Protein Information |
|
|---|---|
| Protein Name | Serine/threonine-protein kinase LMTK1 |
| Accession Code | Q6ZMQ8 |
| Gene | AATK |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 1374) | |
|
MSSSFFNPSFAFSSHFDPDGAPLSELSWPSSLAVVAVSFSGLFAVIVLMLACLCCKKGGIGFKEFENAEGDEYAADLAQGSPATAAQNGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDVGRHSLLYLKE IGRGWFGKVFLGEVNSGISSAQVVVKELQASASVQEQMQFLEEVQPYRALKHSNLLQCLAQCAEVTPYLLVMEFCPLGDLKGYLRSCRVAESMAPDPRTLQRMACEVACGVLHLHRNNFVHSDLALRNCL LTADLTVKIGDYGLAHCKYREDYFVTADQLWVPLRWIAPELVDEVHSNLLVVDQTKSGNVWSLGVTIWELFELGTQPYPQHSDQQVLAYTVREQQLKLPKPQLQLTLSDRWYEVMQFCWLQPEQRPTAEE VHLLLSYLCAKGATEAEEEFERRWRSLRPGGGGVGPGPGAAGPMLGGVVELAAASSFPLLEQFAGDGFHADGDDVLTVTETSRGLNFEYKWEAGRGAEAFPATLSPGRTARLQELCAPDGAPPGVVPVLS AHSPSLGSEYFIRLEEAAPAAGHDPDCAGCAPSPPATADQDDDSDGSTAASLAMEPLLGHGPPVDVPWGRGDHYPRRSLARDPLCPSRSPSPSAGPLSLAEGGAEDADWGVAAFCPAFFEDPLGTSPLGS SGAPPLPLTGEDELEEVGARRAAQRGHWRSNVSANNNSGSRCPESWDPVSAGGHAEGCPSPKQTPRASPEPGYPGEPLLGLQAASAQEPGCCPGLPHLCSAQGLAPAPCLVTPSWTETASSGGDHPQAEP KLATEAEGTTGPRLPLPSVPSPSQEGAPLPSEEASAPDAPDALPDSPTPATGGEVSAIKLASALNGSSSSPEVEAPSSEDEDTAEATSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTPDSLDSLDIPS SASDGGYEVFSPSATGPSGGQPRALDSGYDTENYESPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLPSTGQPSEQVCLR PGVSGEAQGSGPGEVLPPLLQLEGSSPEPSTCPSGLVPEPPEPQGPAKVRPGPSPSCSQFFLLTPVPLRSEGNSSEFQGPPGLLSGPAPQKRMGGPGTPRAPLRLALPGLPAALEGRPEEEEEDSEDSDE SDEELRCYSVQEPSEDSEEEAPAVPVVVAESQSARNLRSLLKMPSLLSETFCEDLERKKKAVSFFDDVTVYLFDQESPTRELGEPFPGAKESPPTFLRGSPGSPSAPNRPQQADGSPNGSTAEEGGGFAW DDDFPLMTAKAAFAMALDPAAPAPAAPTPTPAPFSRFTVSPAPTSRFSITHVSDSDAESKRGPEAGAGGESKEA |
|
Description |
||
|---|---|---|
| Membrane {By Similarity}; Single-pass type I membrane protein {By Similarity}. Cytoplasm {ECO:0000269|PubMed:10837911}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:10837911}. Note=Predominantly perinuclear. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms |
| Cellular Component | Perinuclear Region Of Cytoplasm (GO:0048471) |
|
Description |
|
|---|---|
| May be involved in neuronal differentiation. {Experimental EvidencePubMed:10837911}. | Assigned Ontology terms |
| Biological Process | Brain Development (GO:0007420) Peptidyl-Tyrosine Autophosphorylation (GO:0038083) Protein Phosphorylation (GO:0006468) |
| Molecular Function | ATP Binding (GO:0005524) Protein Kinase Activity (GO:0004672) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674) Protein Tyrosine Kinase Activity (GO:0004713) |
Interactions with Nuclear Envelope proteins (19 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O95248 | Myotubularin-related protein 5 | EBI-20980276 | 0.37 |
| Q15256 | Receptor-type tyrosine-protein phosphatase R | EBI-20980062 | 0.37 |
| Q96QG7 | Myotubularin-related protein 9 | EBI-20980306 | 0.37 |
| Q9Y217 | Myotubularin-related protein 6 | EBI-20980286 | 0.37 |
| Q96EF0 | Myotubularin-related protein 8 | EBI-20980296 | 0.37 |
| Q9UMZ2 | Synergin gamma | EBI-32723474 | 0.27 |
| Q8N1F7 | Nuclear pore complex protein Nup93 | EBI-32723474 | 0.27 |
| Q9H2J4 | Phosducin-like protein 3 | EBI-32723474 | 0.27 |
| Q96A49 | Synapse-associated protein 1 | EBI-32723474 | 0.27 |
| Q6ULP2 | Aftiphilin | EBI-32723474 | 0.27 |
| Q15078 | Cyclin-dependent kinase 5 activator 1, p25 | EBI-2008413 | 0.59 |
| P61810 | Cyclin-dependent kinase 5 activator 1, p25 | EBI-2008524 | 0.40 |
| Q9NQC7 | Ubiquitin carboxyl-terminal hydrolase CYLD | EBI-32723474 | 0.27 |
| Q14203 | Dynactin subunit 1 | EBI-32723474 | 0.27 |
| P31689 | DnaJ homolog subfamily A member 1 | EBI-10101253 | 0.35 |
| P04626 | Receptor tyrosine-protein kinase erbB-2 | EBI-25367655 | 0.37 |
| Q06787 | Fragile X messenger ribonucleoprotein 1 | EBI-32723474 | 0.27 |
| Q15811 | Intersectin-1 | EBI-32723474 | 0.27 |
| P43034 | Platelet-activating factor acetylhydrolase IB subunit beta | EBI-32723474 | 0.27 | Interactions with other proteins (172 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q03114 | Cyclin-dependent kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Cyclin-dependent-like kinase 5) (Serine/threonine-protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit) | EBI-2008524 | 0.40 |
| Q00535 | Cyclin-dependent kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Cyclin-dependent-like kinase 5) (Serine/threonine-protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit) | EBI-2008624 | 0.40 |
| P62136 | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16) | EBI-5549776 | 0.67 |
| P51571 | Translocon-associated protein subunit delta (TRAP-delta) (Signal sequence receptor subunit delta) (SSR-delta) | EBI-10101253 | 0.35 |
| Q9UJS0 | Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial (Calcium-binding mitochondrial carrier protein Aralar2) (ARALAR-related gene 2) (ARALAR2) (Citrin) (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13) | EBI-10101253 | 0.35 |
| P36873 | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit) | EBI-10101253 | 0.66 |
| Q15293 | Reticulocalbin-1 | EBI-10101253 | 0.35 |
| Q9NVI7 | ATPase family AAA domain-containing protein 3A | EBI-10101253 | 0.53 |
| P04792 | Heat shock protein beta-1 (HspB1) (28 kDa heat shock protein) (Estrogen-regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP 27) (Stress-responsive protein 27) (SRP27) | EBI-10101253 | 0.35 |
| P68032 | Actin, alpha cardiac muscle 1 (EC 3.6.4.-) (Alpha-cardiac actin) [Cleaved into: Actin, alpha cardiac muscle 1, intermediate form] | EBI-10101253 | 0.35 |
| O75746 | Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial (Araceli hiperlarga) (Aralar) (Aralar1) (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) | EBI-10101253 | 0.35 |
| Q9H936 | Mitochondrial glutamate carrier 1 (GC-1) (Glutamate/H(+) symporter 1) (Solute carrier family 25 member 22) | EBI-10101253 | 0.35 |
| Q96EY1 | DnaJ homolog subfamily A member 3, mitochondrial (DnaJ protein Tid-1) (hTid-1) (Hepatocellular carcinoma-associated antigen 57) (Tumorous imaginal discs protein Tid56 homolog) | EBI-10101253 | 0.35 |
| P13674 | Prolyl 4-hydroxylase subunit alpha-1 (4-PH alpha-1) (EC 1.14.11.2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-1) | EBI-10101253 | 0.53 |
| O60762 | Dolichol-phosphate mannosyltransferase subunit 1 (EC 2.4.1.83) (Dolichol-phosphate mannose synthase subunit 1) (DPM synthase subunit 1) (Dolichyl-phosphate beta-D-mannosyltransferase subunit 1) (Mannose-P-dolichol synthase subunit 1) (MPD synthase subunit 1) | EBI-10101253 | 0.35 |
| Q02978 | Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP) (alpha-oxoglutarate carrier) (Solute carrier family 25 member 11) (SLC25A11) | EBI-10101253 | 0.48 |
| P53007 | Tricarboxylate transport protein, mitochondrial (Citrate transport protein) (CTP) (Mitochondrial citrate carrier) (CIC) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein) | EBI-10101253 | 0.35 |
| Q96N21 | AP-4 complex accessory subunit Tepsin (ENTH domain-containing protein 2) (Epsin for AP-4) (Tetra-epsin) | EBI-23805010 | 0.56 |
| P30411 | B2 bradykinin receptor (B2R) (BK-2 receptor) | EBI-20803497 | 0.37 |
| P35236 | Tyrosine-protein phosphatase non-receptor type 7 (EC 3.1.3.48) (Hematopoietic protein-tyrosine phosphatase) (HEPTP) (Protein-tyrosine phosphatase LC-PTP) | EBI-20980082 | 0.37 |
| P16298 | Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit beta isoform) (CNA beta) | EBI-20979982 | 0.37 |
| Q08209 | Protein phosphatase 3 catalytic subunit alpha (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calcineurin A alpha) (Calmodulin-dependent calcineurin A subunit alpha isoform) (CNA alpha) (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform) | EBI-20979972 | 0.37 |
| P62140 | Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53) | EBI-20979952 | 0.55 |
| P35813 | Protein phosphatase 1A (EC 3.1.3.16) (Protein phosphatase 2C isoform alpha) (PP2C-alpha) (Protein phosphatase IA) | EBI-20979992 | 0.37 |
| P29350 | Tyrosine-protein phosphatase non-receptor type 6 (EC 3.1.3.48) (Hematopoietic cell protein-tyrosine phosphatase) (Protein-tyrosine phosphatase 1C) (PTP-1C) (Protein-tyrosine phosphatase SHP-1) (SH-PTP1) | EBI-20980072 | 0.37 |
| Q15750 | TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 1) (TGF-beta-activated kinase 1-binding protein 1) (TAK1-binding protein 1) | EBI-20980052 | 0.52 |
| Q9H0C8 | Integrin-linked kinase-associated serine/threonine phosphatase 2C (ILKAP) (EC 3.1.3.16) | EBI-20980042 | 0.37 |
| Q96MI6 | Protein phosphatase 1M (EC 3.1.3.16) (Protein phosphatase 2C isoform eta) (PP2C-eta) (PP2CE) | EBI-20980032 | 0.37 |
| Q8N3J5 | Protein phosphatase 1K, mitochondrial (EC 3.1.3.16) (PP2C domain-containing protein phosphatase 1K) (PP2C-like mitochondrial protein) (PP2C-type mitochondrial phosphoprotein phosphatase) (PTMP) (Protein phosphatase 2C isoform kappa) (PP2C-kappa) | EBI-20980022 | 0.37 |
| O75688 | Protein phosphatase 1B (EC 3.1.3.16) (Protein phosphatase 2C isoform beta) (PP2C-beta) | EBI-20980002 | 0.37 |
| P49593 | Protein phosphatase 1F (EC 3.1.3.16) (Ca(2+)/calmodulin-dependent protein kinase phosphatase) (CaM-kinase phosphatase) (CaMKPase) (Partner of PIX 2) (Protein fem-2 homolog) (hFem-2) | EBI-20980012 | 0.37 |
| Q68J44 | Dual specificity phosphatase 29 (Dual specificity phosphatase 27) (Dual specificity phosphatase DUPD1) (EC 3.1.3.16, EC 3.1.3.48) | EBI-20980172 | 0.37 |
| Q06124 | Tyrosine-protein phosphatase non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1D) (PTP-1D) (Protein-tyrosine phosphatase 2C) (PTP-2C) (SH-PTP2) (SHP-2) (Shp2) (SH-PTP3) | EBI-20980092 | 0.37 |
| Q16690 | Dual specificity protein phosphatase 5 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase hVH3) | EBI-20980132 | 0.37 |
| Q05209 | Tyrosine-protein phosphatase non-receptor type 12 (EC 3.1.3.48) (PTP-PEST) (Protein-tyrosine phosphatase G1) (PTPG1) | EBI-20980102 | 0.37 |
| Q99952 | Tyrosine-protein phosphatase non-receptor type 18 (EC 3.1.3.48) (Brain-derived phosphatase) | EBI-20980112 | 0.37 |
| Q99956 | Dual specificity protein phosphatase 9 (EC 3.1.3.16) (EC 3.1.3.48) (Mitogen-activated protein kinase phosphatase 4) (MAP kinase phosphatase 4) (MKP-4) | EBI-20980152 | 0.37 |
| Q16828 | Dual specificity protein phosphatase 6 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase PYST1) (Mitogen-activated protein kinase phosphatase 3) (MAP kinase phosphatase 3) (MKP-3) | EBI-20980142 | 0.37 |
| P28562 | Dual specificity protein phosphatase 1 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase hVH1) (Mitogen-activated protein kinase phosphatase 1) (MAP kinase phosphatase 1) (MKP-1) (Protein-tyrosine phosphatase CL100) | EBI-20980122 | 0.37 |
| O95147 | Dual specificity protein phosphatase 14 (EC 3.1.3.16) (EC 3.1.3.48) (MKP-1-like protein tyrosine phosphatase) (MKP-L) (Mitogen-activated protein kinase phosphatase 6) (MAP kinase phosphatase 6) (MKP-6) | EBI-20980162 | 0.37 |
| Q6XPS3 | Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 (EC 3.1.3.67) (Lipid phosphatase TPIP) (TPTE and PTEN homologous inositol lipid phosphatase) | EBI-20980222 | 0.37 |
| P60484 | Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (EC 3.1.3.16) (EC 3.1.3.48) (EC 3.1.3.67) (Mutated in multiple advanced cancers 1) (Phosphatase and tensin homolog) | EBI-20980212 | 0.37 |
| A2A3K4 | Protein tyrosine phosphatase domain-containing protein 1 (EC 3.1.3.-) | EBI-20980202 | 0.37 |
| Q9UNH5 | Dual specificity protein phosphatase CDC14A (EC 3.1.3.16) (EC 3.1.3.48) (CDC14 cell division cycle 14 homolog A) | EBI-20980192 | 0.37 |
| Q8WUJ0 | Serine/threonine/tyrosine-interacting protein (Inactive tyrosine-protein phosphatase STYX) (Phosphoserine/threonine/tyrosine interaction protein) | EBI-20980182 | 0.37 |
| Q9NXD2 | Myotubularin-related protein 10 (Inactive phosphatidylinositol 3-phosphatase 10) | EBI-20980316 | 0.37 |
| O95677 | Eyes absent homolog 4 (EC 3.1.3.48) | EBI-20980346 | 0.37 |
| O00167 | Eyes absent homolog 2 (EC 3.1.3.48) | EBI-20980336 | 0.37 |
| P30305 | M-phase inducer phosphatase 2 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25B) | EBI-20980326 | 0.37 |
| Q15326 | Zinc finger MYND domain-containing protein 11 (Adenovirus 5 E1A-binding protein) (Bone morphogenetic protein receptor-associated molecule 1) (Protein BS69) | EBI-30825123 | 0.44 |
| O95747 | Serine/threonine-protein kinase OSR1 (EC 2.7.11.1) (Oxidative stress-responsive 1 protein) | EBI-30834562 | 0.57 |
| P07900 | Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38) | EBI-32718899 | 0.35 |
| Q9UKB1 | F-box/WD repeat-containing protein 11 (F-box and WD repeats protein beta-TrCP2) (F-box/WD repeat-containing protein 1B) (Homologous to Slimb protein) (HOS) | EBI-32718899 | 0.42 |
| Q92598 | Heat shock protein 105 kDa (Antigen NY-CO-25) (Heat shock 110 kDa protein) | EBI-32718899 | 0.42 |
| Q16543 | Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed] | EBI-32718899 | 0.35 |
| Q9Y297 | F-box/WD repeat-containing protein 1A (E3RSIkappaB) (Epididymis tissue protein Li 2a) (F-box and WD repeats protein beta-TrCP) (pIkappaBalpha-E3 receptor subunit) | EBI-32718899 | 0.35 |
| P35241 | Radixin | EBI-32718899 | 0.35 |
| O95757 | Heat shock 70 kDa protein 4L (Heat shock 70-related protein APG-1) (Heat-shock protein family A member 4-like protein) (HSPA4-like protein) (Osmotic stress protein 94) | EBI-32718899 | 0.42 |
| Q00325 | Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3) | EBI-32718899 | 0.35 |
| Q01813 | ATP-dependent 6-phosphofructokinase, platelet type (ATP-PFK) (PFK-P) (EC 2.7.1.11) (6-phosphofructokinase type C) (Phosphofructo-1-kinase isozyme C) (PFK-C) (Phosphohexokinase) | EBI-32718899 | 0.35 |
| Q13616 | Cullin-1 (CUL-1) | EBI-32718899 | 0.35 |
| Q709F0 | Acyl-CoA dehydrogenase family member 11 (ACAD-11) (EC 1.3.8.-) | EBI-32718899 | 0.35 |
| Q86XK2 | F-box only protein 11 (Protein arginine N-methyltransferase 9) (Vitiligo-associated protein 1) (VIT-1) | EBI-32718899 | 0.35 |
| Q9UBX3 | Mitochondrial dicarboxylate carrier (DIC) (Solute carrier family 25 member 10) | EBI-32718899 | 0.35 |
| P04114 | Apolipoprotein B-100 (Apo B-100) [Cleaved into: Apolipoprotein B-48 (Apo B-48)] | EBI-32718899 | 0.35 |
| O00483 | Cytochrome c oxidase subunit NDUFA4 (Complex I-MLRQ) (CI-MLRQ) (NADH-ubiquinone oxidoreductase MLRQ subunit) | EBI-32718899 | 0.42 |
| Q9BSD7 | Cancer-related nucleoside-triphosphatase (NTPase) (EC 3.6.1.15) (Nucleoside triphosphate phosphohydrolase) | EBI-32718899 | 0.35 |
| O15197 | Ephrin type-B receptor 6 (HEP) (Tyrosine-protein kinase-defective receptor EPH-6) | EBI-32721423 | 0.27 |
| O43615 | Mitochondrial import inner membrane translocase subunit TIM44 | EBI-32723474 | 0.27 |
| Q8IXI1 | Mitochondrial Rho GTPase 2 (MIRO-2) (hMiro-2) (EC 3.6.5.-) (Ras homolog gene family member T2) | EBI-32723474 | 0.27 |
| Q6P1N0 | Coiled-coil and C2 domain-containing protein 1A (Akt kinase-interacting protein 1) (Five prime repressor element under dual repression-binding protein 1) (FRE under dual repression-binding protein 1) (Freud-1) (Putative NF-kappa-B-activating protein 023N) | EBI-32723474 | 0.27 |
| P50851 | Lipopolysaccharide-responsive and beige-like anchor protein (Beige-like protein) (CDC4-like protein) | EBI-32723474 | 0.27 |
| P78527 | DNA-dependent protein kinase catalytic subunit (DNA-PK catalytic subunit) (DNA-PKcs) (EC 2.7.11.1) (DNPK1) (p460) | EBI-32723474 | 0.27 |
| Q14204 | Cytoplasmic dynein 1 heavy chain 1 (Cytoplasmic dynein heavy chain 1) (Dynein heavy chain, cytosolic) | EBI-32723474 | 0.27 |
| P42566 | Epidermal growth factor receptor substrate 15 (Protein Eps15) (Protein AF-1p) | EBI-32723474 | 0.27 |
| Q9BXF6 | Rab11 family-interacting protein 5 (Rab11-FIP5) (Gamma-SNAP-associated factor 1) (Gaf-1) (Phosphoprotein pp75) (Rab11-interacting protein Rip11) | EBI-32723474 | 0.27 |
| Q6WKZ4 | Rab11 family-interacting protein 1 (Rab11-FIP1) (Rab-coupling protein) | EBI-32723474 | 0.27 |
| Q7Z3T8 | Zinc finger FYVE domain-containing protein 16 (Endofin) (Endosome-associated FYVE domain protein) | EBI-32723474 | 0.27 |
| Q9H0B6 | Kinesin light chain 2 (KLC 2) | EBI-32723474 | 0.27 |
| Q8N8S7 | Protein enabled homolog | EBI-32723474 | 0.27 |
| P63010 | AP-2 complex subunit beta (AP105B) (Adaptor protein complex AP-2 subunit beta) (Adaptor-related protein complex 2 subunit beta) (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit) | EBI-32723474 | 0.27 |
| Q96B97 | SH3 domain-containing kinase-binding protein 1 (CD2-binding protein 3) (CD2BP3) (Cbl-interacting protein of 85 kDa) (Human Src family kinase-binding protein 1) (HSB-1) | EBI-32723474 | 0.27 |
| P47897 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | EBI-32723474 | 0.27 |
| Q15435 | Protein phosphatase 1 regulatory subunit 7 (Protein phosphatase 1 regulatory subunit 22) | EBI-32723474 | 0.27 |
| O95782 | AP-2 complex subunit alpha-1 (100 kDa coated vesicle protein A) (Adaptor protein complex AP-2 subunit alpha-1) (Adaptor-related protein complex 2 subunit alpha-1) (Alpha-adaptin A) (Alpha1-adaptin) (Clathrin assembly protein complex 2 alpha-A large chain) (Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit) | EBI-32723474 | 0.27 |
| Q9UJW0 | Dynactin subunit 4 (Dyn4) (Dynactin subunit p62) | EBI-32723474 | 0.27 |
| Q658Y4 | Protein FAM91A1 | EBI-32723474 | 0.27 |
| Q641Q2 | WASH complex subunit 2A | EBI-32723474 | 0.27 |
| Q12972 | Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) [Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1)] | EBI-32723474 | 0.27 |
| A5YKK6 | CCR4-NOT transcription complex subunit 1 (CCR4-associated factor 1) (Negative regulator of transcription subunit 1 homolog) (NOT1H) (hNOT1) | EBI-32723474 | 0.27 |
| Q15643 | Thyroid receptor-interacting protein 11 (TR-interacting protein 11) (TRIP-11) (Clonal evolution-related gene on chromosome 14 protein) (Golgi-associated microtubule-binding protein 210) (GMAP-210) (Trip230) | EBI-32723474 | 0.27 |
| P38606 | V-type proton ATPase catalytic subunit A (V-ATPase subunit A) (EC 7.1.2.2) (V-ATPase 69 kDa subunit) (Vacuolar ATPase isoform VA68) (Vacuolar proton pump subunit alpha) | EBI-32723474 | 0.27 |
| Q13643 | Four and a half LIM domains protein 3 (FHL-3) (Skeletal muscle LIM-protein 2) (SLIM-2) | EBI-32723474 | 0.27 |
| O76021 | Ribosomal L1 domain-containing protein 1 (CATX-11) (Cellular senescence-inhibited gene protein) (Protein PBK1) | EBI-32723474 | 0.27 |
| Q8N3F8 | MICAL-like protein 1 (Molecule interacting with Rab13) (MIRab13) | EBI-32723474 | 0.27 |
| Q15046 | Lysine--tRNA ligase (EC 2.7.7.-) (EC 6.1.1.6) (Lysyl-tRNA synthetase) (LysRS) | EBI-32723474 | 0.27 |
| Q3YEC7 | Rab-like protein 6 (GTP-binding protein Parf) (Partner of ARF) (Rab-like protein 1) (RBEL1) | EBI-32723474 | 0.27 |
| P05198 | Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 subunit alpha) (eIF-2-alpha) (eIF-2A) (eIF-2alpha) | EBI-32723474 | 0.27 |
| O60264 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5) (EC 3.6.4.-) (Sucrose nonfermenting protein 2 homolog) (hSNF2H) | EBI-32723474 | 0.27 |
| P62495 | Eukaryotic peptide chain release factor subunit 1 (Eukaryotic release factor 1) (eRF1) (Protein Cl1) (TB3-1) | EBI-32723474 | 0.27 |
| Q9NZM3 | Intersectin-2 (SH3 domain-containing protein 1B) (SH3P18) (SH3P18-like WASP-associated protein) | EBI-32723474 | 0.27 |
| Q8NDI1 | EH domain-binding protein 1 | EBI-32723474 | 0.27 |
| P42025 | Beta-centractin (Actin-related protein 1B) (ARP1B) | EBI-32723474 | 0.27 |
| Q9P260 | RAB11-binding protein RELCH (LisH domain and HEAT repeat-containing protein KIAA1468) (RAB11 binding and LisH domain, coiled-coil and HEAT repeat-containing) (RAB11-binding protein containing LisH, coiled-coil, and HEAT repeats) | EBI-32723474 | 0.27 |
| P41236 | Protein phosphatase inhibitor 2 (IPP-2) | EBI-32723474 | 0.27 |
| Q12768 | WASH complex subunit 5 (Strumpellin) (WASH complex subunit strumpellin) | EBI-32723474 | 0.27 |
| Q96Q05 | Trafficking protein particle complex subunit 9 (NIK- and IKBKB-binding protein) (Tularik gene 1 protein) | EBI-32723474 | 0.27 |
| Q96SB3 | Neurabin-2 (Neurabin-II) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) | EBI-32723474 | 0.27 |
| Q2M389 | WASH complex subunit 4 (Strumpellin and WASH-interacting protein) (SWIP) (WASH complex subunit SWIP) | EBI-32723474 | 0.27 |
| O60282 | Kinesin heavy chain isoform 5C (EC 3.6.4.-) (Kinesin heavy chain neuron-specific 2) (Kinesin-1) | EBI-32723474 | 0.27 |
| Q15276 | Rab GTPase-binding effector protein 1 (Rabaptin-4) (Rabaptin-5) (Rabaptin-5alpha) (Renal carcinoma antigen NY-REN-17) | EBI-32723474 | 0.27 |
| Q9UEW8 | STE20/SPS1-related proline-alanine-rich protein kinase (Ste-20-related kinase) (EC 2.7.11.1) (DCHT) (Serine/threonine-protein kinase 39) | EBI-32723474 | 0.27 |
| Q9P2R3 | Rabankyrin-5 (Rank-5) (Ankyrin repeat and FYVE domain-containing protein 1) (Ankyrin repeats hooked to a zinc finger motif) | EBI-32723474 | 0.27 |
| Q10567 | AP-1 complex subunit beta-1 (Adaptor protein complex AP-1 subunit beta-1) (Adaptor-related protein complex 1 subunit beta-1) (Beta-1-adaptin) (Beta-adaptin 1) (Clathrin assembly protein complex 1 beta large chain) (Golgi adaptor HA1/AP1 adaptin beta subunit) | EBI-32723474 | 0.27 |
| Q15311 | RalA-binding protein 1 (RalBP1) (76 kDa Ral-interacting protein) (Dinitrophenyl S-glutathione ATPase) (DNP-SG ATPase) (EC 7.6.2.2, EC 7.6.2.3) (Ral-interacting protein 1) | EBI-32723474 | 0.27 |
| P50454 | Serpin H1 (47 kDa heat shock protein) (Arsenic-transactivated protein 3) (AsTP3) (Cell proliferation-inducing gene 14 protein) (Collagen-binding protein) (Colligin) (Rheumatoid arthritis-related antigen RA-A47) | EBI-32723474 | 0.27 |
| Q9NZ32 | Actin-related protein 10 (Actin-related protein 11) (hARP11) | EBI-32723474 | 0.27 |
| Q9BQ67 | Glutamate-rich WD repeat-containing protein 1 | EBI-32723474 | 0.27 |
| P06493 | Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase) | EBI-32723474 | 0.27 |
| Q8NFP9 | Neurobeachin (Lysosomal-trafficking regulator 2) (Protein BCL8B) | EBI-32723474 | 0.27 |
| Q9NZ52 | ADP-ribosylation factor-binding protein GGA3 (Golgi-localized, gamma ear-containing, ARF-binding protein 3) | EBI-32723474 | 0.27 |
| Q8NHV4 | Protein NEDD1 (Neural precursor cell expressed developmentally down-regulated protein 1) (NEDD-1) | EBI-32723474 | 0.27 |
| P48553 | Trafficking protein particle complex subunit 10 (Epilepsy holoprosencephaly candidate 1 protein) (EHOC-1) (Protein GT334) (Trafficking protein particle complex subunit TMEM1) (Transport protein particle subunit TMEM1) (TRAPP subunit TMEM1) | EBI-32723474 | 0.27 |
| P18085 | ADP-ribosylation factor 4 | EBI-32723474 | 0.27 |
| P49023 | Paxillin | EBI-32723474 | 0.27 |
| P26038 | Moesin (Membrane-organizing extension spike protein) | EBI-32723474 | 0.27 |
| P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | EBI-32723474 | 0.27 |
| Q9UJC3 | Protein Hook homolog 1 (h-hook1) (hHK1) | EBI-32723474 | 0.27 |
| O60927 | E3 ubiquitin-protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3) | EBI-32723474 | 0.27 |
| Q92600 | CCR4-NOT transcription complex subunit 9 (Cell differentiation protein RQCD1 homolog) (Rcd-1) | EBI-32723474 | 0.27 |
| Q9GZT9 | Egl nine homolog 1 (EC 1.14.11.29) (Hypoxia-inducible factor prolyl hydroxylase 2) (HIF-PH2) (HIF-prolyl hydroxylase 2) (HPH-2) (Prolyl hydroxylase domain-containing protein 2) (PHD2) (SM-20) | EBI-32723474 | 0.27 |
| P16333 | Cytoplasmic protein NCK1 (NCK adaptor protein 1) (Nck-1) (SH2/SH3 adaptor protein NCK-alpha) | EBI-32723474 | 0.27 |
| Q96CW1 | AP-2 complex subunit mu (AP-2 mu chain) (Adaptin-mu2) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (HA2 50 kDa subunit) (Plasma membrane adaptor AP-2 50 kDa protein) | EBI-32723474 | 0.27 |
| Q9Y4L1 | Hypoxia up-regulated protein 1 (150 kDa oxygen-regulated protein) (ORP-150) (170 kDa glucose-regulated protein) (GRP-170) | EBI-32723474 | 0.27 |
| Q9H6R7 | WD repeat and coiled-coil-containing protein | EBI-32723474 | 0.27 |
| P09543 | 2',3'-cyclic-nucleotide 3'-phosphodiesterase (CNP) (CNPase) (EC 3.1.4.37) | EBI-32723474 | 0.27 |
| Q15025 | TNFAIP3-interacting protein 1 (A20-binding inhibitor of NF-kappa-B activation 1) (ABIN-1) (HIV-1 Nef-interacting protein) (Nef-associated factor 1) (Naf1) (Nip40-1) (Virion-associated nuclear shuttling protein) (VAN) (hVAN) | EBI-32723474 | 0.27 |
| Q96PK6 | RNA-binding protein 14 (Paraspeckle protein 2) (PSP2) (RNA-binding motif protein 14) (RRM-containing coactivator activator/modulator) (Synaptotagmin-interacting protein) (SYT-interacting protein) | EBI-32723474 | 0.27 |
| Q08379 | Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95) | EBI-32723474 | 0.27 |
| Q8IVF2 | Protein AHNAK2 | EBI-32723474 | 0.27 |
| Q9UIG0 | Tyrosine-protein kinase BAZ1B (EC 2.7.10.2) (Bromodomain adjacent to zinc finger domain protein 1B) (Williams syndrome transcription factor) (Williams-Beuren syndrome chromosomal region 10 protein) (Williams-Beuren syndrome chromosomal region 9 protein) (hWALp2) | EBI-32723474 | 0.27 |
| O43318 | Mitogen-activated protein kinase kinase kinase 7 (EC 2.7.11.25) (Transforming growth factor-beta-activated kinase 1) (TGF-beta-activated kinase 1) | EBI-32723474 | 0.27 |
| Q6ZS11 | Ras and Rab interactor-like protein | EBI-32723474 | 0.27 |
| P51116 | RNA-binding protein FXR2 (FMR1 autosomal homolog 2) | EBI-32723474 | 0.27 |
| Q9UKD2 | mRNA turnover protein 4 homolog (Ribosome assembly factor MRTO4) | EBI-32723474 | 0.27 |
| Q9P2D6 | Protein FAM135A | EBI-32723474 | 0.27 |
| O75935 | Dynactin subunit 3 (Dynactin complex subunit 22 kDa subunit) (p22) | EBI-32723474 | 0.27 |
| Q96GQ7 | Probable ATP-dependent RNA helicase DDX27 (EC 3.6.4.13) (DEAD box protein 27) | EBI-32723474 | 0.27 |
| Q96A65 | Exocyst complex component 4 (Exocyst complex component Sec8) | EBI-32723474 | 0.27 |
| Q8IWJ2 | GRIP and coiled-coil domain-containing protein 2 (185 kDa Golgi coiled-coil protein) (GCC185) (CLL-associated antigen KW-11) (CTCL tumor antigen se1-1) (Ran-binding protein 2-like 4) (RanBP2L4) (Renal carcinoma antigen NY-REN-53) | EBI-32723474 | 0.27 |
| P61088 | Ubiquitin-conjugating enzyme E2 N (EC 2.3.2.23) (Bendless-like ubiquitin-conjugating enzyme) (E2 ubiquitin-conjugating enzyme N) (Ubc13) (UbcH13) (Ubiquitin carrier protein N) (Ubiquitin-protein ligase N) | EBI-32723474 | 0.27 |
| Q9ULJ8 | Neurabin-1 (Neurabin-I) (Neural tissue-specific F-actin-binding protein I) (Protein phosphatase 1 regulatory subunit 9A) | EBI-32723474 | 0.27 |
| P00491 | Purine nucleoside phosphorylase (PNP) (EC 2.4.2.1) (Inosine phosphorylase) (Inosine-guanosine phosphorylase) | EBI-32723474 | 0.27 |
| Q9H9A5 | CCR4-NOT transcription complex subunit 10 | EBI-32723474 | 0.27 |
| Q14689 | Disco-interacting protein 2 homolog A (DIP2 homolog A) (EC 6.2.1.1) | EBI-32723474 | 0.27 |
| P82675 | 28S ribosomal protein S5, mitochondrial (MRP-S5) (S5mt) (Mitochondrial small ribosomal subunit protein uS5m) | EBI-32723474 | 0.27 |
| Q9Y3P9 | Rab GTPase-activating protein 1 (GAP and centrosome-associated protein) (Rab6 GTPase-activating protein GAPCenA) | EBI-32723474 | 0.27 |
| P13667 | Protein disulfide-isomerase A4 (EC 5.3.4.1) (Endoplasmic reticulum resident protein 70) (ER protein 70) (ERp70) (Endoplasmic reticulum resident protein 72) (ER protein 72) (ERp-72) (ERp72) | EBI-32723474 | 0.27 |
| Q9Y3A5 | Ribosome maturation protein SBDS (Shwachman-Bodian-Diamond syndrome protein) | EBI-32723474 | 0.27 |
| Q8IUR0 | Trafficking protein particle complex subunit 5 | EBI-32723474 | 0.27 |
| O00399 | Dynactin subunit 6 (Dynactin subunit p27) (Protein WS-3) | EBI-32723474 | 0.27 |
| P62158 | Calmodulin-1 | EBI-32723474 | 0.27 |
| O60826 | Coiled-coil domain-containing protein 22 | EBI-32723474 | 0.27 |
| Q6GYQ0 | Ral GTPase-activating protein subunit alpha-1 (GAP-related-interacting partner to E12) (GRIPE) (GTPase-activating Rap/Ran-GAP domain-like 1) (Tuberin-like protein 1) (p240) | EBI-32723474 | 0.27 |
| Q9H939 | Proline-serine-threonine phosphatase-interacting protein 2 (PEST phosphatase-interacting protein 2) | EBI-32723474 | 0.27 |
| Q9NVI1 | Fanconi anemia group I protein (Protein FACI) | EBI-32723474 | 0.27 |
| O00203 | AP-3 complex subunit beta-1 (Adaptor protein complex AP-3 subunit beta-1) (Adaptor-related protein complex 3 subunit beta-1) (Beta-3A-adaptin) (Clathrin assembly protein complex 3 beta-1 large chain) | EBI-32723474 | 0.27 |
| Q9Y4W6 | AFG3-like protein 2 (EC 3.4.24.-) (Paraplegin-like protein) | EBI-32723474 | 0.27 |
| Q15058 | Kinesin-like protein KIF14 | EBI-32723474 | 0.27 |
| Q9Y296 | Trafficking protein particle complex subunit 4 (Hematopoietic stem/progenitor cell protein 172) (Synbindin) (TRS23 homolog) | EBI-32723474 | 0.27 |
| O75131 | Copine-3 (Copine III) | EBI-32723474 | 0.27 |
| O94979 | Protein transport protein Sec31A (ABP125) (ABP130) (SEC31-like protein 1) (SEC31-related protein A) (Web1-like protein) | EBI-32723474 | 0.27 |
Database | Links |
| UNIPROT | Q6ZMQ8 O75136 Q6ZN31 Q86X28 |
| Pfam | PF07714 |
| PROSITE | PS00107 PS50011 PS00109 |
| OMIM | 605276 |
| DisGeNET | 9625 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory