCC-2)	EBI-753397	0.85
O43889	Cyclic AMP-responsive element-binding protein 3 (CREB-3) (cAMP-responsive element-binding protein 3) (Leucine zipper protein) (Luman) (Transcription factor LZIP-alpha) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3 (N-terminal Luman) (Transcriptionally active form)]	EBI-12701204	0.56
Q8N7W2	BEN domain-containing protein 7	EBI-10211848	0.81
P35222	Catenin beta-1 (Beta-catenin)	EBI-8577506	0.59
P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	EBI-1171716	0.53
Q9UKV8	Protein argonaute-2 (Argonaute2) (hAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF-2C 2) (eIF2C 2) (PAZ Piwi domain protein) (PPD) (Protein slicer)	EBI-7642406	0.35
P04296	Major DNA-binding protein	EBI-9631489	0.35
Q9HCK5	Protein argonaute-4 (Argonaute4) (hAgo4) (Argonaute RISC catalytic component 4) (Eukaryotic translation initiation factor 2C 4) (eIF-2C 4) (eIF2C 4)	EBI-2269711	0.35
O70126	Aurora kinase B (EC 2.7.11.1) (Aurora 1) (Aurora- and IPL1-like midbody-associated protein 1) (Aurora/IPL1-related kinase 2) (ARK-2) (Aurora-related kinase 2) (STK-1) (Serine/threonine-protein kinase 12) (Serine/threonine-protein kinase 5) (Serine/threonine-protein kinase aurora-B)	EBI-2557780	0.40
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-2877710	0.35
Q9BQS8	FYVE and coiled-coil domain-containing protein 1 (Zinc finger FYVE domain-containing protein 7)	EBI-3242919	0.35
Q15051	IQ calmodulin-binding motif-containing protein 1 (Nephrocystin-5) (p53 and DNA damage-regulated IQ motif protein) (PIQ)	EBI-4286917	0.35
P51858	Hepatoma-derived growth factor (HDGF) (High mobility group protein 1-like 2) (HMG-1L2)	EBI-4409719	0.35
Q16659	Mitogen-activated protein kinase 6 (MAP kinase 6) (MAPK 6) (EC 2.7.11.24) (Extracellular signal-regulated kinase 3) (ERK-3) (MAP kinase isoform p97) (p97-MAPK)	EBI-7207761	0.37
P0DOE9	Non-structural protein 1 (NS1) (Non-structural protein 1C)	EBI-6138583	0.35
P19320	Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106)	EBI-6191076	0.53
Q77M19	V protein	EBI-6270503	0.35
Q13617	Cullin-2 (CUL-2)	EBI-21327106	0.35
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
P22893	mRNA decay activator protein ZFP36 (Growth factor-inducible nuclear protein NUP475) (TPA-induced sequence 11) (Tristetraprolin) (Zinc finger protein 36) (Zfp-36)	EBI-6506418	0.35
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-6515609	0.53
P57078	Receptor-interacting serine/threonine-protein kinase 4 (EC 2.7.11.1) (Ankyrin repeat domain-containing protein 3) (PKC-delta-interacting protein kinase)	EBI-12503575	0.35
Q8IWZ5	Tripartite motif-containing protein 42	EBI-10211808	0.72
Q53Z40	HCG1 protein (Zinc finger protein 165)	EBI-10211828	0.56
Q5JST6	EF-hand domain-containing family member C2	EBI-10211838	0.56
Q8NEC5	Cation channel sperm-associated protein 1 (CatSper1) (hCatSper)	EBI-10211860	0.81
Q9P286	Serine/threonine-protein kinase PAK 5 (EC 2.7.11.1) (p21-activated kinase 5) (PAK-5) (p21-activated kinase 7) (PAK-7)	EBI-10211880	0.56
Q8NHQ1	Centrosomal protein of 70 kDa (Cep70) (p10-binding protein)	EBI-10211870	0.72
Q9P127	Leucine zipper protein 4 (Cancer/testis antigen 28) (CT-28) (CT28) (Tumor antigen HOM-TES-85)	EBI-10211900	0.81
Q9UNY5	Zinc finger protein 232 (Zinc finger and SCAN domain-containing protein 11)	EBI-10211910	0.56
Q9Y228	TRAF3-interacting JNK-activating modulator (TRAF3-interacting protein 3)	EBI-10211920	0.81
Q13895	Bystin	EBI-10230959	0.72
Q8N8X9	Protein mab-21-like 3	EBI-10268015	0.56
Q8WTP8	Apoptosis-enhancing nuclease (EC 3.1.-.-) (Interferon-stimulated 20 kDa exonuclease-like 1)	EBI-10275770	0.56
Q9ULW3	Activator of basal transcription 1 (hABT1) (Basal transcriptional activator)	EBI-10323933	0.72
O14862	Interferon-inducible protein AIM2 (Absent in melanoma 2)	EBI-9995694	0.35
P10398	Serine/threonine-protein kinase A-Raf (EC 2.7.11.1) (Proto-oncogene A-Raf) (Proto-oncogene A-Raf-1) (Proto-oncogene Pks)	EBI-10101587	0.35
Q13418	Integrin-linked protein kinase (EC 2.7.11.1) (59 kDa serine/threonine-protein kinase) (Beta-integrin-linked kinase) (ILK-1) (ILK-2) (p59ILK)	EBI-10103376	0.35
P51617	Interleukin-1 receptor-associated kinase 1 (IRAK-1) (EC 2.7.11.1)	EBI-10103481	0.53
O60674	Tyrosine-protein kinase JAK2 (EC 2.7.10.2) (Janus kinase 2) (JAK-2)	EBI-10103554	0.35
P04049	RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (Proto-oncogene c-RAF) (cRaf) (Raf-1)	EBI-10104226	0.53
Q9H0K1	Serine/threonine-protein kinase SIK2 (EC 2.7.11.1) (Qin-induced kinase) (Salt-inducible kinase 2) (SIK-2) (Serine/threonine-protein kinase SNF1-like kinase 2)	EBI-10104403	0.35
P03177	Thymidine kinase (EC 2.7.1.21)	EBI-11721652	0.35
P03179	Major tegument protein (MTP) (Protein p140)	EBI-11721697	0.35
P03182	Apoptosis regulator BHRF1 (Early antigen protein R) (EA-R) (Nuclear antigen)	EBI-11721938	0.35
P03225	Protein BDLF2	EBI-11722220	0.35
P06460	Probable protein E5A	EBI-11723082	0.35
P06461	Probable protein E5B	EBI-11723785	0.35
P06792	Probable protein E5	EBI-11724527	0.35
P06927	Probable protein E5	EBI-11724813	0.35
P0C739	Protein BNLF2a	EBI-11725101	0.35
P0CK56	Uncharacterized protein BDLF4	EBI-11725466	0.35
P0CK58	Apoptosis regulator BALF1	EBI-11732874	0.35
P30119	Uncharacterized protein BTRF1	EBI-11733103	0.35
P69901	Probable protein E5B	EBI-11733364	0.35
Q2MG95	BVLF1	EBI-11733653	0.35
Q2MG96	BGLF3.5 protein	EBI-11733890	0.35
Q8AZK7	Epstein-Barr nuclear antigen leader protein (EBNA-LP) (EBV nuclear antigen leader protein) (Epstein-Barr nuclear antigen 5) (EBNA-5) (EBV nuclear antigen 5)	EBI-11734159	0.35
Q8AZJ3	Uncharacterized protein BNLF2b	EBI-11734105	0.35
E9QKK1	Centromere-associated protein E	EBI-10995761	0.35
Q9Z1B5	Mitotic spindle assembly checkpoint protein MAD2A (Mitotic arrest deficient 2-like protein 1) (MAD2-like protein 1)	EBI-10996176	0.35
P36895	Bone morphogenetic protein receptor type-1A (BMP type-1A receptor) (BMPR-1A) (EC 2.7.11.30) (Activin receptor-like kinase 3) (ALK-3) (BMP-2/BMP-4 receptor) (Serine/threonine-protein kinase receptor R5) (SKR5) (CD antigen CD292)	EBI-11008521	0.35
P31150	Rab GDP dissociation inhibitor alpha (Rab GDI alpha) (Guanosine diphosphate dissociation inhibitor 1) (GDI-1) (Oligophrenin-2) (Protein XAP-4)	EBI-11035437	0.35
Q9Z2X1	Heterogeneous nuclear ribonucleoprotein F (hnRNP F) [Cleaved into: Heterogeneous nuclear ribonucleoprotein F, N-terminally processed]	EBI-11066678	0.35
F8VQC7	Kinectin	EBI-11104527	0.35
Q6ZNC8	Lysophospholipid acyltransferase 1 (LPLAT 1) (1-acylglycerophosphocholine O-acyltransferase) (EC 2.3.1.23) (1-acylglycerophosphoethanolamine O-acyltransferase) (EC 2.3.1.n7) (1-acylglycerophosphoserine O-acyltransferase MBOAT1) (EC 2.3.1.n6) (Lysophosphatidylserine acyltransferase) (LPSAT) (Lyso-PS acyltransferase) (Membrane-bound O-acyltransferase domain-containing protein 1) (O-acyltransferase domain-containing protein 1)	EBI-11121915	0.35
Q5T3F8	CSC1-like protein 2 (Transmembrane protein 63B)	EBI-11155257	0.35
Q6NUS6	Tectonic-3	EBI-11368748	0.27
Q86UK5	Limbin (Ellis-van Creveld syndrome protein 2) (EVC2)	EBI-11372136	0.27
Q86X19	Transmembrane protein 17	EBI-11372615	0.27
Q96GX1	Tectonic-2	EBI-11375285	0.27
Q9P0N5	Transmembrane protein 216	EBI-11378021	0.27
Q96Q45	Transmembrane protein 237 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein)	EBI-11396533	0.27
P48039	Melatonin receptor type 1A (Mel-1A-R) (Mel1a receptor)	EBI-11575834	0.37
Q71U36	Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain]	EBI-11897791	0.53
Q6FHY5	MEOX2 protein	EBI-24279203	0.56
Q9BYN7	Zinc finger protein 341	EBI-24339377	0.56
Q04864	Proto-oncogene c-Rel	EBI-24344788	0.56
Q16623	Syntaxin-1A (Neuron-specific antigen HPC-1)	EBI-24487831	0.56
Q6P2D0	Zinc finger protein 1 homolog (Zfp-1) (Zinc finger protein 475)	EBI-24525478	0.56
P20138	Myeloid cell surface antigen CD33 (Sialic acid-binding Ig-like lectin 3) (Siglec-3) (gp67) (CD antigen CD33)	EBI-24662714	0.56
Q5JRM2	Uncharacterized protein CXorf66	EBI-23676624	0.56
Q8N5K1	CDGSH iron-sulfur domain-containing protein 2 (Endoplasmic reticulum intermembrane small protein) (MitoNEET-related 1 protein) (Miner1) (Nutrient-deprivation autophagy factor-1) (NAF-1)	EBI-23679672	0.56
Q96HE8	Transmembrane protein 80	EBI-24667793	0.56
Q6NX45	Zinc finger protein 774	EBI-24670601	0.56
B7U540	Inward rectifier potassium channel 18 (Inward rectifier K(+) channel Kir2.6) (Potassium channel, inwardly rectifying subfamily J member 18)	EBI-24672111	0.56
A6NEL2	Ankyrin repeat domain-containing protein SOWAHB (Ankyrin repeat domain-containing protein 56) (Protein sosondowah homolog B)	EBI-23696046	0.56
Q15842	ATP-sensitive inward rectifier potassium channel 8 (Inward rectifier K(+) channel Kir6.1) (Potassium channel, inwardly rectifying subfamily J member 8) (uKATP-1)	EBI-24689183	0.56
Q9NQX5	Neural proliferation differentiation and control protein 1 (NPDC-1)	EBI-24699630	0.56
Q8N4V1	ER membrane protein complex subunit 5 (Membrane magnesium transporter 1) (Transmembrane protein 32)	EBI-24709706	0.56
Q7RTU1	Transcription factor 23 (TCF-23) (Class A basic helix-loop-helix protein 24) (bHLHa24)	EBI-23756438	0.56
O60930	Ribonuclease H1 (RNase H1) (EC 3.1.26.4) (Ribonuclease H type II)	EBI-23758332	0.56
Q0VD86	Protein INCA1 (Inhibitor of CDK interacting with cyclin A1)	EBI-24717955	0.56
Q7Z6M4	Transcription termination factor 4, mitochondrial (Mitochondrial transcription termination factor 4) (mTERF domain-containing protein 2) [Cleaved into: mTERF domain-containing protein 2 processed]	EBI-23772605	0.56
Q9Y320	Thioredoxin-related transmembrane protein 2 (Cell proliferation-inducing gene 26 protein) (Thioredoxin domain-containing protein 14)	EBI-23795943	0.56
P16157	Ankyrin-1 (ANK-1) (Ankyrin-R) (Erythrocyte ankyrin)	EBI-24733419	0.56
Q9HA82	Ceramide synthase 4 (CerS4) (EC 2.3.1.-) (LAG1 longevity assurance homolog 4) (Sphingosine N-acyltransferase CERS4) (EC 2.3.1.24)	EBI-23800001	0.56
P43628	Killer cell immunoglobulin-like receptor 2DL3 (CD158 antigen-like family member B2) (KIR-023GB) (Killer inhibitory receptor cl 2-3) (NKAT2a) (NKAT2b) (Natural killer-associated transcript 2) (NKAT-2) (p58 natural killer cell receptor clone CL-6) (p58 NK receptor CL-6) (p58.2 MHC class-I-specific NK receptor) (CD antigen CD158b2)	EBI-24742152	0.56
Q9BSJ6	Protein PIMREG (CALM-interactor expressed in thymus and spleen) (PICALM-interacting mitotic regulator) (Regulator of chromosome segregation protein 1)	EBI-24763001	0.56
Q6IBW4	Condensin-2 complex subunit H2 (Chromosome-associated protein H2) (hCAP-H2) (Kleisin-beta) (Non-SMC condensin II complex subunit H2)	EBI-23853144	0.56
Q86VY9	Transmembrane protein 200A	EBI-24778276	0.56
Q8TDT2	Probable G-protein coupled receptor 152 (G-protein coupled receptor PGR5)	EBI-25275476	0.56
Q5T7V8	RAB6-interacting golgin (N-terminal kinase-like-binding protein 1) (NTKL-BP1) (NTKL-binding protein 1) (hNTKL-BP1) (SCY1-like 1-binding protein 1) (SCYL1-BP1) (SCYL1-binding protein 1)	EBI-23923221	0.56
Q8IUY3	GRAM domain-containing protein 2A	EBI-24390287	0.56
P50221	Homeobox protein MOX-1 (Mesenchyme homeobox 1)	EBI-24397223	0.56
O75031	Heat shock factor 2-binding protein	EBI-24417083	0.56
Q9HAQ2	Kinesin-like protein KIF9	EBI-24439983	0.56
Q8TD17	Zinc finger protein 398 (Zinc finger DNA-binding protein p52/p71)	EBI-24447341	0.56
Q96S94	Cyclin-L2 (Paneth cell-enhanced expression protein)	EBI-24556880	0.56
Q6P9A3	Zinc finger protein 549	EBI-24557406	0.56
Q9NU63	Zinc finger protein 57 homolog (Zfp-57) (Zinc finger protein 698)	EBI-24580547	0.56
Q5T686	Arginine vasopressin-induced protein 1 (AVP-induced protein 1)	EBI-24599743	0.56
P21964	Catechol O-methyltransferase (EC 2.1.1.6)	EBI-24641360	0.56
Q86UD4	Zinc finger protein 329	EBI-24646904	0.56
Q96PL5	Erythroid membrane-associated protein (hERMAP) (Radin blood group antigen) (Scianna blood group antigen)	EBI-25169259	0.56
Q4KMG9	Transmembrane protein 52B	EBI-24747207	0.56
Q68DC2	Ankyrin repeat and SAM domain-containing protein 6 (Ankyrin repeat domain-containing protein 14) (SamCystin) (Sterile alpha motif domain-containing protein 6) (SAM domain-containing protein 6)	EBI-25195191	0.56
Q9BRJ2	39S ribosomal protein L45, mitochondrial (L45mt) (MRP-L45) (Mitochondrial large ribosomal subunit protein mL45)	EBI-24789200	0.56
Q14500	ATP-sensitive inward rectifier potassium channel 12 (Inward rectifier K(+) channel Kir2.2) (IRK-2) (Inward rectifier K(+) channel Kir2.2v) (Potassium channel, inwardly rectifying subfamily J member 12)	EBI-24790299	0.56
Q7Z7G2	Complexin-4 (Complexin IV) (CPX IV)	EBI-25207978	0.56
Q9H400	Lck-interacting transmembrane adapter 1 (Lck-interacting membrane protein) (Lck-interacting molecule)	EBI-24799476	0.56
Q8WWF3	Serine-rich single-pass membrane protein 1	EBI-24800633	0.56
Q9UGI6	Small conductance calcium-activated potassium channel protein 3 (SK3) (SKCa 3) (SKCa3) (KCa2.3)	EBI-24807534	0.56
Q86T13	C-type lectin domain family 14 member A (Epidermal growth factor receptor 5) (EGFR-5)	EBI-25224374	0.56
Q8WUU8	Transmembrane protein 174	EBI-25273036	0.56
P49910	Zinc finger protein 165 (Cancer/testis antigen 53) (CT53) (LD65) (Zinc finger and SCAN domain-containing protein 7)	EBI-12696914	0.56
O95292	Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)	EBI-12698321	0.56
Q9NTW7	Zinc finger protein 64 (Zfp-64) (Zinc finger protein 338)	EBI-12700590	0.56
Q12846	Syntaxin-4 (Renal carcinoma antigen NY-REN-31)	EBI-12702158	0.56
P50222	Homeobox protein MOX-2 (Growth arrest-specific homeobox) (Mesenchyme homeobox 2)	EBI-12702328	0.56
Q8N5R6	Coiled-coil domain-containing protein 33 (Cancer/testis antigen 61) (CT61)	EBI-12702476	0.56
O14829	Serine/threonine-protein phosphatase with EF-hands 1 (PPEF-1) (EC 3.1.3.16) (Protein phosphatase with EF calcium-binding domain) (PPEF) (Serine/threonine-protein phosphatase 7) (PP7)	EBI-14024386	0.35
P56180	Putative tyrosine-protein phosphatase TPTE (EC 3.1.3.48) (Cancer/testis antigen 44) (CT44) (Transmembrane phosphatase with tensin homology) (Tumor antigen BJ-HCC-5)	EBI-14025693	0.57
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-16398399	0.35
Q05322	Membrane-associated protein VP24 (Ebola VP24) (eVP24)	EBI-15481401	0.35
P60709	Actin, cytoplasmic 1 (EC 3.6.4.-) (Beta-actin) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed]	EBI-15531451	0.52
P68135	Actin, alpha skeletal muscle (EC 3.6.4.-) (Alpha-actin-1) [Cleaved into: Actin, alpha skeletal muscle, intermediate form]	EBI-15531470	0.60
Q14684	Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B)	EBI-16686997	0.35
O15155	BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18)	EBI-16788067	0.27
P27824	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	EBI-16788621	0.27
P68431	Histone H3.1 (Histone H3/a) (Histone H3/b) (Histone H3/c) (Histone H3/d) (Histone H3/f) (Histone H3/h) (Histone H3/i) (Histone H3/j) (Histone H3/k) (Histone H3/l)	EBI-16793336	0.27
P11279	Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a)	EBI-16794808	0.27
Q9HBL7	Plasminogen receptor (KT) (Plg-R(KT))	EBI-16797780	0.27
P62491	Ras-related protein Rab-11A (Rab-11) (EC 3.6.5.2) (YL8)	EBI-16797971	0.27
P20339	Ras-related protein Rab-5A (EC 3.6.5.2)	EBI-16798221	0.27
P51151	Ras-related protein Rab-9A	EBI-16798325	0.27
P62753	40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6)	EBI-16798663	0.27
O43493	Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2)	EBI-16800265	0.42
Q9NS69	Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog)	EBI-16802054	0.27
Q7KZN9	Cytochrome c oxidase assembly protein COX15 homolog	EBI-20304305	0.35
P36957	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K)	EBI-20305285	0.35
P08559	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I)	EBI-20306509	0.35
P35610	Sterol O-acyltransferase 1 (EC 2.3.1.26) (Acyl-coenzyme A:cholesterol acyltransferase 1) (ACAT-1) (Cholesterol acyltransferase 1)	EBI-20307233	0.35
P21796	Voltage-dependent anion-selective channel protein 1 (VDAC-1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM)	EBI-20307902	0.35
Q9HCE5	N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14)	EBI-20595531	0.35
P51957	Serine/threonine-protein kinase Nek4 (EC 2.7.11.1) (Never in mitosis A-related kinase 4) (NimA-related protein kinase 4) (Serine/threonine-protein kinase 2) (Serine/threonine-protein kinase NRK2)	EBI-20721387	0.35
A2A935	Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1)	EBI-21022882	0.35
P14404	Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog)	EBI-21026252	0.35
Q5T7N2	LINE-1 type transposase domain-containing protein 1 (ES cell-associated protein 11)	EBI-20993270	0.35
P14316	Interferon regulatory factor 2 (IRF-2)	EBI-21260627	0.35
Q15077	P2Y purinoceptor 6 (P2Y6)	EBI-21262943	0.35
F5H1C8	Solute carrier family 15 member 3 (Solute carrier family 15, member 3, isoform CRA_a)	EBI-21264930	0.35
Q03518	Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4)	EBI-21265865	0.35
Q9NQB0	Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)	EBI-21265942	0.35
Q9H1C4	Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1)	EBI-21266770	0.35
Q13163	Dual specificity mitogen-activated protein kinase kinase 5 (MAP kinase kinase 5) (MAPKK 5) (EC 2.7.12.2) (MAPK/ERK kinase 5) (MEK 5)	EBI-25374437	0.35
Q15311	RalA-binding protein 1 (RalBP1) (76 kDa Ral-interacting protein) (Dinitrophenyl S-glutathione ATPase) (DNP-SG ATPase) (EC 7.6.2.2, EC 7.6.2.3) (Ral-interacting protein 1)	EBI-25375541	0.35
Q92934	Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-2-like protein 8) (Bcl2-L-8) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)	EBI-25378368	0.35
P19419	ETS domain-containing protein Elk-1	EBI-25378580	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
Q9H9V9	2-oxoglutarate and iron-dependent oxygenase JMJD4 (EC 1.14.11.-) (JmjC domain-containing protein 4) (Jumonji domain-containing protein 4) (Lysyl-hydroxylase JMJD4)	EBI-25479633	0.35
Q8N5Y8	Protein mono-ADP-ribosyltransferase PARP16 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 15) (Poly [ADP-ribose] polymerase 16) (PARP-16)	EBI-25482187	0.35
P69479	Phosphoprotein (Protein P) (Protein M1)	EBI-25568044	0.35
P0DTC4	Envelope small membrane protein (E) (sM protein)	EBI-25509966	0.35
P0DTC8	ORF8 protein (ORF8) (Non-structural protein 8) (ns8)	EBI-25510273	0.35
P0DTD3	Putative ORF9c protein (ORF9c) (Uncharacterized protein 14) (ORF14)	EBI-25510342	0.35
Q96CS3	FAS-associated factor 2 (Protein ETEA) (UBX domain-containing protein 3B) (UBX domain-containing protein 8)	EBI-25770166	0.35
Q8IWF2	FAD-dependent oxidoreductase domain-containing protein 2 (Endoplasmic reticulum flavoprotein associated with degradation)	EBI-25770736	0.35
Q8NBM4	Ubiquitin-associated domain-containing protein 2 (UBA domain-containing protein 2) (Phosphoglycerate dehydrogenase-like protein 1)	EBI-25771384	0.35
Q5U458	DnaJ homolog subfamily C member 11	EBI-26450034	0.35
O60303	Katanin-interacting protein	EBI-26582514	0.35
P34972	Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5)	EBI-26880846	0.35
P01116	GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]	EBI-27041844	0.27
P01111	GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)	EBI-27042293	0.27
F1PAA9	Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-27079701	0.27
A0A0H3NFP4	SPI-2 type III secretion system effector SifA (Type III secretion system effector protein-necessary for Sif formation and maintaining the SCV. Has GAP activity)	EBI-27055788	0.27
A0A0H3NG92	Type III secretion system effector protein-regulates and maintains the SCV (Type III secretion systems effector SseF)	EBI-27055968	0.27
A0A0H3NF08	SPI-2 type III secretion system effector PipB2 (Type III secretion system effector protein, Contributes to Sif formation)	EBI-27055973	0.27
A0A0H3NB75	Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV)	EBI-27055983	0.27
P35226	Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51)	EBI-27108918	0.35
Q99592	Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171)	EBI-27093179	0.35
Q86UX6	Serine/threonine-protein kinase 32C (EC 2.7.11.1) (PKE) (Yet another novel kinase 3)	EBI-28942129	0.35
Q99986	Serine/threonine-protein kinase VRK1 (EC 2.7.11.1) (Vaccinia-related kinase 1)	EBI-28944934	0.35
Q9UJY1	Heat shock protein beta-8 (HspB8) (Alpha-crystallin C chain) (E2-induced gene 1 protein) (Protein kinase H11) (Small stress protein-like protein HSP22)	EBI-28946841	0.35
Q8NCK7	Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11)	EBI-27103180	0.35
Q93009	Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7)	EBI-30841862	0.44
Q05925	Homeobox protein engrailed-1 (Homeobox protein en-1) (Hu-En-1)	EBI-29000369	0.35
P23769	Endothelial transcription factor GATA-2 (GATA-binding protein 2)	EBI-29000495	0.35
P23771	Trans-acting T-cell-specific transcription factor GATA-3 (GATA-binding factor 3)	EBI-29000509	0.35
Q8TDD2	Transcription factor Sp7 (Zinc finger protein osterix)	EBI-29000537	0.35
P57682	Krueppel-like factor 3 (Basic krueppel-like factor) (CACCC-box-binding protein BKLF) (TEF-2)	EBI-29000670	0.35
P43694	Transcription factor GATA-4 (GATA-binding factor 4)	EBI-29011567	0.35
Q9UIH9	Krueppel-like factor 15 (Kidney-enriched krueppel-like factor)	EBI-29019642	0.35
Q9BXK1	Krueppel-like factor 16 (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2)	EBI-29019783	0.35
O95600	Krueppel-like factor 8 (Basic krueppel-like factor 3) (Zinc finger protein 741)	EBI-29020196	0.35
P48431	Transcription factor SOX-2	EBI-29373058	0.35
P35712	Transcription factor SOX-6	EBI-29384845	0.35
P08047	Transcription factor Sp1	EBI-29385496	0.35
P31314	T-cell leukemia homeobox protein 1 (Homeobox protein Hox-11) (Proto-oncogene TCL-3) (T-cell leukemia/lymphoma protein 3)	EBI-29607649	0.35
O43763	T-cell leukemia homeobox protein 2 (Homeobox protein Hox-11L1) (Neural crest homeobox protein)	EBI-29612789	0.35
O43711	T-cell leukemia homeobox protein 3 (Homeobox protein Hox-11L2)	EBI-29624592	0.35
P52952	Homeobox protein Nkx-2.5 (Cardiac-specific homeobox) (Homeobox protein CSX) (Homeobox protein NK-2 homolog E)	EBI-29653951	0.35
Q9Y4X4	Krueppel-like factor 12 (Transcriptional repressor AP-2rep)	EBI-29017631	0.27
P21709	Ephrin type-A receptor 1 (hEpha1) (EC 2.7.10.1) (EPH tyrosine kinase) (EPH tyrosine kinase 1) (Erythropoietin-producing hepatoma receptor) (Tyrosine-protein kinase receptor EPH)	EBI-32717758	0.35
P29322	Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK)	EBI-32718189	0.42
P22455	Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334)	EBI-32718547	0.35
P35916	Vascular endothelial growth factor receptor 3 (VEGFR-3) (EC 2.7.10.1) (Fms-like tyrosine kinase 4) (FLT-4) (Tyrosine-protein kinase receptor FLT4)	EBI-32718614	0.35
P08069	Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain]	EBI-32718669	0.42
P06213	Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta]	EBI-32718777	0.42
P08581	Hepatocyte growth factor receptor (HGF receptor) (EC 2.7.10.1) (HGF/SF receptor) (Proto-oncogene c-Met) (Scatter factor receptor) (SF receptor) (Tyrosine-protein kinase Met)	EBI-32719056	0.42
P04629	High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (p140-TrkA)	EBI-32719115	0.35
Q16288	NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)	EBI-32719212	0.35
Q01974	Tyrosine-protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor-related 2)	EBI-32719482	0.42
Q6J9G0	Tyrosine-protein kinase STYK1 (EC 2.7.10.2) (Novel oncogene with kinase domain) (Protein PK-unique) (Serine/threonine/tyrosine kinase 1)	EBI-32719662	0.42
Q06418	Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine-protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine-protein kinase TIF)	EBI-32719716	0.35
Q9UM73	ALK tyrosine kinase receptor (EC 2.7.10.1) (Anaplastic lymphoma kinase) (CD antigen CD246)	EBI-32719830	0.27
P30530	Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene)	EBI-32719959	0.27
P21860	Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3)	EBI-32721529	0.27
P22607	Fibroblast growth factor receptor 3 (FGFR-3) (EC 2.7.10.1) (CD antigen CD333)	EBI-32721979	0.27
P17948	Vascular endothelial growth factor receptor 1 (VEGFR-1) (EC 2.7.10.1) (Fms-like tyrosine kinase 1) (FLT-1) (Tyrosine-protein kinase FRT) (Tyrosine-protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor)	EBI-32722433	0.27
P36888	Receptor-type tyrosine-protein kinase FLT3 (EC 2.7.10.1) (FL cytokine receptor) (Fetal liver kinase-2) (FLK-2) (Fms-like tyrosine kinase 3) (FLT-3) (Stem cell tyrosine kinase 1) (STK-1) (CD antigen CD135)	EBI-32722567	0.27
P14616	Insulin receptor-related protein (IRR) (EC 2.7.10.1) (IR-related receptor) [Cleaved into: Insulin receptor-related protein alpha chain; Insulin receptor-related protein beta chain]	EBI-32723232	0.27
P35968	Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase insert domain receptor) (KDR) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309)	EBI-32723270	0.27
Q8IWU2	Serine/threonine-protein kinase LMTK2 (EC 2.7.11.1) (Apoptosis-associated tyrosine kinase 2) (Brain-enriched kinase) (hBREK) (CDK5/p35-regulated kinase) (CPRK) (Kinase/phosphatase/inhibitor 2) (Lemur tyrosine kinase 2) (Serine/threonine-protein kinase KPI-2)	EBI-32723604	0.27
Q12866	Tyrosine-protein kinase Mer (EC 2.7.10.1) (Proto-oncogene c-Mer) (Receptor tyrosine kinase MerTK)	EBI-32723870	0.27
O15146	Muscle, skeletal receptor tyrosine-protein kinase (EC 2.7.10.1) (Muscle-specific tyrosine-protein kinase receptor) (MuSK) (Muscle-specific kinase receptor)	EBI-32724025	0.27
P07949	Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment]	EBI-32725031	0.27
P08922	Proto-oncogene tyrosine-protein kinase ROS (EC 2.7.10.1) (Proto-oncogene c-Ros) (Proto-oncogene c-Ros-1) (Receptor tyrosine kinase c-ros oncogene 1) (c-Ros receptor tyrosine kinase)	EBI-32731758	0.27
Q02763	Angiopoietin-1 receptor (EC 2.7.10.1) (Endothelial tyrosine kinase) (Tunica interna endothelial cell kinase) (Tyrosine kinase with Ig and EGF homology domains-2) (Tyrosine-protein kinase receptor TEK) (Tyrosine-protein kinase receptor TIE-2) (hTIE2) (p140 TEK) (CD antigen CD202b)	EBI-32732012	0.35
Q8N612	FHF complex subunit HOOK interacting protein 1B (FHIP1B) (FTS and Hook-interacting protein) (FHIP)	EBI-34574737	0.27
Q5W0V3	FHF complex subunit HOOK interacting protein 2A (FHIP2A)	EBI-34574999	0.27

Cross-References

Database	Links
UNIPROT	P50402 Q6FI02
PDB	1JEI 2ODC 2ODG 6GHD 6RPR 7NDY
Pfam	PF03020
PROSITE	PS50954
OMIM	300384 310300
DisGeNET	2010

Emerin (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 2ODG)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (23 interactors)

Interactions with other proteins (245 interactors)

Cross-References

Database

Links

Description

Description