Protein Information |
|
---|---|
Protein Name | COP9 signalosome complex subunit 5 |
Accession Code | Q92905 |
Gene | COPS5 |
Organism | Homo sapiens | Human (Taxonomy: 9606) |
Part of Reference Proteome? | Yes |
Sequence (Length: 334) | |
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGL MLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQ FQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL LWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMS QVIKDKLFNQINIS |
Structure Viewer (PDB: 4D10) |
---|
Description |
|
---|---|
Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex. Promotes the proteasomal degradation of BRSK2. {Experimental EvidencePubMed:11285227, Experimental EvidencePubMed:11337588, Experimental EvidencePubMed:12628923, Experimental EvidencePubMed:12732143, Experimental EvidencePubMed:19214193, Experimental EvidencePubMed:20978819, Experimental EvidencePubMed:22609399, Experimental EvidencePubMed:9535219}. | Assigned Ontology terms |
Biological Process | Exosomal Secretion (GO:1990182) Negative Regulation Of Apoptotic Process (GO:0043066) Positive Regulation Of DNA-Binding Transcription Factor Activity (GO:0051091) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Post-Translational Protein Modification (GO:0043687) Protein Deneddylation (GO:0000338) Protein Deubiquitination (GO:0016579) Protein Neddylation (GO:0045116) Regulation Of Cell Cycle (GO:0051726) Regulation Of IRE1-Mediated Unfolded Protein Response (GO:1903894) Regulation Of JNK Cascade (GO:0046328) Regulation Of Protein Neddylation (GO:2000434) Translation (GO:0006412) |
Molecular Function | DeNEDDylase Activity (GO:0019784) Enzyme Binding (GO:0019899) Macrophage Migration Inhibitory Factor Binding (GO:0035718) Metal Ion Binding (GO:0046872) Metal-Dependent Deubiquitinase Activity (GO:0140492) Metalloendopeptidase Activity (GO:0004222) Metallopeptidase Activity (GO:0008237) Transcription Coactivator Activity (GO:0003713) Translation Initiation Factor Activity (GO:0003743) |
Interactions with Nuclear Envelope proteins (28 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
O15504 | Nucleoporin NUP42 | EBI-21325777 | 0.35 |
O75694 | Nuclear pore complex protein Nup155 | EBI-21325777 | 0.35 |
P04406 | Glyceraldehyde-3-phosphate dehydrogenase | EBI-21325777 | 0.35 |
P31689 | DnaJ homolog subfamily A member 1 | EBI-21325777 | 0.35 |
P63244 | Receptor of activated protein C kinase 1, N-terminally processed | EBI-21325777 | 0.55 |
P63279 | SUMO-conjugating enzyme UBC9 | EBI-3454145 | 0.00 |
Q14974 | Importin subunit beta-1 | EBI-21325777 | 0.35 |
Q3TLR7 | Denticleless protein homolog | EBI-11019947 | 0.35 |
Q5JTH9 | RRP12-like protein | EBI-21325777 | 0.35 |
Q7L5N1 | COP9 signalosome complex subunit 6 | EBI-2510150 | 0.91 |
Q8N114 | Protein shisa-5 | EBI-2115585 | 0.00 |
Q8NI35 | InaD-like protein | EBI-2659663 | 0.35 |
Q8TEL6 | Short transient receptor potential channel 4-associated protein | EBI-21325777 | 0.35 |
Q92900 | Regulator of nonsense transcripts 1 | EBI-21325777 | 0.35 |
Q9UDY8 | Mucosa-associated lymphoid tissue lymphoma translocation protein 1 | EBI-7006117 | 0.35 |
Q9H6S0 | 3'-5' RNA helicase YTHDC2 | EBI-21325777 | 0.35 |
Q96EE3 | Nucleoporin SEH1 | EBI-21325777 | 0.35 |
Q9UBU9 | Nuclear RNA export factor 1 | EBI-21325777 | 0.35 |
Q9NZI8 | Insulin-like growth factor 2 mRNA-binding protein 1 | EBI-21325777 | 0.35 |
Q9UKA1 | F-box/LRR-repeat protein 5 | EBI-21325777 | 0.53 |
Q9NZJ0 | Denticleless protein homolog | EBI-21325777 | 0.35 |
Q9Y224 | RNA transcription, translation and transport factor protein | EBI-21325777 | 0.35 |
Q8NE71 | ATP-binding cassette sub-family F member 1 | EBI-21325777 | 0.35 |
O95831 | Apoptosis-inducing factor 1, mitochondrial | EBI-21325777 | 0.35 |
O95999 | B-cell lymphoma/leukemia 10 | EBI-7006208 | 0.35 |
Q8IWQ3 | Serine/threonine-protein kinase BRSK2 | EBI-30872909 | 0.64 |
P11802 | Cyclin-dependent kinase 4 | EBI-21325777 | 0.35 |
Q07065 | Cytoskeleton-associated protein 4 | EBI-21325777 | 0.35 | Interactions with other proteins (684 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
P55789 | FAD-linked sulfhydryl oxidase ALR (EC 1.8.3.2) (Augmenter of liver regeneration) (hERV1) (Hepatopoietin) | EBI-7286464 | 0.60 |
P14174 | Macrophage migration inhibitory factor (MIF) (EC 5.3.2.1) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase) (EC 5.3.3.12) (Phenylpyruvate tautomerase) | EBI-7522890 | 0.59 |
P10599 | Thioredoxin (Trx) (ATL-derived factor) (ADF) (Surface-associated sulphydryl protein) (SASP) (allergen Hom s Trx) | EBI-594678 | 0.74 |
P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | EBI-594810 | 0.60 |
Q15796 | Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) | EBI-7224786 | 0.37 |
Q5VTD9 | Zinc finger protein Gfi-1b (Growth factor independent protein 1B) (Potential regulator of CDKN1A translocated in CML) | EBI-956654 | 0.00 |
P09936 | Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCH-L1) (EC 3.4.19.12) (Neuron cytoplasmic protein 9.5) (PGP 9.5) (PGP9.5) (Ubiquitin thioesterase L1) | EBI-1181897 | 0.54 |
P22087 | rRNA 2'-O-methyltransferase fibrillarin (EC 2.1.1.-) (34 kDa nucleolar scleroderma antigen) (Histone-glutamine methyltransferase) (U6 snRNA 2'-O-methyltransferase fibrillarin) | EBI-1182007 | 0.49 |
O95273 | Cyclin-D1-binding protein 1 (Grap2 and cyclin-D-interacting protein) (Human homolog of Maid) | EBI-1385474 | 0.54 |
P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | EBI-1551755 | 0.40 |
O75882 | Attractin (DPPT-L) (Mahogany homolog) | EBI-2115511 | 0.00 |
P36507 | Dual specificity mitogen-activated protein kinase kinase 2 (MAP kinase kinase 2) (MAPKK 2) (EC 2.7.12.2) (ERK activator kinase 2) (MAPK/ERK kinase 2) (MEK 2) | EBI-2115525 | 0.00 |
Q9HB07 | MYG1 exonuclease (EC 3.1.-.-) | EBI-2115530 | 0.00 |
Q9NZF1 | Placenta-specific gene 8 protein (Protein C15) | EBI-2115546 | 0.00 |
P50336 | Protoporphyrinogen oxidase (PPO) (EC 1.3.3.4) | EBI-2115551 | 0.00 |
P54578 | Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.4.19.12) (Deubiquitinating enzyme 14) (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) | EBI-2115609 | 0.00 |
P04004 | Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) [Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B] | EBI-2115614 | 0.00 |
Q16539 | Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (Cytokine suppressive anti-inflammatory drug-binding protein) (CSAID-binding protein) (CSBP) (MAP kinase MXI2) (MAX-interacting protein 2) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha) (Stress-activated protein kinase 2a) (SAPK2a) | EBI-2116848 | 0.00 |
P62256 | Ubiquitin-conjugating enzyme E2 H (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme H) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme H) (UbcH2) (Ubiquitin carrier protein H) (Ubiquitin-conjugating enzyme E2-20K) (Ubiquitin-protein ligase H) | EBI-2339626 | 0.37 |
Q9BXL7 | Caspase recruitment domain-containing protein 11 (CARD-containing MAGUK protein 1) (Carma 1) | EBI-7006135 | 0.46 |
Q13098 | COP9 signalosome complex subunit 1 (SGN1) (Signalosome subunit 1) (G protein pathway suppressor 1) (GPS-1) (JAB1-containing signalosome subunit 1) (Protein MFH) | EBI-7006270 | 0.93 |
Q5VTR2 | E3 ubiquitin-protein ligase BRE1A (BRE1-A) (hBRE1) (EC 2.3.2.27) (RING finger protein 20) (RING-type E3 ubiquitin transferase BRE1A) | EBI-8566847 | 0.50 |
Q15018 | BRISC complex subunit Abraxas 2 (Abraxas brother protein 1) (Protein FAM175B) | EBI-8566862 | 0.35 |
P0CG48 | Polyubiquitin-C [Cleaved into: Ubiquitin] | EBI-8566988 | 0.40 |
P61201 | COP9 signalosome complex subunit 2 (SGN2) (Signalosome subunit 2) (Alien homolog) (JAB1-containing signalosome subunit 2) (Thyroid receptor-interacting protein 15) (TR-interacting protein 15) (TRIP-15) | EBI-2510150 | 0.88 |
Q86XK2 | F-box only protein 11 (Protein arginine N-methyltransferase 9) (Vitiligo-associated protein 1) (VIT-1) | EBI-2510150 | 0.56 |
Q9BX70 | BTB/POZ domain-containing protein 2 | EBI-2510150 | 0.67 |
Q13620 | Cullin-4B (CUL-4B) | EBI-2510150 | 0.85 |
Q9H496 | Torsin-1A-interacting protein 2, isoform IFRG15 (15 kDa interferon-responsive protein) (IFRG15) | EBI-2510150 | 0.56 |
Q96EF6 | F-box only protein 17 (F-box only protein 26) | EBI-2510150 | 0.67 |
Q96M94 | Kelch-like protein 15 | EBI-2510150 | 0.56 |
Q9BT78 | COP9 signalosome complex subunit 4 (SGN4) (Signalosome subunit 4) (JAB1-containing signalosome subunit 4) | EBI-2510150 | 0.85 |
Q92466 | DNA damage-binding protein 2 (DDB p48 subunit) (DDBb) (Damage-specific DNA-binding protein 2) (UV-damaged DNA-binding protein 2) (UV-DDB 2) | EBI-2510150 | 0.80 |
Q9P2J3 | Kelch-like protein 9 | EBI-2510150 | 0.56 |
Q9UBW8 | COP9 signalosome complex subunit 7a (SGN7a) (Signalosome subunit 7a) (Dermal papilla-derived protein 10) (JAB1-containing signalosome subunit 7a) | EBI-2510150 | 0.85 |
P15374 | Ubiquitin carboxyl-terminal hydrolase isozyme L3 (UCH-L3) (EC 3.4.19.12) (Ubiquitin thioesterase L3) | EBI-2510150 | 0.40 |
Q13616 | Cullin-1 (CUL-1) | EBI-2510150 | 0.74 |
Q99627 | COP9 signalosome complex subunit 8 (SGN8) (Signalosome subunit 8) (COP9 homolog) (hCOP9) (JAB1-containing signalosome subunit 8) | EBI-2510150 | 0.90 |
Q8NEZ5 | F-box only protein 22 (F-box protein FBX22p44) | EBI-2510150 | 0.40 |
Q6TFL4 | Kelch-like protein 24 (Kainate receptor-interacting protein for GluR6) (KRIP6) (Protein DRE1) | EBI-2510150 | 0.56 |
Q9H9Q2 | COP9 signalosome complex subunit 7b (SGN7b) (Signalosome subunit 7b) (JAB1-containing signalosome subunit 7b) | EBI-2510150 | 0.85 |
Q8TEB1 | DDB1- and CUL4-associated factor 11 (WD repeat-containing protein 23) | EBI-2510150 | 0.56 |
Q13619 | Cullin-4A (CUL-4A) | EBI-2510150 | 0.74 |
Q13309 | S-phase kinase-associated protein 2 (Cyclin-A/CDK2-associated protein p45) (F-box protein Skp2) (F-box/LRR-repeat protein 1) (p45skp2) | EBI-2510150 | 0.56 |
Q15843 | NEDD8 (Neddylin) (Neural precursor cell expressed developmentally down-regulated protein 8) (NEDD-8) (Ubiquitin-like protein Nedd8) | EBI-2510150 | 0.56 |
Q13618 | Cullin-3 (CUL-3) | EBI-2510150 | 0.67 |
Q15048 | Leucine-rich repeat-containing protein 14 | EBI-2510150 | 0.56 |
Q9Y4B6 | DDB1- and CUL4-associated factor 1 (HIV-1 Vpr-binding protein) (VprBP) (Serine/threonine-protein kinase VPRBP) (EC 2.7.11.1) (Vpr-interacting protein) | EBI-2510150 | 0.67 |
Q9P2N7 | Kelch-like protein 13 (BTB and kelch domain-containing protein 2) | EBI-2510150 | 0.56 |
Q13617 | Cullin-2 (CUL-2) | EBI-2510150 | 0.67 |
Q96L50 | Leucine-rich repeat protein 1 (4-1BB-mediated-signaling molecule) (4-1BBlrr) (LRR-repeat protein 1) (LRR-1) (Peptidylprolyl isomerase-like 5) | EBI-2510150 | 0.56 |
Q53GT1 | Kelch-like protein 22 | EBI-2510150 | 0.56 |
Q9UNS2 | COP9 signalosome complex subunit 3 (SGN3) (Signalosome subunit 3) (JAB1-containing signalosome subunit 3) | EBI-2510150 | 0.92 |
Q13216 | DNA excision repair protein ERCC-8 (Cockayne syndrome WD repeat protein CSA) | EBI-2510150 | 0.56 |
O94889 | Kelch-like protein 18 | EBI-2510150 | 0.56 |
B4DN30 | cDNA FLJ52699, highly similar to WD repeat protein 21A | EBI-2510150 | 0.40 |
Q3U1J4 | DNA damage-binding protein 1 (DDB p127 subunit) (Damage-specific DNA-binding protein 1) (UV-damaged DNA-binding factor) | EBI-2559059 | 0.40 |
P53355 | Death-associated protein kinase 1 (DAP kinase 1) (EC 2.7.11.1) | EBI-2659621 | 0.35 |
Q96N67 | Dedicator of cytokinesis protein 7 | EBI-2659621 | 0.35 |
P08107 | Heat shock 70 kDa protein 1A (Heat shock 70 kDa protein 1) (HSP70-1) (HSP70.1) | EBI-2659628 | 0.35 |
P25705 | ATP synthase subunit alpha, mitochondrial (ATP synthase F1 subunit alpha) | EBI-2659628 | 0.35 |
Q9NZQ3 | NCK-interacting protein with SH3 domain (54 kDa VacA-interacting protein) (54 kDa vimentin-interacting protein) (VIP54) (90 kDa SH3 protein interacting with Nck) (AF3p21) (Dia-interacting protein 1) (DIP-1) (Diaphanous protein-interacting protein) (SH3 adapter protein SPIN90) (WASP-interacting SH3-domain protein) (WISH) (Wiskott-Aldrich syndrome protein-interacting protein) | EBI-2659628 | 0.35 |
P80723 | Brain acid soluble protein 1 (22 kDa neuronal tissue-enriched acidic protein) (Neuronal axonal membrane protein NAP-22) | EBI-2659628 | 0.35 |
Q9NNW5 | WD repeat-containing protein 6 | EBI-2659628 | 0.35 |
P34931 | Heat shock 70 kDa protein 1-like (Heat shock 70 kDa protein 1L) (Heat shock 70 kDa protein 1-Hom) (HSP70-Hom) | EBI-2659628 | 0.53 |
O43491 | Band 4.1-like protein 2 (Erythrocyte membrane protein band 4.1-like 2) (Generally expressed protein 4.1) (4.1G) | EBI-2659628 | 0.35 |
P35579 | Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA) | EBI-2659628 | 0.35 |
P08238 | Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84) | EBI-2659628 | 0.35 |
Q4VCS5 | Angiomotin | EBI-2659628 | 0.35 |
P48741 | Putative heat shock 70 kDa protein 7 (Heat shock 70 kDa protein B) | EBI-2659628 | 0.53 |
Q8IY63 | Angiomotin-like protein 1 | EBI-2659628 | 0.35 |
P11021 | Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein) | EBI-2659628 | 0.53 |
P17066 | Heat shock 70 kDa protein 6 (Heat shock 70 kDa protein B') | EBI-2659628 | 0.53 |
P63167 | Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) | EBI-2659628 | 0.35 |
P28289 | Tropomodulin-1 (Erythrocyte tropomodulin) (E-Tmod) | EBI-2659628 | 0.35 |
O75955 | Flotillin-1 | EBI-2659628 | 0.35 |
Q9UJZ1 | Stomatin-like protein 2, mitochondrial (SLP-2) (EPB72-like protein 2) (Paraprotein target 7) (Paratarg-7) | EBI-2659628 | 0.35 |
O75970 | Multiple PDZ domain protein (Multi-PDZ domain protein 1) | EBI-2659663 | 0.35 |
P62877 | E3 ubiquitin-protein ligase RBX1 (EC 2.3.2.27) (EC 2.3.2.32) (E3 ubiquitin-protein transferase RBX1) (Protein ZYP) (RING finger protein 75) (RING-box protein 1) (Rbx1) (Regulator of cullins 1) (ROC1) [Cleaved into: E3 ubiquitin-protein ligase RBX1, N-terminally processed (E3 ubiquitin-protein transferase RBX1, N-terminally processed)] | EBI-2659663 | 0.35 |
Q6PJ61 | F-box only protein 46 (F-box only protein 34-like) | EBI-2659663 | 0.53 |
Q9NUP9 | Protein lin-7 homolog C (Lin-7C) (Mammalian lin-seven protein 3) (MALS-3) (Vertebrate lin-7 homolog 3) (Veli-3) | EBI-2659663 | 0.35 |
O14974 | Protein phosphatase 1 regulatory subunit 12A (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (Protein phosphatase myosin-binding subunit) | EBI-2659663 | 0.35 |
P35580 | Myosin-10 (Cellular myosin heavy chain, type B) (Myosin heavy chain 10) (Myosin heavy chain, non-muscle IIb) (Non-muscle myosin heavy chain B) (NMMHC-B) (Non-muscle myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) | EBI-2659663 | 0.35 |
Q5VUJ6 | Leucine-rich repeat and calponin homology domain-containing protein 2 | EBI-2659663 | 0.53 |
Q8N3R9 | Protein PALS1 (MAGUK p55 subfamily member 5) (Membrane protein, palmitoylated 5) (Protein associated with Lin-7 1) | EBI-2659663 | 0.35 |
O15085 | Rho guanine nucleotide exchange factor 11 (PDZ-RhoGEF) | EBI-2659663 | 0.35 |
Q16531 | DNA damage-binding protein 1 (DDB p127 subunit) (DNA damage-binding protein a) (DDBa) (Damage-specific DNA-binding protein 1) (HBV X-associated protein 1) (XAP-1) (UV-damaged DNA-binding factor) (UV-damaged DNA-binding protein 1) (UV-DDB 1) (XPE-binding factor) (XPE-BF) (Xeroderma pigmentosum group E-complementing protein) (XPCe) | EBI-2659663 | 0.53 |
Q9P2K6 | Kelch-like protein 42 (Cullin-3-binding protein 9) (Ctb9) (Kelch domain-containing protein 5) | EBI-2659663 | 0.53 |
Q9Y2D5 | A-kinase anchor protein 2 (AKAP-2) (AKAP-KL) (Protein kinase A-anchoring protein 2) (PRKA2) | EBI-2659663 | 0.35 |
Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | EBI-7950968 | 0.35 |
Q99459 | Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein) | EBI-7954144 | 0.35 |
Q16584 | Mitogen-activated protein kinase kinase kinase 11 (EC 2.7.11.25) (Mixed lineage kinase 3) (Src-homology 3 domain-containing proline-rich kinase) | EBI-3442917 | 0.00 |
Q99759 | Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.11.25) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3) | EBI-3443070 | 0.00 |
O43318 | Mitogen-activated protein kinase kinase kinase 7 (EC 2.7.11.25) (Transforming growth factor-beta-activated kinase 1) (TGF-beta-activated kinase 1) | EBI-3443260 | 0.00 |
Q8IVH8 | Mitogen-activated protein kinase kinase kinase kinase 3 (EC 2.7.11.1) (Germinal center kinase-related protein kinase) (GLK) (MAPK/ERK kinase kinase kinase 3) (MEK kinase kinase 3) (MEKKK 3) | EBI-3443337 | 0.00 |
Q9Y4K4 | Mitogen-activated protein kinase kinase kinase kinase 5 (EC 2.7.11.1) (Kinase homologous to SPS1/STE20) (KHS) (MAPK/ERK kinase kinase kinase 5) (MEK kinase kinase 5) (MEKKK 5) | EBI-3443648 | 0.00 |
P61244 | Protein max (Class D basic helix-loop-helix protein 4) (bHLHd4) (Myc-associated factor X) | EBI-3444880 | 0.00 |
Q06413 | Myocyte-specific enhancer factor 2C (Myocyte enhancer factor 2C) | EBI-3445247 | 0.00 |
Q14814 | Myocyte-specific enhancer factor 2D | EBI-3445506 | 0.00 |
Q12772 | Sterol regulatory element-binding protein 2 (SREBP-2) (Class D basic helix-loop-helix protein 2) (bHLHd2) (Sterol regulatory element-binding transcription factor 2) [Cleaved into: Processed sterol regulatory element-binding protein 2 (Transcription factor SREBF2)] | EBI-3451285 | 0.00 |
P61981 | 14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed] | EBI-3453135 | 0.00 |
Q9H4A3 | Serine/threonine-protein kinase WNK1 (EC 2.7.11.1) (Erythrocyte 65 kDa protein) (p65) (Kinase deficient protein) (Protein kinase lysine-deficient 1) (Protein kinase with no lysine 1) (hWNK1) | EBI-3453687 | 0.00 |
O15105 | Mothers against decapentaplegic homolog 7 (MAD homolog 7) (Mothers against DPP homolog 7) (Mothers against decapentaplegic homolog 8) (MAD homolog 8) (Mothers against DPP homolog 8) (SMAD family member 7) (SMAD 7) (Smad7) (hSMAD7) | EBI-3861684 | 0.64 |
Q13485 | Mothers against decapentaplegic homolog 4 (MAD homolog 4) (Mothers against DPP homolog 4) (Deletion target in pancreatic carcinoma 4) (SMAD family member 4) (SMAD 4) (Smad4) (hSMAD4) | EBI-3862454 | 0.40 |
P02743 | Serum amyloid P-component (SAP) (9.5S alpha-1-glycoprotein) [Cleaved into: Serum amyloid P-component(1-203)] | EBI-3907158 | 0.37 |
Q99489 | D-aspartate oxidase (DASOX) (DDO) (EC 1.4.3.1) | EBI-3915505 | 0.37 |
Q9NPY3 | Complement component C1q receptor (C1q/MBL/SPA receptor) (C1qR) (C1qR(p)) (C1qRp) (CDw93) (Complement component 1 q subcomponent receptor 1) (Matrix-remodeling-associated protein 4) (CD antigen CD93) | EBI-3922558 | 0.37 |
Q9P0P8 | Mitochondrial transcription rescue factor 1 | EBI-3922568 | 0.37 |
Q8N6T3 | ADP-ribosylation factor GTPase-activating protein 1 (ARF GAP 1) (ADP-ribosylation factor 1 GTPase-activating protein) (ARF1 GAP) (ARF1-directed GTPase-activating protein) | EBI-3922578 | 0.37 |
P19838 | Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor KBF1) (EBP-1) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) [Cleaved into: Nuclear factor NF-kappa-B p50 subunit] | EBI-3936417 | 0.55 |
P32119 | Peroxiredoxin-2 (EC 1.11.1.24) (Natural killer cell-enhancing factor B) (NKEF-B) (PRP) (Thiol-specific antioxidant protein) (TSA) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thioredoxin-dependent peroxiredoxin 2) | EBI-3936427 | 0.37 |
Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2) | EBI-3942223 | 0.37 |
P55085 | Proteinase-activated receptor 2 (PAR-2) (Coagulation factor II receptor-like 1) (G-protein coupled receptor 11) (Thrombin receptor-like 1) [Cleaved into: Proteinase-activated receptor 2, alternate cleaved 1; Proteinase-activated receptor 2, alternate cleaved 2] | EBI-4303187 | 0.64 |
P36873 | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit) | EBI-4311588 | 0.37 |
Q9H8M7 | Ubiquitin carboxyl-terminal hydrolase MINDY-3 (EC 3.4.19.12) (Dermal papilla-derived protein 5) (Deubiquitinating enzyme MINDY-3) (Protein CARP) | EBI-4422753 | 0.54 |
Q02556 | Interferon regulatory factor 8 (IRF-8) (Interferon consensus sequence-binding protein) (H-ICSBP) (ICSBP) | EBI-6115692 | 0.35 |
P12520 | Protein Vpr (R ORF protein) (Viral protein R) | EBI-6177205 | 0.35 |
Q96GG9 | DCN1-like protein 1 (DCNL1) (DCUN1 domain-containing protein 1) (Defective in cullin neddylation protein 1-like protein 1) (Squamous cell carcinoma-related oncogene) | EBI-21325177 | 0.35 |
Q9C0D3 | Protein zyg-11 homolog B | EBI-21325777 | 0.35 |
Q96FX7 | tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A (EC 2.1.1.220) (mRNA methyladenosine-N(1)-methyltransferase catalytic subunit TRMT61A) (EC 2.1.1.-) (tRNA(m1A58)-methyltransferase subunit TRMT61A) (tRNA(m1A58)MTase subunit TRMT61A) | EBI-21325777 | 0.35 |
P09012 | U1 small nuclear ribonucleoprotein A (U1 snRNP A) (U1-A) (U1A) | EBI-21325777 | 0.35 |
P35250 | Replication factor C subunit 2 (Activator 1 40 kDa subunit) (A1 40 kDa subunit) (Activator 1 subunit 2) (Replication factor C 40 kDa subunit) (RF-C 40 kDa subunit) (RFC40) | EBI-21325777 | 0.35 |
Q9UKV8 | Protein argonaute-2 (Argonaute2) (hAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF-2C 2) (eIF2C 2) (PAZ Piwi domain protein) (PPD) (Protein slicer) | EBI-21325777 | 0.35 |
Q9UL18 | Protein argonaute-1 (Argonaute1) (hAgo1) (Argonaute RISC catalytic component 1) (Eukaryotic translation initiation factor 2C 1) (eIF-2C 1) (eIF2C 1) (Putative RNA-binding protein Q99) | EBI-21325777 | 0.35 |
Q14011 | Cold-inducible RNA-binding protein (A18 hnRNP) (Glycine-rich RNA-binding protein CIRP) | EBI-21325777 | 0.35 |
Q8N726 | Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p14ARF) | EBI-21325777 | 0.35 |
P54132 | RecQ-like DNA helicase BLM (EC 3.6.4.12) (Bloom syndrome protein) (DNA helicase, RecQ-like type 2) (RecQ2) (RecQ protein-like 3) | EBI-21325777 | 0.35 |
O94844 | Rho-related BTB domain-containing protein 1 | EBI-21325777 | 0.35 |
Q86YV6 | Myosin light chain kinase family member 4 (EC 2.7.11.1) (Sugen kinase 85) (SgK085) | EBI-21325777 | 0.35 |
Q8N4N3 | Kelch-like protein 36 | EBI-21325777 | 0.35 |
Q9UK96 | F-box only protein 10 | EBI-21325777 | 0.35 |
Q96ME1 | F-box/LRR-repeat protein 18 (F-box and leucine-rich repeat protein 18) | EBI-21325777 | 0.35 |
Q8N1E6 | F-box/LRR-repeat protein 14 (F-box and leucine-rich repeat protein 14) | EBI-21325777 | 0.35 |
Q96FN4 | Copine-2 (Copine II) | EBI-21325777 | 0.35 |
Q9NWX5 | Ankyrin repeat and SOCS box protein 6 (ASB-6) | EBI-21325777 | 0.35 |
Q86TJ5 | Zinc finger protein 554 | EBI-21325777 | 0.35 |
Q9NR11 | Zinc finger protein 302 (Zinc finger protein 135-like) (Zinc finger protein 140-like) (Zinc finger protein 327) | EBI-21325777 | 0.35 |
O15231 | Zinc finger protein 185 (LIM domain protein ZNF185) (P1-A) | EBI-21325777 | 0.35 |
Q96KR1 | Zinc finger RNA-binding protein (hZFR) (M-phase phosphoprotein homolog) | EBI-21325777 | 0.35 |
Q5TAX3 | Terminal uridylyltransferase 4 (TUTase 4) (EC 2.7.7.52) (Zinc finger CCHC domain-containing protein 11) | EBI-21325777 | 0.35 |
Q7Z2W4 | Zinc finger CCCH-type antiviral protein 1 (ADP-ribosyltransferase diphtheria toxin-like 13) (ARTD13) (Inactive Poly [ADP-ribose] polymerase 13) (PARP13) (Zinc finger CCCH domain-containing protein 2) (Zinc finger antiviral protein) (ZAP) | EBI-21325777 | 0.35 |
P63104 | 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1) | EBI-21325777 | 0.35 |
P67809 | Y-box-binding protein 1 (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor) | EBI-21325777 | 0.35 |
Q9H0D6 | 5'-3' exoribonuclease 2 (EC 3.1.13.-) (DHM1-like protein) (DHP protein) | EBI-21325777 | 0.35 |
P12956 | X-ray repair cross-complementing protein 6 (EC 3.6.4.-) (EC 4.2.99.-) (5'-deoxyribose-5-phosphate lyase Ku70) (5'-dRP lyase Ku70) (70 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 1) (ATP-dependent DNA helicase II 70 kDa subunit) (CTC box-binding factor 75 kDa subunit) (CTC75) (CTCBF) (DNA repair protein XRCC6) (Lupus Ku autoantigen protein p70) (Ku70) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 6) | EBI-21325777 | 0.35 |
Q9Y4P8 | WD repeat domain phosphoinositide-interacting protein 2 (WIPI-2) (WIPI49-like protein 2) | EBI-21325777 | 0.35 |
Q9GZS3 | WD repeat-containing protein 61 (Meiotic recombination REC14 protein homolog) (SKI8 homolog) (Ski8) [Cleaved into: WD repeat-containing protein 61, N-terminally processed] | EBI-21325777 | 0.35 |
P61964 | WD repeat-containing protein 5 (BMP2-induced 3-kb gene protein) | EBI-21325777 | 0.35 |
Q5TAQ9 | DDB1- and CUL4-associated factor 8 (WD repeat-containing protein 42A) | EBI-21325777 | 0.35 |
Q5T6F0 | DDB1- and CUL4-associated factor 12 (Centrosome-related protein TCC52) (Testis cancer centrosome-related protein) (WD repeat-containing protein 40A) | EBI-21325777 | 0.35 |
Q3SXM0 | DDB1- and CUL4-associated factor 4-like protein 1 (WD repeat-containing protein 21B) | EBI-21325777 | 0.35 |
Q8WV16 | DDB1- and CUL4-associated factor 4 (WD repeat-containing protein 21A) | EBI-21325777 | 0.53 |
P08670 | Vimentin | EBI-21325777 | 0.35 |
P55072 | Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) | EBI-21325777 | 0.35 |
Q93009 | Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) | EBI-21325777 | 0.35 |
Q9Y4E8 | Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.4.19.12) (Deubiquitinating enzyme 15) (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Unph-2) (Unph4) | EBI-21325777 | 0.35 |
P10746 | Uroporphyrinogen-III synthase (UROIIIS) (UROS) (EC 4.2.1.75) (Hydroxymethylbilane hydrolyase [cyclizing]) (Uroporphyrinogen-III cosynthase) | EBI-21325777 | 0.35 |
Q9BZI7 | Regulator of nonsense transcripts 3B (Nonsense mRNA reducing factor 3B) (Up-frameshift suppressor 3 homolog B) (hUpf3B) (Up-frameshift suppressor 3 homolog on chromosome X) (hUpf3p-X) | EBI-21325777 | 0.35 |
Q14157 | Ubiquitin-associated protein 2-like (Protein NICE-4) | EBI-21325777 | 0.35 |
P22314 | Ubiquitin-like modifier-activating enzyme 1 (EC 6.2.1.45) (Protein A1S9) (Ubiquitin-activating enzyme E1) | EBI-21325777 | 0.35 |
P26368 | Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (hU2AF(65)) (hU2AF65) (U2 snRNP auxiliary factor large subunit) | EBI-21325777 | 0.35 |
Q06418 | Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine-protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine-protein kinase TIF) | EBI-21325777 | 0.35 |
P49411 | Elongation factor Tu, mitochondrial (EF-Tu) (P43) | EBI-21325777 | 0.35 |
P68371 | Tubulin beta-4B chain (Tubulin beta-2 chain) (Tubulin beta-2C chain) | EBI-21325777 | 0.35 |
Q9H4B7 | Tubulin beta-1 chain | EBI-21325777 | 0.35 |
P07437 | Tubulin beta chain (Tubulin beta-5 chain) | EBI-21325777 | 0.35 |
P68366 | Tubulin alpha-4A chain (EC 3.6.5.-) (Alpha-tubulin 1) (Testis-specific alpha-tubulin) (Tubulin H2-alpha) (Tubulin alpha-1 chain) | EBI-21325777 | 0.35 |
Q9BQE3 | Tubulin alpha-1C chain (EC 3.6.5.-) (Alpha-tubulin 6) (Tubulin alpha-6 chain) [Cleaved into: Detyrosinated tubulin alpha-1C chain] | EBI-21325777 | 0.35 |
Q8WZ42 | Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) | EBI-21325777 | 0.35 |
Q6IQ55 | Tau-tubulin kinase 2 (EC 2.7.11.1) | EBI-21325777 | 0.35 |
Q13263 | Transcription intermediary factor 1-beta (TIF1-beta) (E3 SUMO-protein ligase TRIM28) (EC 2.3.2.27) (KRAB-associated protein 1) (KAP-1) (KRAB-interacting protein 1) (KRIP-1) (Nuclear corepressor KAP-1) (RING finger protein 96) (RING-type E3 ubiquitin transferase TIF1-beta) (Tripartite motif-containing protein 28) | EBI-21325777 | 0.35 |
P62995 | Transformer-2 protein homolog beta (TRA-2 beta) (TRA2-beta) (hTRA2-beta) (Splicing factor, arginine/serine-rich 10) (Transformer-2 protein homolog B) | EBI-21325777 | 0.35 |
Q13595 | Transformer-2 protein homolog alpha (TRA-2 alpha) (TRA2-alpha) (Transformer-2 protein homolog A) | EBI-21325777 | 0.35 |
P11387 | DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) | EBI-21325777 | 0.35 |
Q9UPQ9 | Trinucleotide repeat-containing gene 6B protein | EBI-21325777 | 0.35 |
Q8TDI8 | Transmembrane channel-like protein 1 (Transmembrane cochlear-expressed protein 1) | EBI-21325777 | 0.35 |
Q01085 | Nucleolysin TIAR (TIA-1-related protein) | EBI-21325777 | 0.35 |
P31483 | Cytotoxic granule associated RNA binding protein TIA1 (Nucleolysin TIA-1 isoform p40) (RNA-binding protein TIA-1) (T-cell-restricted intracellular antigen-1) (TIA-1) (p40-TIA-1) | EBI-21325777 | 0.35 |
Q86V81 | THO complex subunit 4 (Tho4) (Ally of AML-1 and LEF-1) (Aly/REF export factor) (Transcriptional coactivator Aly/REF) (bZIP-enhancing factor BEF) | EBI-21325777 | 0.35 |
Q92734 | Protein TFG (TRK-fused gene protein) | EBI-21325777 | 0.35 |
Q00059 | Transcription factor A, mitochondrial (mtTFA) (Mitochondrial transcription factor 1) (MtTF1) (Transcription factor 6) (TCF-6) (Transcription factor 6-like 2) | EBI-21325777 | 0.35 |
P17987 | T-complex protein 1 subunit alpha (TCP-1-alpha) (CCT-alpha) | EBI-21325777 | 0.35 |
Q15370 | Elongin-B (EloB) (Elongin 18 kDa subunit) (RNA polymerase II transcription factor SIII subunit B) (SIII p18) (Transcription elongation factor B polypeptide 2) | EBI-21325777 | 0.35 |
Q15369 | Elongin-C (EloC) (Elongin 15 kDa subunit) (RNA polymerase II transcription factor SIII subunit C) (SIII p15) (Transcription elongation factor B polypeptide 1) | EBI-21325777 | 0.35 |
Q9Y4P3 | Transducin beta-like protein 2 (WS beta-transducin repeats protein) (WS-betaTRP) (Williams-Beuren syndrome chromosomal region 13 protein) | EBI-21325777 | 0.35 |
Q92804 | TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) | EBI-21325777 | 0.35 |
O60506 | Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) (Glycine- and tyrosine-rich RNA-binding protein) (GRY-RBP) (NS1-associated protein 1) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) | EBI-21325777 | 0.35 |
Q96SI9 | Spermatid perinuclear RNA-binding protein | EBI-21325777 | 0.35 |
Q9Y3F4 | Serine-threonine kinase receptor-associated protein (MAP activator with WD repeats) (UNR-interacting protein) (WD-40 repeat protein PT-WD) | EBI-21325777 | 0.35 |
Q9NUL3 | Double-stranded RNA-binding protein Staufen homolog 2 | EBI-21325777 | 0.35 |
Q08945 | FACT complex subunit SSRP1 (Chromatin-specific transcription elongation factor 80 kDa subunit) (Facilitates chromatin transcription complex 80 kDa subunit) (FACT 80 kDa subunit) (FACTp80) (Facilitates chromatin transcription complex subunit SSRP1) (Recombination signal sequence recognition protein 1) (Structure-specific recognition protein 1) (hSSRP1) (T160) | EBI-21325777 | 0.35 |
P51571 | Translocon-associated protein subunit delta (TRAP-delta) (Signal sequence receptor subunit delta) (SSR-delta) | EBI-21325777 | 0.35 |
Q04837 | Single-stranded DNA-binding protein, mitochondrial (Mt-SSB) (MtSSB) (PWP1-interacting protein 17) | EBI-21325777 | 0.35 |
P05455 | Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS-B) | EBI-21325777 | 0.35 |
Q9UQ35 | Serine/arginine repetitive matrix protein 2 (300 kDa nuclear matrix antigen) (Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa) (SR-related nuclear matrix protein of 300 kDa) (Ser/Arg-related nuclear matrix protein of 300 kDa) (Splicing coactivator subunit SRm300) (Tax-responsive enhancer element-binding protein 803) (TaxREB803) | EBI-21325777 | 0.35 |
Q96SB4 | SRSF protein kinase 1 (EC 2.7.11.1) (SFRS protein kinase 1) (Serine/arginine-rich protein-specific kinase 1) (SR-protein-specific kinase 1) | EBI-21325777 | 0.35 |
P37108 | Signal recognition particle 14 kDa protein (SRP14) (18 kDa Alu RNA-binding protein) | EBI-21325777 | 0.35 |
O15042 | U2 snRNP-associated SURP motif-containing protein (140 kDa Ser/Arg-rich domain protein) (U2-associated protein SR140) | EBI-21325777 | 0.35 |
Q01082 | Spectrin beta chain, non-erythrocytic 1 (Beta-II spectrin) (Fodrin beta chain) (Spectrin, non-erythroid beta chain 1) | EBI-21325777 | 0.35 |
Q13813 | Spectrin alpha chain, non-erythrocytic 1 (Alpha-II spectrin) (Fodrin alpha chain) (Spectrin, non-erythroid alpha subunit) | EBI-21325777 | 0.35 |
Q92673 | Sortilin-related receptor (Low-density lipoprotein receptor relative with 11 ligand-binding repeats) (LDLR relative with 11 ligand-binding repeats) (LR11) (SorLA-1) (Sorting protein-related receptor containing LDLR class A repeats) (SorLA) | EBI-21325777 | 0.35 |
Q9Y5X1 | Sorting nexin-9 (SH3 and PX domain-containing protein 1) (Protein SDP1) (SH3 and PX domain-containing protein 3A) | EBI-21325777 | 0.35 |
P62308 | Small nuclear ribonucleoprotein G (snRNP-G) (Sm protein G) (Sm-G) (SmG) | EBI-21325777 | 0.35 |
P62306 | Small nuclear ribonucleoprotein F (snRNP-F) (Sm protein F) (Sm-F) (SmF) | EBI-21325777 | 0.35 |
P62304 | Small nuclear ribonucleoprotein E (snRNP-E) (Sm protein E) (Sm-E) (SmE) | EBI-21325777 | 0.35 |
P62318 | Small nuclear ribonucleoprotein Sm D3 (Sm-D3) (snRNP core protein D3) | EBI-21325777 | 0.35 |
P62316 | Small nuclear ribonucleoprotein Sm D2 (Sm-D2) (snRNP core protein D2) | EBI-21325777 | 0.35 |
P09234 | U1 small nuclear ribonucleoprotein C (U1 snRNP C) (U1-C) (U1C) | EBI-21325777 | 0.35 |
P14678 | Small nuclear ribonucleoprotein-associated proteins B and B' (snRNP-B) (Sm protein B/B') (Sm-B/B') (SmB/B') | EBI-21325777 | 0.35 |
P08621 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | EBI-21325777 | 0.35 |
O75643 | U5 small nuclear ribonucleoprotein 200 kDa helicase (EC 3.6.4.13) (Activating signal cointegrator 1 complex subunit 3-like 1) (BRR2 homolog) (U5 snRNP-specific 200 kDa protein) (U5-200KD) | EBI-21325777 | 0.35 |
Q9UQE7 | Structural maintenance of chromosomes protein 3 (SMC protein 3) (SMC-3) (Basement membrane-associated chondroitin proteoglycan) (Bamacan) (Chondroitin sulfate proteoglycan 6) (Chromosome-associated polypeptide) (hCAP) | EBI-21325777 | 0.35 |
Q12824 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (BRG1-associated factor 47) (BAF47) (Integrase interactor 1 protein) (SNF5 homolog) (hSNF5) | EBI-21325777 | 0.35 |
P51532 | Transcription activator BRG1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA4) (BRG1-associated factor 190A) (BAF190A) (Mitotic growth and transcription activator) (Protein BRG-1) (Protein brahma homolog 1) (SNF2-beta) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4) | EBI-21325777 | 0.35 |
Q6IEE8 | Schlafen family member 12-like | EBI-21325777 | 0.35 |
P12236 | ADP/ATP translocase 3 (ADP,ATP carrier protein 3) (ADP,ATP carrier protein, isoform T2) (ANT 2) (Adenine nucleotide translocator 3) (ANT 3) (Solute carrier family 25 member 6) [Cleaved into: ADP/ATP translocase 3, N-terminally processed] | EBI-21325777 | 0.35 |
P05141 | ADP/ATP translocase 2 (ADP,ATP carrier protein 2) (ADP,ATP carrier protein, fibroblast isoform) (Adenine nucleotide translocator 2) (ANT 2) (Solute carrier family 25 member 5) [Cleaved into: ADP/ATP translocase 2, N-terminally processed] | EBI-21325777 | 0.35 |
P12235 | ADP/ATP translocase 1 (ADP,ATP carrier protein 1) (ADP,ATP carrier protein, heart/skeletal muscle isoform T1) (Adenine nucleotide translocator 1) (ANT 1) (Solute carrier family 25 member 4) | EBI-21325777 | 0.35 |
Q00325 | Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3) | EBI-21325777 | 0.35 |
P63208 | S-phase kinase-associated protein 1 (Cyclin-A/CDK2-associated protein p19) (p19A) (Organ of Corti protein 2) (OCP-2) (Organ of Corti protein II) (OCP-II) (RNA polymerase II elongation factor-like protein) (SIII) (Transcription elongation factor B polypeptide 1-like) (p19skp1) | EBI-21325777 | 0.35 |
Q8TBC3 | SH3KBP1-binding protein 1 (SETA-binding protein 1) | EBI-21325777 | 0.35 |
Q16629 | Serine/arginine-rich splicing factor 7 (Splicing factor 9G8) (Splicing factor, arginine/serine-rich 7) | EBI-21325777 | 0.35 |
Q13247 | Serine/arginine-rich splicing factor 6 (Pre-mRNA-splicing factor SRP55) (Splicing factor, arginine/serine-rich 6) | EBI-21325777 | 0.35 |
Q13243 | Serine/arginine-rich splicing factor 5 (Delayed-early protein HRS) (Pre-mRNA-splicing factor SRP40) (Splicing factor, arginine/serine-rich 5) | EBI-21325777 | 0.35 |
P84103 | Serine/arginine-rich splicing factor 3 (Pre-mRNA-splicing factor SRP20) (Splicing factor, arginine/serine-rich 3) | EBI-21325777 | 0.35 |
Q01130 | Serine/arginine-rich splicing factor 2 (Protein PR264) (Splicing component, 35 kDa) (Splicing factor SC35) (SC-35) (Splicing factor, arginine/serine-rich 2) | EBI-21325777 | 0.35 |
Q07955 | Serine/arginine-rich splicing factor 1 (Alternative-splicing factor 1) (ASF-1) (Splicing factor, arginine/serine-rich 1) (pre-mRNA-splicing factor SF2, P33 subunit) | EBI-21325777 | 0.35 |
P23246 | Splicing factor, proline- and glutamine-rich (100 kDa DNA-pairing protein) (hPOMp100) (DNA-binding p52/p100 complex, 100 kDa subunit) (Polypyrimidine tract-binding protein-associated-splicing factor) (PSF) (PTB-associated-splicing factor) | EBI-21325777 | 0.35 |
Q15427 | Splicing factor 3B subunit 4 (Pre-mRNA-splicing factor SF3b 49 kDa subunit) (Spliceosome-associated protein 49) (SAP 49) | EBI-21325777 | 0.35 |
Q15393 | Splicing factor 3B subunit 3 (Pre-mRNA-splicing factor SF3b 130 kDa subunit) (SF3b130) (STAF130) (Spliceosome-associated protein 130) (SAP 130) | EBI-21325777 | 0.35 |
O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | EBI-21325777 | 0.35 |
Q12874 | Splicing factor 3A subunit 3 (SF3a60) (Spliceosome-associated protein 61) (SAP 61) | EBI-21325777 | 0.35 |
P48594 | Serpin B4 (Leupin) (Peptidase inhibitor 11) (PI-11) (Squamous cell carcinoma antigen 2) (SCCA-2) | EBI-21325777 | 0.35 |
P29508 | Serpin B3 (Protein T4-A) (Squamous cell carcinoma antigen 1) (SCCA-1) | EBI-21325777 | 0.35 |
Q9GZR1 | Sentrin-specific protease 6 (EC 3.4.22.-) (SUMO-1-specific protease 1) (Sentrin/SUMO-specific protease SENP6) | EBI-21325777 | 0.35 |
P21912 | Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (EC 1.3.5.1) (Iron-sulfur subunit of complex II) (Ip) | EBI-21325777 | 0.35 |
P31040 | Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (EC 1.3.5.1) (Flavoprotein subunit of complex II) (Fp) | EBI-21325777 | 0.35 |
Q14151 | Scaffold attachment factor B2 (SAF-B2) | EBI-21325777 | 0.35 |
P06702 | Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9) | EBI-21325777 | 0.35 |
P05109 | Protein S100-A8 (Calgranulin-A) (Calprotectin L1L subunit) (Cystic fibrosis antigen) (CFAG) (Leukocyte L1 complex light chain) (Migration inhibitory factor-related protein 8) (MRP-8) (p8) (S100 calcium-binding protein A8) (Urinary stone protein band A) | EBI-21325777 | 0.35 |
Q9Y265 | RuvB-like 1 (EC 3.6.4.12) (49 kDa TATA box-binding protein-interacting protein) (49 kDa TBP-interacting protein) (54 kDa erythrocyte cytosolic protein) (ECP-54) (INO80 complex subunit H) (Nuclear matrix protein 238) (NMP 238) (Pontin 52) (TIP49a) (TIP60-associated protein 54-alpha) (TAP54-alpha) | EBI-21325777 | 0.35 |
O76021 | Ribosomal L1 domain-containing protein 1 (CATX-11) (Cellular senescence-inhibited gene protein) (Protein PBK1) | EBI-21325777 | 0.35 |
Q9Y3B9 | RRP15-like protein (Ribosomal RNA-processing protein 15) | EBI-21325777 | 0.35 |
P23921 | Ribonucleoside-diphosphate reductase large subunit (EC 1.17.4.1) (Ribonucleoside-diphosphate reductase subunit M1) (Ribonucleotide reductase large subunit) | EBI-21325777 | 0.35 |
P46781 | 40S ribosomal protein S9 (Small ribosomal subunit protein uS4) | EBI-21325777 | 0.35 |
P62241 | 40S ribosomal protein S8 (Small ribosomal subunit protein eS8) | EBI-21325777 | 0.35 |
P62081 | 40S ribosomal protein S7 (Small ribosomal subunit protein eS7) | EBI-21325777 | 0.35 |
P62753 | 40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6) | EBI-21325777 | 0.35 |
P62701 | 40S ribosomal protein S4, X isoform (SCR10) (Single copy abundant mRNA protein) (Small ribosomal subunit protein eS4) | EBI-21325777 | 0.35 |
P61247 | 40S ribosomal protein S3a (Small ribosomal subunit protein eS1) (v-fos transformation effector protein) (Fte-1) | EBI-21325777 | 0.35 |
P23396 | 40S ribosomal protein S3 (EC 4.2.99.18) (Small ribosomal subunit protein uS3) | EBI-21325777 | 0.35 |
P42677 | 40S ribosomal protein S27 (Metallopan-stimulin 1) (MPS-1) (Small ribosomal subunit protein eS27) | EBI-21325777 | 0.35 |
P62851 | 40S ribosomal protein S25 (Small ribosomal subunit protein eS25) | EBI-21325777 | 0.35 |
P62847 | 40S ribosomal protein S24 (Small ribosomal subunit protein eS24) | EBI-21325777 | 0.35 |
P62266 | 40S ribosomal protein S23 (Small ribosomal subunit protein uS12) | EBI-21325777 | 0.35 |
P63220 | 40S ribosomal protein S21 (Small ribosomal subunit protein eS21) | EBI-21325777 | 0.35 |
P60866 | 40S ribosomal protein S20 (Small ribosomal subunit protein uS10) | EBI-21325777 | 0.35 |
P15880 | 40S ribosomal protein S2 (40S ribosomal protein S4) (Protein LLRep3) (Small ribosomal subunit protein uS5) | EBI-21325777 | 0.35 |
P39019 | 40S ribosomal protein S19 (Small ribosomal subunit protein eS19) | EBI-21325777 | 0.35 |
P08708 | 40S ribosomal protein S17 (Small ribosomal subunit protein eS17) | EBI-21325777 | 0.35 |
P62249 | 40S ribosomal protein S16 (Small ribosomal subunit protein uS9) | EBI-21325777 | 0.35 |
P62244 | 40S ribosomal protein S15a (Small ribosomal subunit protein uS8) | EBI-21325777 | 0.35 |
P62841 | 40S ribosomal protein S15 (RIG protein) (Small ribosomal subunit protein uS19) | EBI-21325777 | 0.35 |
P62263 | 40S ribosomal protein S14 (Small ribosomal subunit protein uS11) | EBI-21325777 | 0.35 |
P62277 | 40S ribosomal protein S13 (Small ribosomal subunit protein uS15) | EBI-21325777 | 0.35 |
P62280 | 40S ribosomal protein S11 (Small ribosomal subunit protein uS17) | EBI-21325777 | 0.35 |
P46783 | 40S ribosomal protein S10 (Small ribosomal subunit protein eS10) | EBI-21325777 | 0.35 |
P04843 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit) (Ribophorin I) (RPN-I) (Ribophorin-1) | EBI-21325777 | 0.35 |
P05387 | 60S acidic ribosomal protein P2 (Large ribosomal subunit protein P2) (Renal carcinoma antigen NY-REN-44) | EBI-21325777 | 0.35 |
P05386 | 60S acidic ribosomal protein P1 (Large ribosomal subunit protein P1) | EBI-21325777 | 0.35 |
P05388 | 60S acidic ribosomal protein P0 (60S ribosomal protein L10E) (Large ribosomal subunit protein uL10) | EBI-21325777 | 0.35 |
P32969 | 60S ribosomal protein L9 (Large ribosomal subunit protein uL6) | EBI-21325777 | 0.35 |
P62917 | 60S ribosomal protein L8 (Large ribosomal subunit protein uL2) | EBI-21325777 | 0.35 |
P62424 | 60S ribosomal protein L7a (Large ribosomal subunit protein eL8) (PLA-X polypeptide) (Surfeit locus protein 3) | EBI-21325777 | 0.35 |
Q02878 | 60S ribosomal protein L6 (Large ribosomal subunit protein eL6) (Neoplasm-related protein C140) (Tax-responsive enhancer element-binding protein 107) (TaxREB107) | EBI-21325777 | 0.35 |
P46777 | 60S ribosomal protein L5 (Large ribosomal subunit protein uL18) | EBI-21325777 | 0.35 |
P36578 | 60S ribosomal protein L4 (60S ribosomal protein L1) (Large ribosomal subunit protein uL4) | EBI-21325777 | 0.35 |
P63173 | 60S ribosomal protein L38 (Large ribosomal subunit protein eL38) | EBI-21325777 | 0.35 |
P61513 | 60S ribosomal protein L37a (Large ribosomal subunit protein eL43) | EBI-21325777 | 0.35 |
P42766 | 60S ribosomal protein L35 (Large ribosomal subunit protein uL29) | EBI-21325777 | 0.35 |
P62899 | 60S ribosomal protein L31 (Large ribosomal subunit protein eL31) | EBI-21325777 | 0.35 |
P62888 | 60S ribosomal protein L30 (Large ribosomal subunit protein eL30) | EBI-21325777 | 0.35 |
P39023 | 60S ribosomal protein L3 (HIV-1 TAR RNA-binding protein B) (TARBP-B) (Large ribosomal subunit protein uL3) | EBI-21325777 | 0.35 |
P46779 | 60S ribosomal protein L28 (Large ribosomal subunit protein eL28) | EBI-21325777 | 0.35 |
P46776 | 60S ribosomal protein L27a (Large ribosomal subunit protein uL15) | EBI-21325777 | 0.35 |
P61353 | 60S ribosomal protein L27 (Large ribosomal subunit protein eL27) | EBI-21325777 | 0.35 |
Q9UNX3 | 60S ribosomal protein L26-like 1 (Large ribosomal subunit protein uL24-like 1) | EBI-21325777 | 0.35 |
P83731 | 60S ribosomal protein L24 (60S ribosomal protein L30) (Large ribosomal subunit protein eL24) | EBI-21325777 | 0.35 |
P62750 | 60S ribosomal protein L23a (Large ribosomal subunit protein uL23) | EBI-21325777 | 0.35 |
P62829 | 60S ribosomal protein L23 (60S ribosomal protein L17) (Large ribosomal subunit protein uL14) | EBI-21325777 | 0.35 |
P35268 | 60S ribosomal protein L22 (EBER-associated protein) (EAP) (Epstein-Barr virus small RNA-associated protein) (Heparin-binding protein HBp15) (Large ribosomal subunit protein eL22) | EBI-21325777 | 0.35 |
P84098 | 60S ribosomal protein L19 (Large ribosomal subunit protein eL19) | EBI-21325777 | 0.35 |
Q02543 | 60S ribosomal protein L18a (Large ribosomal subunit protein eL20) | EBI-21325777 | 0.35 |
Q07020 | 60S ribosomal protein L18 (Large ribosomal subunit protein eL18) | EBI-21325777 | 0.35 |
P61313 | 60S ribosomal protein L15 (Large ribosomal subunit protein eL15) | EBI-21325777 | 0.35 |
P50914 | 60S ribosomal protein L14 (CAG-ISL 7) (Large ribosomal subunit protein eL14) | EBI-21325777 | 0.35 |
P26373 | 60S ribosomal protein L13 (Breast basic conserved protein 1) (Large ribosomal subunit protein eL13) | EBI-21325777 | 0.35 |
P30050 | 60S ribosomal protein L12 (Large ribosomal subunit protein uL11) | EBI-21325777 | 0.35 |
P62913 | 60S ribosomal protein L11 (CLL-associated antigen KW-12) (Large ribosomal subunit protein uL5) | EBI-21325777 | 0.35 |
Q96L21 | 60S ribosomal protein L10-like (Large ribosomal subunit protein uL16-like) | EBI-21325777 | 0.35 |
P62906 | 60S ribosomal protein L10a (CSA-19) (Large ribosomal subunit protein uL1) (Neural precursor cell expressed developmentally down-regulated protein 6) (NEDD-6) | EBI-21325777 | 0.35 |
P27635 | 60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM) | EBI-21325777 | 0.35 |
Q15287 | RNA-binding protein with serine-rich domain 1 (SR-related protein LDC2) | EBI-21325777 | 0.35 |
O43148 | mRNA cap guanine-N7 methyltransferase (EC 2.1.1.56) (RG7MT1) (mRNA (guanine-N(7))-methyltransferase) (mRNA cap methyltransferase) (hCMT1) (hMet) (hcm1p) | EBI-21325777 | 0.35 |
P13489 | Ribonuclease inhibitor (Placental ribonuclease inhibitor) (Placental RNase inhibitor) (Ribonuclease/angiogenin inhibitor 1) (RAI) | EBI-21325777 | 0.35 |
Q8WVD3 | E3 ubiquitin-protein ligase RNF138 (EC 2.3.2.27) (Nemo-like kinase-associated RING finger protein) (NLK-associated RING finger protein) (hNARF) (RING finger protein 138) (RING-type E3 ubiquitin transferase RNF138) | EBI-21325777 | 0.35 |
P78509 | Reelin (EC 3.4.21.-) | EBI-21325777 | 0.35 |
Q8NDN9 | RCC1 and BTB domain-containing protein 1 (Chronic lymphocytic leukemia deletion region gene 7 protein) (CLL deletion region gene 7 protein) (Regulator of chromosome condensation and BTB domain-containing protein 1) | EBI-21325777 | 0.35 |
O75526 | RNA-binding motif protein, X-linked-like-2 (Testis-specific heterogeneous nuclear ribonucleoprotein G-T) (hnRNP G-T) | EBI-21325777 | 0.35 |
P52756 | RNA-binding protein 5 (Protein G15) (Putative tumor suppressor LUCA15) (RNA-binding motif protein 5) (Renal carcinoma antigen NY-REN-9) | EBI-21325777 | 0.35 |
Q9BTD8 | RNA-binding protein 42 (RNA-binding motif protein 42) | EBI-21325777 | 0.35 |
Q9BWF3 | RNA-binding protein 4 (Lark homolog) (hLark) (RNA-binding motif protein 4) (RNA-binding motif protein 4a) | EBI-21325777 | 0.35 |
Q14498 | RNA-binding protein 39 (CAPER alpha) (CAPERalpha) (Hepatocellular carcinoma protein 1) (RNA-binding motif protein 39) (RNA-binding region-containing protein 2) (Splicing factor HCC1) | EBI-21325777 | 0.35 |
P98179 | RNA-binding protein 3 (RNA-binding motif protein 3) (RNPL) | EBI-21325777 | 0.35 |
Q16769 | Glutaminyl-peptide cyclotransferase (EC 2.3.2.5) (Glutaminyl cyclase) (QC) (sQC) (Glutaminyl-tRNA cyclotransferase) (Glutamyl cyclase) (EC) | EBI-21325777 | 0.35 |
P09417 | Dihydropteridine reductase (EC 1.5.1.34) (HDHPR) (Quinoid dihydropteridine reductase) (Short chain dehydrogenase/reductase family 33C member 1) | EBI-21325777 | 0.35 |
Q13610 | Periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) | EBI-21325777 | 0.35 |
Q9UHX1 | Poly(U)-binding-splicing factor PUF60 (60 kDa poly(U)-binding-splicing factor) (FUSE-binding protein-interacting repressor) (FBP-interacting repressor) (Ro-binding protein 1) (RoBP1) (Siah-binding protein 1) (Siah-BP1) | EBI-21325777 | 0.35 |
P26599 | Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) | EBI-21325777 | 0.35 |
Q14997 | Proteasome activator complex subunit 4 (Proteasome activator PA200) | EBI-21325777 | 0.35 |
O14818 | Proteasome subunit alpha type-7 (Proteasome subunit RC6-1) (Proteasome subunit XAPC7) | EBI-21325777 | 0.35 |
O60256 | Phosphoribosyl pyrophosphate synthase-associated protein 2 (PRPP synthase-associated protein 2) (41 kDa phosphoribosypyrophosphate synthetase-associated protein) (PAP41) | EBI-21325777 | 0.35 |
Q14558 | Phosphoribosyl pyrophosphate synthase-associated protein 1 (PRPP synthase-associated protein 1) (39 kDa phosphoribosypyrophosphate synthase-associated protein) (PAP39) | EBI-21325777 | 0.35 |
P21108 | Ribose-phosphate pyrophosphokinase 3 (EC 2.7.6.1) (Phosphoribosyl pyrophosphate synthase 1-like 1) (PRPS1-like 1) (Phosphoribosyl pyrophosphate synthase III) (PRS-III) | EBI-21325777 | 0.35 |
O75400 | Pre-mRNA-processing factor 40 homolog A (Fas ligand-associated factor 1) (Formin-binding protein 11) (Formin-binding protein 3) (Huntingtin yeast partner A) (Huntingtin-interacting protein 10) (HIP-10) (Huntingtin-interacting protein A) (Renal carcinoma antigen NY-REN-6) | EBI-21325777 | 0.35 |
Q86UA1 | Pre-mRNA-processing factor 39 (PRP39 homolog) | EBI-21325777 | 0.35 |
Q8WWY3 | U4/U6 small nuclear ribonucleoprotein Prp31 (Pre-mRNA-processing factor 31) (Serologically defined breast cancer antigen NY-BR-99) (U4/U6 snRNP 61 kDa protein) (Protein 61K) (hPrp31) | EBI-21325777 | 0.35 |
Q9UMS4 | Pre-mRNA-processing factor 19 (EC 2.3.2.27) (Nuclear matrix protein 200) (PRP19/PSO4 homolog) (hPso4) (RING-type E3 ubiquitin transferase PRP19) (Senescence evasion factor) | EBI-21325777 | 0.35 |
P78527 | DNA-dependent protein kinase catalytic subunit (DNA-PK catalytic subunit) (DNA-PKcs) (EC 2.7.11.1) (DNPK1) (p460) | EBI-21325777 | 0.35 |
P30048 | Thioredoxin-dependent peroxide reductase, mitochondrial (EC 1.11.1.24) (Antioxidant protein 1) (AOP-1) (HBC189) (Peroxiredoxin III) (Prx-III) (Peroxiredoxin-3) (Protein MER5 homolog) (Thioredoxin-dependent peroxiredoxin 3) | EBI-21325777 | 0.35 |
Q06830 | Peroxiredoxin-1 (EC 1.11.1.24) (Natural killer cell-enhancing factor A) (NKEF-A) (Proliferation-associated gene protein) (PAG) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Thioredoxin-dependent peroxiredoxin 1) | EBI-21325777 | 0.35 |
O75807 | Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog) | EBI-21325777 | 0.35 |
P62937 | Peptidyl-prolyl cis-trans isomerase A (PPIase A) (EC 5.2.1.8) (Cyclophilin A) (Cyclosporin A-binding protein) (Rotamase A) [Cleaved into: Peptidyl-prolyl cis-trans isomerase A, N-terminally processed] | EBI-21325777 | 0.35 |
Q99575 | Ribonucleases P/MRP protein subunit POP1 (hPOP1) | EBI-21325777 | 0.35 |
P19388 | DNA-directed RNA polymerases I, II, and III subunit RPABC1 (RNA polymerases I, II, and III subunit ABC1) (DNA-directed RNA polymerase II 23 kDa polypeptide) (DNA-directed RNA polymerase II subunit E) (RPB5 homolog) (XAP4) | EBI-21325777 | 0.35 |
P19387 | DNA-directed RNA polymerase II subunit RPB3 (RNA polymerase II subunit 3) (RNA polymerase II subunit B3) (DNA-directed RNA polymerase II 33 kDa polypeptide) (RPB33) (DNA-directed RNA polymerase II subunit C) (RPB31) | EBI-21325777 | 0.35 |
Q8WVV4 | Protein POF1B (Premature ovarian failure protein 1B) | EBI-21325777 | 0.35 |
Q02809 | Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 (EC 1.14.11.4) (Lysyl hydroxylase 1) (LH1) | EBI-21325777 | 0.35 |
P53350 | Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13) | EBI-21325777 | 0.35 |
P14618 | Pyruvate kinase PKM (EC 2.7.1.40) (Cytosolic thyroid hormone-binding protein) (CTHBP) (Opa-interacting protein 3) (OIP-3) (Pyruvate kinase 2/3) (Pyruvate kinase muscle isozyme) (Threonine-protein kinase PKM2) (EC 2.7.11.1) (Thyroid hormone-binding protein 1) (THBP1) (Tumor M2-PK) (Tyrosine-protein kinase PKM2) (EC 2.7.10.2) (p58) | EBI-21325777 | 0.35 |
Q9P1Y6 | PHD and RING finger domain-containing protein 1 | EBI-21325777 | 0.35 |
O00264 | Membrane-associated progesterone receptor component 1 (mPR) (Dap1) (IZA) | EBI-21325777 | 0.35 |
P00558 | Phosphoglycerate kinase 1 (EC 2.7.2.3) (Cell migration-inducing gene 10 protein) (Primer recognition protein 2) (PRP 2) | EBI-21325777 | 0.35 |
Q96HS1 | Serine/threonine-protein phosphatase PGAM5, mitochondrial (EC 3.1.3.16) (Bcl-XL-binding protein v68) (Phosphoglycerate mutase family member 5) | EBI-21325777 | 0.35 |
Q01813 | ATP-dependent 6-phosphofructokinase, platelet type (ATP-PFK) (PFK-P) (EC 2.7.1.11) (6-phosphofructokinase type C) (Phosphofructo-1-kinase isozyme C) (PFK-C) (Phosphohexokinase) | EBI-21325777 | 0.35 |
O00764 | Pyridoxal kinase (EC 2.7.1.35) (Pyridoxine kinase) | EBI-21325777 | 0.35 |
Q15084 | Protein disulfide-isomerase A6 (EC 5.3.4.1) (Endoplasmic reticulum protein 5) (ER protein 5) (ERp5) (Protein disulfide isomerase P5) (Thioredoxin domain-containing protein 7) | EBI-21325777 | 0.35 |
P29803 | Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial (EC 1.2.4.1) (PDHE1-A type II) | EBI-21325777 | 0.35 |
O43924 | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (GMP-PDE delta) (Protein p17) | EBI-21325777 | 0.35 |
Q6L8Q7 | 2',5'-phosphodiesterase 12 (2'-PDE) (2-PDE) (EC 3.1.4.-) (Mitochondrial deadenylase) (EC 3.1.13.4) | EBI-21325777 | 0.35 |
P22061 | Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PIMT) (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) | EBI-21325777 | 0.35 |
Q15366 | Poly(rC)-binding protein 2 (Alpha-CP2) (Heterogeneous nuclear ribonucleoprotein E2) (hnRNP E2) | EBI-21325777 | 0.35 |
Q15365 | Poly(rC)-binding protein 1 (Alpha-CP1) (Heterogeneous nuclear ribonucleoprotein E1) (hnRNP E1) (Nucleic acid-binding protein SUB2.3) | EBI-21325777 | 0.35 |
P61457 | Pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (DCoH) (Dimerization cofactor of HNF1) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD) | EBI-21325777 | 0.35 |
P09874 | Poly [ADP-ribose] polymerase 1 (PARP-1) (EC 2.4.2.30) (ADP-ribosyltransferase diphtheria toxin-like 1) (ARTD1) (DNA ADP-ribosyltransferase PARP1) (EC 2.4.2.-) (NAD(+) ADP-ribosyltransferase 1) (ADPRT 1) (Poly[ADP-ribose] synthase 1) (Protein poly-ADP-ribosyltransferase PARP1) (EC 2.4.2.-) [Cleaved into: Poly [ADP-ribose] polymerase 1, processed C-terminus (Poly [ADP-ribose] polymerase 1, 89-kDa form); Poly [ADP-ribose] polymerase 1, processed N-terminus (NT-PARP-1) (Poly [ADP-ribose] polymerase 1, 24-kDa form) (Poly [ADP-ribose] polymerase 1, 28-kDa form)] | EBI-21325777 | 0.35 |
Q86U42 | Polyadenylate-binding protein 2 (PABP-2) (Poly(A)-binding protein 2) (Nuclear poly(A)-binding protein 1) (Poly(A)-binding protein II) (PABII) (Polyadenylate-binding nuclear protein 1) | EBI-21325777 | 0.35 |
Q13310 | Polyadenylate-binding protein 4 (PABP-4) (Poly(A)-binding protein 4) (Activated-platelet protein 1) (APP-1) (Inducible poly(A)-binding protein) (iPABP) | EBI-21325777 | 0.35 |
P11940 | Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1) | EBI-21325777 | 0.35 |
Q7Z417 | FMR1-interacting protein NUFIP2 (82 kDa FMRP-interacting protein) (82-FIP) (Cell proliferation-inducing gene 1 protein) (FMRP-interacting protein 2) (Nuclear FMR1-interacting protein 2) | EBI-21325777 | 0.35 |
Q9BRJ7 | Tudor-interacting repair regulator protein (NUDT16-like protein 1) (Protein syndesmos) | EBI-21325777 | 0.35 |
P36639 | Oxidized purine nucleoside triphosphate hydrolase (EC 3.6.1.56) (2-hydroxy-dATP diphosphatase) (7,8-dihydro-8-oxoguanine triphosphatase) (8-oxo-dGTPase) (Methylated purine nucleoside triphosphate hydrolase) (EC 3.6.1.-) (Nucleoside diphosphate-linked moiety X motif 1) (Nudix motif 1) | EBI-21325777 | 0.35 |
Q08J23 | RNA cytosine C(5)-methyltransferase NSUN2 (EC 2.1.1.-) (Myc-induced SUN domain-containing protein) (Misu) (NOL1/NOP2/Sun domain family member 2) (Substrate of AIM1/Aurora kinase B) (mRNA cytosine C(5)-methyltransferase) (EC 2.1.1.-) (tRNA cytosine C(5)-methyltransferase) (EC 2.1.1.-, EC 2.1.1.203) (tRNA methyltransferase 4 homolog) (hTrm4) | EBI-21325777 | 0.35 |
P16083 | Ribosyldihydronicotinamide dehydrogenase [quinone] (EC 1.10.5.1) (NRH dehydrogenase [quinone] 2) (NRH:quinone oxidoreductase 2) (Quinone reductase 2) (QR2) | EBI-21325777 | 0.35 |
P06748 | Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin) | EBI-21325777 | 0.35 |
O00567 | Nucleolar protein 56 (Nucleolar protein 5A) | EBI-21325777 | 0.35 |
P46087 | Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase (EC 2.1.1.-) (Nucleolar protein 1) (Nucleolar protein 2 homolog) (Proliferating-cell nucleolar antigen p120) (Proliferation-associated nucleolar protein p120) | EBI-21325777 | 0.35 |
Q9Y3C1 | Nucleolar protein 16 (HBV pre-S2 trans-regulated protein 3) | EBI-21325777 | 0.35 |
Q15233 | Non-POU domain-containing octamer-binding protein (NonO protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) | EBI-21325777 | 0.35 |
O15226 | NF-kappa-B-repressing factor (NFkB-repressing factor) (NRF) (Protein ITBA4) | EBI-21325777 | 0.35 |
P49821 | NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (EC 7.1.1.2) (Complex I-51kD) (CI-51kD) (NADH dehydrogenase flavoprotein 1) (NADH-ubiquinone oxidoreductase 51 kDa subunit) | EBI-21325777 | 0.35 |
P19338 | Nucleolin (Protein C23) | EBI-21325777 | 0.35 |
Q09161 | Nuclear cap-binding protein subunit 1 (80 kDa nuclear cap-binding protein) (CBP80) (NCBP 80 kDa subunit) | EBI-21325777 | 0.35 |
P55209 | Nucleosome assembly protein 1-like 1 (NAP-1-related protein) (hNRP) | EBI-21325777 | 0.35 |
Q9NP98 | Myozenin-1 (Calsarcin-2) (Filamin-, actinin- and telethonin-binding protein) (Protein FATZ) | EBI-21325777 | 0.35 |
Q9NPC7 | Myoneurin (Zinc finger and BTB domain-containing protein 31) | EBI-21325777 | 0.35 |
Q8WXC6 | COP9 signalosome complex subunit 9 (CSN acidic protein) (CSNAP) (Myeloma-overexpressed gene 2 protein) | EBI-21325777 | 0.35 |
Q9BQG0 | Myb-binding protein 1A | EBI-21325777 | 0.35 |
Q6UB35 | Monofunctional C1-tetrahydrofolate synthase, mitochondrial (EC 6.3.4.3) (Formyltetrahydrofolate synthetase) | EBI-21325777 | 0.35 |
Q92552 | 28S ribosomal protein S27, mitochondrial (MRP-S27) (S27mt) (Mitochondrial ribosomal protein S27) (Mitochondrial small ribosomal subunit protein mS27) | EBI-21325777 | 0.35 |
P82663 | 28S ribosomal protein S25, mitochondrial (MRP-S25) (S25mt) (Mitochondrial small ribosomal subunit protein mS25) | EBI-21325777 | 0.35 |
Q9Y3D9 | 28S ribosomal protein S23, mitochondrial (MRP-S23) (S23mt) (Mitochondrial small ribosomal subunit protein mS23) | EBI-21325777 | 0.35 |
P82650 | 28S ribosomal protein S22, mitochondrial (MRP-S22) (S22mt) (Mitochondrial small ribosomal subunit protein mS22) | EBI-21325777 | 0.35 |
P82914 | 28S ribosomal protein S15, mitochondrial (MRP-S15) (S15mt) (Mitochondrial small ribosomal subunit protein uS15m) | EBI-21325777 | 0.35 |
P82912 | 28S ribosomal protein S11, mitochondrial (MRP-S11) (S11mt) (Cervical cancer proto-oncogene 2 protein) (HCC-2) (Mitochondrial small ribosomal subunit protein uS11m) | EBI-21325777 | 0.35 |
Q13405 | 39S ribosomal protein L49, mitochondrial (L49mt) (MRP-L49) (Mitochondrial large ribosomal subunit protein mL49) (Neighbor of FAU) (NOF) (Protein NOF1) | EBI-21325777 | 0.35 |
Q8N983 | 39S ribosomal protein L43, mitochondrial (L43mt) (MRP-L43) (Mitochondrial large ribosomal subunit protein mL43) (Mitochondrial ribosomal protein bMRP36a) | EBI-21325777 | 0.35 |
P49406 | 39S ribosomal protein L19, mitochondrial (L19mt) (MRP-L19) (39S ribosomal protein L15, mitochondrial) (L15mt) (MRP-L15) (Mitochondrial large ribosomal subunit protein bL19m) | EBI-21325777 | 0.35 |
Q9Y3B7 | 39S ribosomal protein L11, mitochondrial (L11mt) (MRP-L11) (Mitochondrial large ribosomal subunit protein uL11m) | EBI-21325777 | 0.35 |
Q9HCE1 | Helicase MOV-10 (EC 3.6.4.13) (Armitage homolog) (Moloney leukemia virus 10 protein) | EBI-21325777 | 0.35 |
P50219 | Motor neuron and pancreas homeobox protein 1 (Homeobox protein HB9) | EBI-21325777 | 0.35 |
P40926 | Malate dehydrogenase, mitochondrial (EC 1.1.1.37) | EBI-21325777 | 0.35 |
P33993 | DNA replication licensing factor MCM7 (EC 3.6.4.12) (CDC47 homolog) (P1.1-MCM3) | EBI-21325777 | 0.35 |
P25205 | DNA replication licensing factor MCM3 (EC 3.6.4.12) (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) (RLF subunit beta) (p102) | EBI-21325777 | 0.35 |
P43243 | Matrin-3 | EBI-21325777 | 0.35 |
P31153 | S-adenosylmethionine synthase isoform type-2 (AdoMet synthase 2) (EC 2.5.1.6) (Methionine adenosyltransferase 2) (MAT 2) (Methionine adenosyltransferase II) (MAT-II) | EBI-21325777 | 0.35 |
P49137 | MAP kinase-activated protein kinase 2 (MAPK-activated protein kinase 2) (MAPKAP kinase 2) (MAPKAP-K2) (MAPKAPK-2) (MK-2) (MK2) (EC 2.7.11.1) | EBI-21325777 | 0.35 |
Q92918 | Mitogen-activated protein kinase kinase kinase kinase 1 (EC 2.7.11.1) (Hematopoietic progenitor kinase) (MAPK/ERK kinase kinase kinase 1) (MEK kinase kinase 1) (MEKKK 1) | EBI-21325777 | 0.35 |
Q9UNF1 | Melanoma-associated antigen D2 (11B6) (Breast cancer-associated gene 1 protein) (BCG-1) (Hepatocellular carcinoma-associated protein JCL-1) (MAGE-D2 antigen) | EBI-21325777 | 0.35 |
Q9NX58 | Cell growth-regulating nucleolar protein | EBI-21325777 | 0.35 |
Q9Y383 | Putative RNA-binding protein Luc7-like 2 | EBI-21325777 | 0.35 |
Q3MHD2 | Protein LSM12 | EBI-21325777 | 0.35 |
Q8N1G4 | Leucine-rich repeat-containing protein 47 | EBI-21325777 | 0.35 |
Q6ZN17 | Protein lin-28 homolog B (Lin-28B) | EBI-21325777 | 0.35 |
Q08380 | Galectin-3-binding protein (Basement membrane autoantigen p105) (Lectin galactoside-binding soluble 3-binding protein) (Mac-2-binding protein) (MAC2BP) (Mac-2 BP) (Tumor-associated antigen 90K) | EBI-21325777 | 0.35 |
P07195 | L-lactate dehydrogenase B chain (LDH-B) (EC 1.1.1.27) (LDH heart subunit) (LDH-H) (Renal carcinoma antigen NY-REN-46) | EBI-21325777 | 0.35 |
Q92615 | La-related protein 4B (La ribonucleoprotein domain family member 4B) (La ribonucleoprotein domain family member 5) (La-related protein 5) | EBI-21325777 | 0.35 |
Q6PKG0 | La-related protein 1 (La ribonucleoprotein domain family member 1) | EBI-21325777 | 0.35 |
P35527 | Keratin, type I cytoskeletal 9 (Cytokeratin-9) (CK-9) (Keratin-9) (K9) | EBI-21325777 | 0.35 |
Q6KB66 | Keratin, type II cytoskeletal 80 (Cytokeratin-80) (CK-80) (Keratin-80) (K80) (Type-II keratin Kb20) | EBI-21325777 | 0.35 |
Q8N1N4 | Keratin, type II cytoskeletal 78 (Cytokeratin-78) (CK-78) (Keratin-5b) (Keratin-78) (K78) (Type-II keratin Kb40) | EBI-21325777 | 0.35 |
Q01546 | Keratin, type II cytoskeletal 2 oral (Cytokeratin-2P) (CK-2P) (K2P) (Keratin-76) (K76) (Type-II keratin Kb9) | EBI-21325777 | 0.35 |
O95678 | Keratin, type II cytoskeletal 75 (Cytokeratin-75) (CK-75) (Keratin-6 hair follicle) (hK6hf) (Keratin-75) (K75) (Type II keratin-K6hf) (Type-II keratin Kb18) | EBI-21325777 | 0.35 |
Q3SY84 | Keratin, type II cytoskeletal 71 (Cytokeratin-71) (CK-71) (Keratin-71) (K71) (Type II inner root sheath-specific keratin-K6irs1) (Keratin 6 irs) (hK6irs) (hK6irs1) (Type-II keratin Kb34) | EBI-21325777 | 0.35 |
P48668 | Keratin, type II cytoskeletal 6C (Cytokeratin-6C) (CK-6C) (Cytokeratin-6E) (CK-6E) (Keratin K6h) (Keratin-6C) (K6C) (Type-II keratin Kb12) | EBI-21325777 | 0.35 |
P04259 | Keratin, type II cytoskeletal 6B (Cytokeratin-6B) (CK-6B) (Keratin-6B) (K6B) (Type-II keratin Kb10) | EBI-21325777 | 0.35 |
P02538 | Keratin, type II cytoskeletal 6A (Cytokeratin-6A) (CK-6A) (Cytokeratin-6D) (CK-6D) (Keratin-6A) (K6A) (Type-II keratin Kb6) (allergen Hom s 5) | EBI-21325777 | 0.35 |
P13647 | Keratin, type II cytoskeletal 5 (58 kDa cytokeratin) (Cytokeratin-5) (CK-5) (Keratin-5) (K5) (Type-II keratin Kb5) | EBI-21325777 | 0.35 |
P12035 | Keratin, type II cytoskeletal 3 (65 kDa cytokeratin) (Cytokeratin-3) (CK-3) (Keratin-3) (K3) (Type-II keratin Kb3) | EBI-21325777 | 0.35 |
Q2M2I5 | Keratin, type I cytoskeletal 24 (Cytokeratin-24) (CK-24) (Keratin-24) (K24) (Type I keratin-24) | EBI-21325777 | 0.35 |
P35908 | Keratin, type II cytoskeletal 2 epidermal (Cytokeratin-2e) (CK-2e) (Epithelial keratin-2e) (Keratin-2 epidermis) (Keratin-2e) (K2e) (Type-II keratin Kb2) | EBI-21325777 | 0.35 |
Q04695 | Keratin, type I cytoskeletal 17 (39.1) (Cytokeratin-17) (CK-17) (Keratin-17) (K17) | EBI-21325777 | 0.35 |
P08779 | Keratin, type I cytoskeletal 16 (Cytokeratin-16) (CK-16) (Keratin-16) (K16) | EBI-21325777 | 0.35 |
P02533 | Keratin, type I cytoskeletal 14 (Cytokeratin-14) (CK-14) (Keratin-14) (K14) | EBI-21325777 | 0.35 |
P13646 | Keratin, type I cytoskeletal 13 (Cytokeratin-13) (CK-13) (Keratin-13) (K13) | EBI-21325777 | 0.35 |
P13645 | Keratin, type I cytoskeletal 10 (Cytokeratin-10) (CK-10) (Keratin-10) (K10) | EBI-21325777 | 0.35 |
P04264 | Keratin, type II cytoskeletal 1 (67 kDa cytokeratin) (Cytokeratin-1) (CK-1) (Hair alpha protein) (Keratin-1) (K1) (Type-II keratin Kb1) | EBI-21325777 | 0.35 |
P52294 | Importin subunit alpha-5 (Karyopherin subunit alpha-1) (Nucleoprotein interactor 1) (NPI-1) (RAG cohort protein 2) (SRP1-beta) [Cleaved into: Importin subunit alpha-5, N-terminally processed] | EBI-21325777 | 0.35 |
Q9P2G9 | Kelch-like protein 8 | EBI-21325777 | 0.35 |
Q53HC5 | Kelch-like protein 26 | EBI-21325777 | 0.35 |
Q8NBE8 | Kelch-like protein 23 | EBI-21325777 | 0.35 |
Q9UJP4 | Kelch-like protein 21 | EBI-21325777 | 0.35 |
Q53G59 | Kelch-like protein 12 (CUL3-interacting protein 1) (DKIR homolog) (hDKIR) | EBI-21325777 | 0.35 |
Q8N163 | Cell cycle and apoptosis regulator protein 2 (Cell division cycle and apoptosis regulator protein 2) (DBIRD complex subunit KIAA1967) (Deleted in breast cancer gene 1 protein) (DBC-1) (DBC.1) (NET35) (p30 DBC) | EBI-21325777 | 0.35 |
Q9C0C6 | CLOCK-interacting pacemaker (CLOCK-interacting circadian protein) | EBI-21325777 | 0.53 |
Q92945 | Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH type-splicing regulatory protein) (KSRP) (p75) | EBI-21325777 | 0.35 |
P50053 | Ketohexokinase (EC 2.7.1.3) (Hepatic fructokinase) | EBI-21325777 | 0.35 |
Q8NC69 | BTB/POZ domain-containing protein KCTD6 (KCASH3 protein) (Potassium channel tetramerization domain-containing protein 6) | EBI-21325777 | 0.35 |
Q9Y597 | BTB/POZ domain-containing protein KCTD3 (Renal carcinoma antigen NY-REN-45) | EBI-21325777 | 0.35 |
Q6PI47 | BTB/POZ domain-containing protein KCTD18 | EBI-21325777 | 0.35 |
Q9H3F6 | BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3 (hBACURD3) (BTB/POZ domain-containing protein KCTD10) (Potassium channel tetramerization domain-containing protein 10) | EBI-21325777 | 0.35 |
Q86V97 | Kelch repeat and BTB domain-containing protein 6 | EBI-21325777 | 0.35 |
Q9NVX7 | Kelch repeat and BTB domain-containing protein 4 (BTB and kelch domain-containing protein 4) | EBI-21325777 | 0.35 |
Q15046 | Lysine--tRNA ligase (EC 2.7.7.-) (EC 6.1.1.6) (Lysyl-tRNA synthetase) (LysRS) | EBI-21325777 | 0.35 |
P14923 | Junction plakoglobin (Catenin gamma) (Desmoplakin III) (Desmoplakin-3) | EBI-21325777 | 0.35 |
P17535 | Transcription factor JunD (Transcription factor AP-1 subunit JunD) | EBI-21325777 | 0.35 |
Q96A47 | Insulin gene enhancer protein ISL-2 (Islet-2) | EBI-21325777 | 0.35 |
P61371 | Insulin gene enhancer protein ISL-1 (Islet-1) | EBI-21325777 | 0.35 |
O14654 | Insulin receptor substrate 4 (IRS-4) (160 kDa phosphotyrosine protein) (py160) (Phosphoprotein of 160 kDa) (pp160) | EBI-21325777 | 0.35 |
P12268 | Inosine-5'-monophosphate dehydrogenase 2 (IMP dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205) (Inosine-5'-monophosphate dehydrogenase type II) (IMP dehydrogenase II) (IMPDH-II) | EBI-21325777 | 0.35 |
Q12906 | Interleukin enhancer-binding factor 3 (Double-stranded RNA-binding protein 76) (DRBP76) (M-phase phosphoprotein 4) (MPP4) (Nuclear factor associated with dsRNA) (NFAR) (Nuclear factor of activated T-cells 90 kDa) (NF-AT-90) (Translational control protein 80) (TCP80) | EBI-21325777 | 0.35 |
Q12905 | Interleukin enhancer-binding factor 2 (Nuclear factor of activated T-cells 45 kDa) | EBI-21325777 | 0.35 |
O00425 | Insulin-like growth factor 2 mRNA-binding protein 3 (IGF2 mRNA-binding protein 3) (IMP-3) (IGF-II mRNA-binding protein 3) (KH domain-containing protein overexpressed in cancer) (hKOC) (VICKZ family member 3) | EBI-21325777 | 0.35 |
P41252 | Isoleucine--tRNA ligase, cytoplasmic (EC 6.1.1.5) (Isoleucyl-tRNA synthetase) (IRS) (IleRS) | EBI-21325777 | 0.35 |
P10809 | 60 kDa heat shock protein, mitochondrial (EC 5.6.1.7) (60 kDa chaperonin) (Chaperonin 60) (CPN60) (Heat shock protein 60) (HSP-60) (Hsp60) (HuCHA60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein) | EBI-21325777 | 0.35 |
P04792 | Heat shock protein beta-1 (HspB1) (28 kDa heat shock protein) (Estrogen-regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP 27) (Stress-responsive protein 27) (SRP27) | EBI-21325777 | 0.35 |
P38646 | Stress-70 protein, mitochondrial (75 kDa glucose-regulated protein) (GRP-75) (Heat shock 70 kDa protein 9) (Mortalin) (MOT) (Peptide-binding protein 74) (PBP74) | EBI-21325777 | 0.35 |
P11142 | Heat shock cognate 71 kDa protein (EC 3.6.4.10) (Heat shock 70 kDa protein 8) (Lipopolysaccharide-associated protein 1) (LAP-1) (LPS-associated protein 1) | EBI-21325777 | 0.35 |
P34932 | Heat shock 70 kDa protein 4 (HSP70RY) (Heat shock 70-related protein APG-2) | EBI-21325777 | 0.35 |
P14625 | Endoplasmin (94 kDa glucose-regulated protein) (GRP-94) (Heat shock protein 90 kDa beta member 1) (Tumor rejection antigen 1) (gp96 homolog) | EBI-21325777 | 0.35 |
Q58FF8 | Putative heat shock protein HSP 90-beta 2 (Heat shock protein 90-beta b) (Heat shock protein 90Bb) | EBI-21325777 | 0.35 |
Q14568 | Heat shock protein HSP 90-alpha A2 (Heat shock 90 kDa protein 1 alpha-like 3) (Heat shock protein HSP 90-alpha A2 pseudogene) | EBI-21325777 | 0.35 |
P07900 | Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38) | EBI-21325777 | 0.35 |
Q99714 | 3-hydroxyacyl-CoA dehydrogenase type-2 (EC 1.1.1.35) (17-beta-estradiol 17-dehydrogenase) (EC 1.1.1.62) (2-methyl-3-hydroxybutyryl-CoA dehydrogenase) (MHBD) (3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+))) (EC 1.1.1.239) (3-hydroxy-2-methylbutyryl-CoA dehydrogenase) (EC 1.1.1.178) (3-hydroxyacyl-CoA dehydrogenase type II) (3alpha(or 20beta)-hydroxysteroid dehydrogenase) (EC 1.1.1.53) (7-alpha-hydroxysteroid dehydrogenase) (EC 1.1.1.159) (Endoplasmic reticulum-associated amyloid beta-peptide-binding protein) (Mitochondrial ribonuclease P protein 2) (Mitochondrial RNase P protein 2) (Short chain dehydrogenase/reductase family 5C member 1) (Short-chain type dehydrogenase/reductase XH98G2) (Type II HADH) | EBI-21325777 | 0.35 |
Q7Z5J1 | Hydroxysteroid 11-beta-dehydrogenase 1-like protein (EC 1.1.1.-) (11-beta-hydroxysteroid dehydrogenase type 3) (11-DH3) (11-beta-HSD3) (Short chain dehydrogenase/reductase family 26C member 2) (Short-chain dehydrogenase/reductase 10) | EBI-21325777 | 0.35 |
Q86YZ3 | Hornerin | EBI-21325777 | 0.35 |
P31260 | Homeobox protein Hox-A10 (Homeobox protein Hox-1.8) (Homeobox protein Hox-1H) (PL) | EBI-21325777 | 0.35 |
O14979 | Heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like) (hnRNP DL) (AU-rich element RNA-binding factor) (JKT41-binding protein) (Protein laAUF1) | EBI-21325777 | 0.35 |
Q1KMD3 | Heterogeneous nuclear ribonucleoprotein U-like protein 2 (Scaffold-attachment factor A2) (SAF-A2) | EBI-21325777 | 0.35 |
Q9BUJ2 | Heterogeneous nuclear ribonucleoprotein U-like protein 1 (Adenovirus early region 1B-associated protein 5) (E1B-55 kDa-associated protein 5) (E1B-AP5) | EBI-21325777 | 0.35 |
Q00839 | Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (GRIP120) (Nuclear p120 ribonucleoprotein) (Scaffold-attachment factor A) (SAF-A) (p120) (pp120) | EBI-21325777 | 0.35 |
O43390 | Heterogeneous nuclear ribonucleoprotein R (hnRNP R) | EBI-21325777 | 0.35 |
P52272 | Heterogeneous nuclear ribonucleoprotein M (hnRNP M) | EBI-21325777 | 0.35 |
P14866 | Heterogeneous nuclear ribonucleoprotein L (hnRNP L) | EBI-21325777 | 0.35 |
P61978 | Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (Transformation up-regulated nuclear protein) (TUNP) | EBI-21325777 | 0.35 |
P31942 | Heterogeneous nuclear ribonucleoprotein H3 (hnRNP H3) (Heterogeneous nuclear ribonucleoprotein 2H9) (hnRNP 2H9) | EBI-21325777 | 0.35 |
P31943 | Heterogeneous nuclear ribonucleoprotein H (hnRNP H) [Cleaved into: Heterogeneous nuclear ribonucleoprotein H, N-terminally processed] | EBI-21325777 | 0.35 |
P52597 | Heterogeneous nuclear ribonucleoprotein F (hnRNP F) (Nucleolin-like protein mcs94-1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein F, N-terminally processed] | EBI-21325777 | 0.35 |
Q14103 | Heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) (AU-rich element RNA-binding protein 1) | EBI-21325777 | 0.35 |
O60812 | Heterogeneous nuclear ribonucleoprotein C-like 1 (hnRNP C-like-1) (hnRNP core protein C-like 1) | EBI-21325777 | 0.35 |
P07910 | Heterogeneous nuclear ribonucleoproteins C1/C2 (hnRNP C1/C2) | EBI-21325777 | 0.35 |
Q99729 | Heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) (APOBEC1-binding protein 1) (ABBP-1) | EBI-21325777 | 0.35 |
P51991 | Heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) | EBI-21325777 | 0.35 |
P22626 | Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1) | EBI-21325777 | 0.35 |
P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed] | EBI-21325777 | 0.35 |
Q13151 | Heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) | EBI-21325777 | 0.35 |
Q16778 | Histone H2B type 2-E (H2B-clustered histone 21) (Histone H2B-GL105) (Histone H2B.q) (H2B/q) | EBI-21325777 | 0.35 |
P16403 | Histone H1.2 (Histone H1c) (Histone H1d) (Histone H1s-1) | EBI-21325777 | 0.35 |
Q00341 | Vigilin (High density lipoprotein-binding protein) (HDL-binding protein) | EBI-21325777 | 0.35 |
O14929 | Histone acetyltransferase type B catalytic subunit (EC 2.3.1.48) (Histone acetyltransferase 1) | EBI-21325777 | 0.35 |
P13807 | Glycogen [starch] synthase, muscle (EC 2.4.1.11) | EBI-21325777 | 0.35 |
Q7Z2Y8 | Interferon-induced very large GTPase 1 (Interferon-induced very large GTPase pseudogene 1) | EBI-21325777 | 0.35 |
Q9BZE4 | GTP-binding protein 4 (Chronic renal failure gene protein) (GTP-binding protein NGB) (Nucleolar GTP-binding protein 1) | EBI-21325777 | 0.35 |
O00178 | GTP-binding protein 1 (G-protein 1) (GP-1) (GP1) | EBI-21325777 | 0.35 |
P09211 | Glutathione S-transferase P (EC 2.5.1.18) (GST class-pi) (GSTP1-1) | EBI-21325777 | 0.35 |
Q9BQ67 | Glutamate-rich WD repeat-containing protein 1 | EBI-21325777 | 0.35 |
Q9BVP2 | Guanine nucleotide-binding protein-like 3 (E2-induced gene 3 protein) (Novel nucleolar protein 47) (NNP47) (Nucleolar GTP-binding protein 3) (Nucleostemin) | EBI-21325777 | 0.35 |
Q92820 | Gamma-glutamyl hydrolase (EC 3.4.19.9) (Conjugase) (GH) (Gamma-Glu-X carboxypeptidase) | EBI-21325777 | 0.35 |
Q8IUC8 | Polypeptide N-acetylgalactosaminyltransferase 13 (EC 2.4.1.41) (Polypeptide GalNAc transferase 13) (GalNAc-T13) (pp-GaNTase 13) (Protein-UDP acetylgalactosaminyltransferase 13) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13) | EBI-21325777 | 0.35 |
Q8TAE8 | Growth arrest and DNA damage-inducible proteins-interacting protein 1 (39S ribosomal protein L59, mitochondrial) (MRP-L59) (CKII beta-associating protein) (CR6-interacting factor 1) (CRIF1) (Mitochondrial large ribosomal subunit protein mL64) (Papillomavirus L2-interacting nuclear protein 1) (PLINP) (PLINP-1) (p53-responsive gene 6 protein) | EBI-21325777 | 0.35 |
Q9UN86 | Ras GTPase-activating protein-binding protein 2 (G3BP-2) (GAP SH3 domain-binding protein 2) | EBI-21325777 | 0.35 |
Q13283 | Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1) | EBI-21325777 | 0.35 |
P51114 | RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p) | EBI-21325777 | 0.35 |
P35637 | RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) | EBI-21325777 | 0.35 |
Q96I24 | Far upstream element-binding protein 3 (FUSE-binding protein 3) | EBI-21325777 | 0.35 |
Q96AE4 | Far upstream element-binding protein 1 (FBP) (FUSE-binding protein 1) (DNA helicase V) (hDH V) | EBI-21325777 | 0.35 |
Q8IY81 | pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 (EC 2.1.1.-) (Protein ftsJ homolog 3) (Putative rRNA methyltransferase 3) | EBI-21325777 | 0.35 |
Q5D862 | Filaggrin-2 (FLG-2) (Intermediate filament-associated and psoriasis-susceptibility protein) (Ifapsoriasin) | EBI-21325777 | 0.35 |
Q6UN15 | Pre-mRNA 3'-end-processing factor FIP1 (hFip1) (FIP1-like 1 protein) (Factor interacting with PAP) (Rearranged in hypereosinophilia) | EBI-21325777 | 0.35 |
Q5HY92 | Fidgetin | EBI-21325777 | 0.35 |
Q96JP0 | Protein fem-1 homolog C (FEM1c) (FEM1-gamma) | EBI-21325777 | 0.35 |
Q9UK73 | Protein fem-1 homolog B (FEM1b) (FEM1-beta) (Fem-1-like death receptor-binding protein alpha) (Fem-1-like in apoptotic pathway protein alpha) (F1A-alpha) | EBI-21325777 | 0.35 |
P22830 | Ferrochelatase, mitochondrial (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) | EBI-21325777 | 0.35 |
Q5XUX1 | F-box/WD repeat-containing protein 9 (F-box and WD-40 domain-containing protein 9) | EBI-21325777 | 0.35 |
Q9UKB1 | F-box/WD repeat-containing protein 11 (F-box and WD repeats protein beta-TrCP2) (F-box/WD repeat-containing protein 1B) (Homologous to Slimb protein) (HOS) | EBI-21325777 | 0.35 |
Q9UK97 | F-box only protein 9 (Cross-immune reaction antigen 1) (Renal carcinoma antigen NY-REN-57) | EBI-21325777 | 0.35 |
Q9Y3I1 | F-box only protein 7 | EBI-21325777 | 0.53 |
Q9H4M3 | F-box only protein 44 (F-box protein FBX30) (F-box/G-domain protein 3) | EBI-21325777 | 0.35 |
Q5XUX0 | F-box only protein 31 | EBI-21325777 | 0.35 |
Q9UK99 | F-box only protein 3 | EBI-21325777 | 0.35 |
O94952 | F-box only protein 21 | EBI-21325777 | 0.35 |
A6NHQ2 | rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1 (EC 2.1.1.-) (Protein-glutamine methyltransferase) | EBI-21325777 | 0.35 |
P62861 | FAU ubiquitin-like and ribosomal protein S30 [Cleaved into: Ubiquitin-like protein FUBI; 40S ribosomal protein S30 (Small ribosomal subunit protein eS30)] | EBI-21325777 | 0.35 |
Q52LJ0 | Protein FAM98B | EBI-21325777 | 0.35 |
Q8NCA5 | Protein FAM98A | EBI-21325777 | 0.35 |
Q6ZRV2 | Protein FAM83H | EBI-21325777 | 0.35 |
Q9NRY5 | Protein FAM114A2 | EBI-21325777 | 0.35 |
Q9BTL3 | RNA guanine-N7 methyltransferase activating subunit (Protein FAM103A1) (RNA guanine-7 methyltransferase activating subunit) (RNMT-activating mRNA cap methyltransferase subunit) (RNMT-activating mini protein) (RAM) | EBI-21325777 | 0.35 |
Q06265 | Exosome complex component RRP45 (Autoantigen PM/Scl 1) (Exosome component 9) (P75 polymyositis-scleroderma overlap syndrome-associated autoantigen) (Polymyositis/scleroderma autoantigen 1) (Polymyositis/scleroderma autoantigen 75 kDa) (PM/Scl-75) | EBI-21325777 | 0.35 |
Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | EBI-21325777 | 0.35 |
P07814 | Bifunctional glutamate/proline--tRNA ligase (Bifunctional aminoacyl-tRNA synthetase) (Cell proliferation-inducing gene 32 protein) (Glutamatyl-prolyl-tRNA synthetase) [Includes: Glutamate--tRNA ligase (EC 6.1.1.17) (Glutamyl-tRNA synthetase) (GluRS); Proline--tRNA ligase (EC 6.1.1.15) (Prolyl-tRNA synthetase)] | EBI-21325777 | 0.35 |
P06733 | Alpha-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (C-myc promoter-binding protein) (Enolase 1) (MBP-1) (MPB-1) (Non-neural enolase) (NNE) (Phosphopyruvate hydratase) (Plasminogen-binding protein) | EBI-21325777 | 0.35 |
Q15717 | ELAV-like protein 1 (Hu-antigen R) (HuR) | EBI-21325777 | 0.35 |
Q9BQ52 | Zinc phosphodiesterase ELAC protein 2 (EC 3.1.26.11) (ElaC homolog protein 2) (Heredity prostate cancer protein 2) (Ribonuclease Z 2) (RNase Z 2) (tRNA 3 endonuclease 2) (tRNase Z 2) | EBI-21325777 | 0.35 |
P63241 | Eukaryotic translation initiation factor 5A-1 (eIF-5A-1) (eIF-5A1) (Eukaryotic initiation factor 5A isoform 1) (eIF-5A) (Rev-binding factor) (eIF-4D) | EBI-21325777 | 0.35 |
P05198 | Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 subunit alpha) (eIF-2-alpha) (eIF-2A) (eIF-2alpha) | EBI-21325777 | 0.35 |
Q8NDI1 | EH domain-binding protein 1 | EBI-21325777 | 0.35 |
Q15029 | 116 kDa U5 small nuclear ribonucleoprotein component (Elongation factor Tu GTP-binding domain-containing protein 2) (SNU114 homolog) (hSNU114) (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa) | EBI-21325777 | 0.35 |
Q8IYU8 | Calcium uptake protein 2, mitochondrial (EF-hand domain-containing family member A1) | EBI-21325777 | 0.35 |
P13639 | Elongation factor 2 (EF-2) | EBI-21325777 | 0.35 |
P26641 | Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) | EBI-21325777 | 0.35 |
Q05639 | Elongation factor 1-alpha 2 (EF-1-alpha-2) (Eukaryotic elongation factor 1 A-2) (eEF1A-2) (Statin-S1) | EBI-21325777 | 0.35 |
P68104 | Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor Tu) (EF-Tu) (Eukaryotic elongation factor 1 A-1) (eEF1A-1) (Leukocyte receptor cluster member 7) | EBI-21325777 | 0.35 |
Q19T08 | Endothelial cell-specific chemotaxis regulator (Apoptosis regulator through modulating IAP expression) (ARIA) (Endothelial cell-specific molecule 2) | EBI-21325777 | 0.35 |
Q99848 | Probable rRNA-processing protein EBP2 (EBNA1-binding protein 2) (Nucleolar protein p40) | EBI-21325777 | 0.35 |
Q14204 | Cytoplasmic dynein 1 heavy chain 1 (Cytoplasmic dynein heavy chain 1) (Dynein heavy chain, cytosolic) | EBI-21325777 | 0.35 |
Q9BVJ7 | Dual specificity protein phosphatase 23 (EC 3.1.3.16) (EC 3.1.3.48) (Low molecular mass dual specificity phosphatase 3) (LDP-3) (VH1-like phosphatase Z) | EBI-21325777 | 0.35 |
P15924 | Desmoplakin (DP) (250/210 kDa paraneoplastic pemphigus antigen) | EBI-21325777 | 0.35 |
Q02413 | Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) | EBI-21325777 | 0.35 |
Q92785 | Zinc finger protein ubi-d4 (Apoptosis response zinc finger protein) (BRG1-associated factor 45D) (BAF45D) (D4, zinc and double PHD fingers family 2) (Protein requiem) | EBI-21325777 | 0.35 |
O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | EBI-21325777 | 0.35 |
Q8WXX5 | DnaJ homolog subfamily C member 9 (HDJC9) (DnaJ protein SB73) | EBI-21325777 | 0.35 |
Q8IXB1 | DnaJ homolog subfamily C member 10 (EC 1.8.4.-) (Endoplasmic reticulum DNA J domain-containing protein 5) (ER-resident protein ERdj5) (ERdj5) (Macrothioredoxin) (MTHr) | EBI-21325777 | 0.35 |
O60884 | DnaJ homolog subfamily A member 2 (Cell cycle progression restoration gene 3 protein) (Dnj3) (Dj3) (HIRA-interacting protein 4) (Renal carcinoma antigen NY-REN-14) | EBI-21325777 | 0.35 |
Q9P225 | Dynein axonemal heavy chain 2 (Axonemal beta dynein heavy chain 2) (Ciliary dynein heavy chain 2) (Dynein heavy chain domain-containing protein 3) | EBI-21325777 | 0.35 |
P10515 | Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (EC 2.3.1.12) (70 kDa mitochondrial autoantigen of primary biliary cirrhosis) (PBC) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) (M2 antigen complex 70 kDa subunit) (Pyruvate dehydrogenase complex component E2) (PDC-E2) (PDCE2) | EBI-21325777 | 0.35 |
Q08211 | ATP-dependent RNA helicase A (EC 3.6.4.13) (DEAH box protein 9) (DExH-box helicase 9) (Leukophysin) (LKP) (Nuclear DNA helicase II) (NDH II) (RNA helicase A) | EBI-21325777 | 0.35 |
Q6P158 | Putative ATP-dependent RNA helicase DHX57 (EC 3.6.4.13) (DEAH box protein 57) | EBI-21325777 | 0.35 |
Q9H2U1 | ATP-dependent DNA/RNA helicase DHX36 (EC 3.6.4.12) (EC 3.6.4.13) (DEAD/H box polypeptide 36) (DEAH-box protein 36) (G4-resolvase-1) (G4R1) (MLE-like protein 1) (RNA helicase associated with AU-rich element protein) | EBI-21325777 | 0.35 |
Q7L2E3 | ATP-dependent RNA helicase DHX30 (EC 3.6.4.13) (DEAH box protein 30) | EBI-21325777 | 0.35 |
Q7Z478 | ATP-dependent RNA helicase DHX29 (EC 3.6.4.13) (DEAH box protein 29) (Nucleic acid helicase DDXx) | EBI-21325777 | 0.35 |
O43143 | ATP-dependent RNA helicase DHX15 (EC 3.6.4.13) (ATP-dependent RNA helicase #46) (DEAH box protein 15) (Splicing factor Prp43) (hPrp43) | EBI-21325777 | 0.35 |
P35659 | Protein DEK | EBI-21325777 | 0.35 |
Q9H1M4 | Beta-defensin 127 (Beta-defensin 27) (DEFB-27) (Defensin, beta 127) | EBI-21325777 | 0.35 |
P26196 | Probable ATP-dependent RNA helicase DDX6 (EC 3.6.4.13) (ATP-dependent RNA helicase p54) (DEAD box protein 6) (Oncogene RCK) | EBI-21325777 | 0.35 |
Q9Y2R4 | Probable ATP-dependent RNA helicase DDX52 (EC 3.6.4.13) (ATP-dependent RNA helicase ROK1-like) (DEAD box protein 52) | EBI-21325777 | 0.35 |
P17844 | Probable ATP-dependent RNA helicase DDX5 (EC 3.6.4.13) (DEAD box protein 5) (RNA helicase p68) | EBI-21325777 | 0.35 |
O00571 | ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3, X-chromosomal) (DEAD box, X isoform) (DBX) (Helicase-like protein 2) (HLP2) | EBI-21325777 | 0.35 |
Q9NY93 | Probable ATP-dependent RNA helicase DDX56 (EC 3.6.4.13) (ATP-dependent 61 kDa nucleolar RNA helicase) (DEAD box protein 21) (DEAD box protein 56) | EBI-21325777 | 0.35 |
Q9UHI6 | Probable ATP-dependent RNA helicase DDX20 (EC 3.6.1.15) (EC 3.6.4.13) (Component of gems 3) (DEAD box protein 20) (DEAD box protein DP 103) (Gemin-3) | EBI-21325777 | 0.35 |
Q9UMR2 | ATP-dependent RNA helicase DDX19B (EC 3.6.4.13) (DEAD box RNA helicase DEAD5) (DEAD box protein 19B) | EBI-21325777 | 0.35 |
Q9NVP1 | ATP-dependent RNA helicase DDX18 (EC 3.6.4.13) (DEAD box protein 18) (Myc-regulated DEAD box protein) (MrDb) | EBI-21325777 | 0.35 |
Q92841 | Probable ATP-dependent RNA helicase DDX17 (EC 3.6.4.13) (DEAD box protein 17) (DEAD box protein p72) (DEAD box protein p82) (RNA-dependent helicase p72) | EBI-21325777 | 0.35 |
Q92499 | ATP-dependent RNA helicase DDX1 (EC 3.6.4.13) (DEAD box protein 1) (DEAD box protein retinoblastoma) (DBP-RB) | EBI-21325777 | 0.35 |
Q9BW61 | DET1- and DDB1-associated protein 1 (Placenta cross-immune reaction antigen 1) (PCIA-1) | EBI-21325777 | 0.35 |
Q6V1P9 | Protocadherin-23 (Cadherin-27) (Cadherin-like protein CDHJ) (Cadherin-like protein VR8) (Protein dachsous homolog 2) (Protocadherin PCDHJ) | EBI-21325777 | 0.35 |
P81605 | Dermcidin (EC 3.4.-.-) (Preproteolysin) [Cleaved into: Survival-promoting peptide; DCD-1] | EBI-21325777 | 0.35 |
Q96EP5 | DAZ-associated protein 1 (Deleted in azoospermia-associated protein 1) | EBI-21325777 | 0.35 |
O95886 | Disks large-associated protein 3 (DAP-3) (PSD-95/SAP90-binding protein 3) (SAP90/PSD-95-associated protein 3) (SAPAP3) | EBI-21325777 | 0.35 |
P19875 | C-X-C motif chemokine 2 (Growth-regulated protein beta) (Gro-beta) (Macrophage inflammatory protein 2-alpha) (MIP2-alpha) [Cleaved into: GRO-beta(5-73) (GRO-beta-T) (Hematopoietic synergistic factor) (HSF) (SB-251353)] | EBI-21325777 | 0.35 |
Q93034 | Cullin-5 (CUL-5) (Vasopressin-activated calcium-mobilizing receptor 1) (VACM-1) | EBI-21325777 | 0.35 |
P17812 | CTP synthase 1 (EC 6.3.4.2) (CTP synthetase 1) (UTP--ammonia ligase 1) | EBI-21325777 | 0.35 |
P35221 | Catenin alpha-1 (Alpha E-catenin) (Cadherin-associated protein) (Renal carcinoma antigen NY-REN-13) | EBI-21325777 | 0.35 |
O75534 | Cold shock domain-containing protein E1 (N-ras upstream gene protein) (Protein UNR) | EBI-21325777 | 0.35 |
P16989 | Y-box-binding protein 3 (Cold shock domain-containing protein A) (DNA-binding protein A) (Single-strand DNA-binding protein NF-GMB) | EBI-21325777 | 0.35 |
O95232 | Luc7-like protein 3 (Cisplatin resistance-associated-overexpressed protein) (Luc7A) (Okadaic acid-inducible phosphoprotein OA48-18) (cAMP regulatory element-associated protein 1) (CRE-associated protein 1) (CREAP-1) | EBI-21325777 | 0.35 |
Q96SW2 | Protein cereblon | EBI-21325777 | 0.53 |
Q9UBL6 | Copine-7 (Copine VII) | EBI-21325777 | 0.35 |
Q8IWV2 | Contactin-4 (Brain-derived immunoglobulin superfamily protein 2) (BIG-2) | EBI-21325777 | 0.35 |
P53675 | Clathrin heavy chain 2 (Clathrin heavy chain on chromosome 22) (CLH-22) | EBI-21325777 | 0.35 |
Q00610 | Clathrin heavy chain 1 (Clathrin heavy chain on chromosome 17) (CLH-17) | EBI-21325777 | 0.35 |
P09496 | Clathrin light chain A (Lca) | EBI-21325777 | 0.35 |
P61024 | Cyclin-dependent kinases regulatory subunit 1 (CKS-1) | EBI-21325777 | 0.35 |
O14757 | Serine/threonine-protein kinase Chk1 (EC 2.7.11.1) (CHK1 checkpoint homolog) (Cell cycle checkpoint kinase) (Checkpoint kinase-1) | EBI-21325777 | 0.35 |
Q00526 | Cyclin-dependent kinase 3 (EC 2.7.11.22) (Cell division protein kinase 3) | EBI-21325777 | 0.35 |
P24941 | Cyclin-dependent kinase 2 (EC 2.7.11.22) (Cell division protein kinase 2) (p33 protein kinase) | EBI-21325777 | 0.35 |
Q12834 | Cell division cycle protein 20 homolog (p55CDC) | EBI-21325777 | 0.35 |
P06493 | Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase) | EBI-21325777 | 0.35 |
P50990 | T-complex protein 1 subunit theta (TCP-1-theta) (CCT-theta) (Chaperonin containing T-complex polypeptide 1 subunit 8) (Renal carcinoma antigen NY-REN-15) | EBI-21325777 | 0.35 |
P78371 | T-complex protein 1 subunit beta (TCP-1-beta) (CCT-beta) | EBI-21325777 | 0.35 |
Q9ULG6 | Cell cycle progression protein 1 (Cell cycle progression restoration protein 8) | EBI-21325777 | 0.35 |
P20248 | Cyclin-A2 (Cyclin-A) (Cyclin A) | EBI-21325777 | 0.35 |
P78396 | Cyclin-A1 | EBI-21325777 | 0.35 |
Q96A33 | PAT complex subunit CCDC47 (Calumin) (Coiled-coil domain-containing protein 47) | EBI-21325777 | 0.35 |
Q6YP21 | Kynurenine--oxoglutarate transaminase 3 (EC 2.6.1.7) (Cysteine-S-conjugate beta-lyase 2) (EC 4.4.1.13) (Kynurenine aminotransferase 3) (Kynurenine aminotransferase III) (KATIII) (Kynurenine--glyoxylate transaminase) (EC 2.6.1.63) (Kynurenine--oxoglutarate transaminase III) | EBI-21325777 | 0.35 |
P16152 | Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (15-hydroxyprostaglandin dehydrogenase [NADP(+)]) (EC 1.1.1.196, EC 1.1.1.197) (20-beta-hydroxysteroid dehydrogenase) (Alcohol dehydrogenase [NAD(P)+] CBR1) (EC 1.1.1.71) (NADPH-dependent carbonyl reductase 1) (Prostaglandin 9-ketoreductase) (PG-9-KR) (Prostaglandin-E(2) 9-reductase) (EC 1.1.1.189) (Short chain dehydrogenase/reductase family 21C member 1) | EBI-21325777 | 0.35 |
Q86X55 | Histone-arginine methyltransferase CARM1 (EC 2.1.1.319) (Coactivator-associated arginine methyltransferase 1) (Protein arginine N-methyltransferase 4) | EBI-21325777 | 0.35 |
Q14444 | Caprin-1 (Cell cycle-associated protein 1) (Cytoplasmic activation- and proliferation-associated protein 1) (GPI-anchored membrane protein 1) (GPI-anchored protein p137) (GPI-p137) (p137GPI) (Membrane component chromosome 11 surface marker 1) (RNA granule protein 105) | EBI-21325777 | 0.35 |
Q86VP6 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-21325777 | 0.35 |
Q8NCB2 | CaM kinase-like vesicle-associated protein | EBI-21325777 | 0.35 |
Q9NZT1 | Calmodulin-like protein 5 (Calmodulin-like skin protein) | EBI-21325777 | 0.35 |
Q05682 | Caldesmon (CDM) | EBI-21325777 | 0.35 |
Q9BRJ6 | Uncharacterized protein C7orf50 | EBI-21325777 | 0.35 |
Q9NRH1 | Protein YAE1 homolog (Yae1 domain-containing protein 1) | EBI-21325777 | 0.35 |
Q9NXF7 | DDB1- and CUL4-associated factor 16 | EBI-21325777 | 0.35 |
Q8N2C7 | Protein unc-80 homolog | EBI-21325777 | 0.35 |
Q9Y3I0 | RNA-splicing ligase RtcB homolog (EC 6.5.1.8) (3'-phosphate/5'-hydroxy nucleic acid ligase) | EBI-21325777 | 0.35 |
Q7Z2T5 | TRMT1-like protein (EC 2.1.1.-) | EBI-21325777 | 0.35 |
Q07021 | Complement component 1 Q subcomponent-binding protein, mitochondrial (ASF/SF2-associated protein p32) (Glycoprotein gC1qBP) (C1qBP) (Hyaluronan-binding protein 1) (Mitochondrial matrix protein p32) (gC1q-R protein) (p33) (SF2AP32) | EBI-21325777 | 0.35 |
Q9BRQ4 | Cilia- and flagella-associated protein 300 | EBI-21325777 | 0.35 |
Q5SWW7 | Uncharacterized protein C10orf55 | EBI-21325777 | 0.35 |
Q13895 | Bystin | EBI-21325777 | 0.35 |
O43684 | Mitotic checkpoint protein BUB3 | EBI-21325777 | 0.35 |
Q96Q07 | BTB/POZ domain-containing protein 9 | EBI-21325777 | 0.35 |
Q9H0C5 | BTB/POZ domain-containing protein 1 (Hepatitis C virus NS5A-transactivated protein 8) (HCV NS5A-transactivated protein 8) | EBI-21325777 | 0.53 |
Q9NSI6 | Bromodomain and WD repeat-containing protein 1 (WD repeat-containing protein 9) | EBI-21325777 | 0.35 |
Q13867 | Bleomycin hydrolase (BH) (BLM hydrolase) (BMH) (EC 3.4.22.40) | EBI-21325777 | 0.35 |
O95429 | BAG family molecular chaperone regulator 4 (BAG-4) (Bcl-2-associated athanogene 4) (Silencer of death domains) | EBI-21325777 | 0.35 |
P05023 | Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1) | EBI-21325777 | 0.35 |
P18846 | Cyclic AMP-dependent transcription factor ATF-1 (cAMP-dependent transcription factor ATF-1) (Activating transcription factor 1) (Protein TREB36) | EBI-21325777 | 0.35 |
P08243 | Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4) (Cell cycle control protein TS11) (Glutamine-dependent asparagine synthetase) | EBI-21325777 | 0.35 |
P05089 | Arginase-1 (EC 3.5.3.1) (Liver-type arginase) (Type I arginase) | EBI-21325777 | 0.35 |
Q10567 | AP-1 complex subunit beta-1 (Adaptor protein complex AP-1 subunit beta-1) (Adaptor-related protein complex 1 subunit beta-1) (Beta-1-adaptin) (Beta-adaptin 1) (Clathrin assembly protein complex 1 beta large chain) (Golgi adaptor HA1/AP1 adaptin beta subunit) | EBI-21325777 | 0.35 |
Q6UB98 | Ankyrin repeat domain-containing protein 12 (Ankyrin repeat-containing cofactor 2) (GAC-1 protein) | EBI-21325777 | 0.35 |
Q9UJX3 | Anaphase-promoting complex subunit 7 (APC7) (Cyclosome subunit 7) | EBI-21325777 | 0.35 |
Q9UJX6 | Anaphase-promoting complex subunit 2 (APC2) (Cyclosome subunit 2) | EBI-21325777 | 0.35 |
P23109 | AMP deaminase 1 (EC 3.5.4.6) (AMP deaminase isoform M) (Myoadenylate deaminase) | EBI-21325777 | 0.35 |
Q9C0C7 | Activating molecule in BECN1-regulated autophagy protein 1 (DDB1- and CUL4-associated factor 3) | EBI-21325777 | 0.35 |
P09972 | Fructose-bisphosphate aldolase C (EC 4.1.2.13) (Brain-type aldolase) | EBI-21325777 | 0.35 |
O43823 | A-kinase anchor protein 8 (AKAP-8) (A-kinase anchor protein 95 kDa) (AKAP 95) | EBI-21325777 | 0.35 |
Q12904 | Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (Multisynthase complex auxiliary component p43) [Cleaved into: Endothelial monocyte-activating polypeptide 2 (EMAP-2) (Endothelial monocyte-activating polypeptide II) (EMAP-II) (Small inducible cytokine subfamily E member 1)] | EBI-21325777 | 0.35 |
P23526 | Adenosylhomocysteinase (AdoHcyase) (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) | EBI-21325777 | 0.35 |
P35573 | Glycogen debranching enzyme (Glycogen debrancher) [Includes: 4-alpha-glucanotransferase (EC 2.4.1.25) (Oligo-1,4-1,4-glucantransferase); Amylo-alpha-1,6-glucosidase (Amylo-1,6-glucosidase) (EC 3.2.1.33) (Dextrin 6-alpha-D-glucosidase)] | EBI-21325777 | 0.35 |
P61163 | Alpha-centractin (Centractin) (ARP1) (Actin-RPV) (Centrosome-associated actin homolog) | EBI-21325777 | 0.35 |
Q562R1 | Beta-actin-like protein 2 (Kappa-actin) | EBI-21325777 | 0.35 |
P60709 | Actin, cytoplasmic 1 (EC 3.6.4.-) (Beta-actin) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed] | EBI-21325777 | 0.35 |
P62736 | Actin, aortic smooth muscle (EC 3.6.4.-) (Alpha-actin-2) (Cell growth-inhibiting gene 46 protein) [Cleaved into: Actin, aortic smooth muscle, intermediate form] | EBI-21325777 | 0.35 |
Q5FVE4 | Long-chain-fatty-acid--CoA ligase ACSBG2 (EC 6.2.1.3) (Acyl-CoA synthetase bubblegum family member 2) (Arachidonate--CoA ligase ACSBG2) (EC 6.2.1.15) (Bubblegum-related protein) (PRTD-NY3) | EBI-21325777 | 0.35 |
P24666 | Low molecular weight phosphotyrosine protein phosphatase (LMW-PTP) (LMW-PTPase) (EC 3.1.3.48) (Adipocyte acid phosphatase) (Low molecular weight cytosolic acid phosphatase) (EC 3.1.3.2) (Red cell acid phosphatase 1) | EBI-21325777 | 0.35 |
P35610 | Sterol O-acyltransferase 1 (EC 2.3.1.26) (Acyl-coenzyme A:cholesterol acyltransferase 1) (ACAT-1) (Cholesterol acyltransferase 1) | EBI-21325777 | 0.35 |
Q8N961 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | EBI-21325777 | 0.35 |
Q8WWZ4 | ATP-binding cassette sub-family A member 10 (EC 7.6.2.-) | EBI-21325777 | 0.35 |
P35372 | Mu-type opioid receptor (M-OR-1) (MOR-1) (Mu opiate receptor) (Mu opioid receptor) (MOP) (hMOP) | EBI-6918514 | 0.58 |
P89884 | Apoptosis regulator Bcl-2 homolog (vBcl-2) (Protein M11) | EBI-9639873 | 0.37 |
O41946 | 30 protein (Uncharacterized protein GAMMAHV.ORF30) | EBI-9640254 | 0.37 |
P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11323169 | 0.35 |
O43172 | U4/U6 small nuclear ribonucleoprotein Prp4 (PRP4 homolog) (hPrp4) (U4/U6 snRNP 60 kDa protein) (WD splicing factor Prp4) | EBI-11043099 | 0.35 |
P04049 | RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (Proto-oncogene c-RAF) (cRaf) (Raf-1) | EBI-11084972 | 0.35 |
B2BTY8 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) | EBI-11510494 | 0.40 |
H9XIJ5 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-11514210 | 0.37 |
B4URF7 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-11514901 | 0.40 |
O60885 | Bromodomain-containing protein 4 (Protein HUNK1) | EBI-11773406 | 0.49 |
Q969Y2 | tRNA modification GTPase GTPBP3, mitochondrial (GTP-binding protein 3) (Mitochondrial GTP-binding protein 1) | EBI-24773699 | 0.56 |
P06929 | Protein E6 | EBI-26501685 | 0.37 |
P36799 | Protein E6 | EBI-26502049 | 0.37 |
P24830 | Regulatory protein E2 | EBI-16046619 | 0.37 |
P06423 | Regulatory protein E2 | EBI-16046569 | 0.37 |
P06790 | Regulatory protein E2 | EBI-16046534 | 0.37 |
P36780 | Regulatory protein E2 | EBI-16049148 | 0.00 |
Q8IWL3 | Iron-sulfur cluster co-chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial] | EBI-15104984 | 0.37 |
O95704 | Amyloid-beta A4 precursor protein-binding family B member 3 (Protein Fe65-like 2) (Fe65L2) | EBI-21591300 | 0.35 |
O43399 | Tumor protein D54 (hD54) (Tumor protein D52-like 2) | EBI-21732177 | 0.35 |
Q6JEL2 | Kelch-like protein 10 | EBI-21755575 | 0.35 |
O43583 | Density-regulated protein (DRP) (Protein DRP1) (Smooth muscle cell-associated protein 3) (SMAP-3) | EBI-21785701 | 0.35 |
P61081 | NEDD8-conjugating enzyme Ubc12 (EC 2.3.2.34) (NEDD8 carrier protein) (Ubiquitin-conjugating enzyme E2 M) | EBI-21805700 | 0.35 |
Q7L5Y6 | DET1 homolog (De-etiolated-1 homolog) | EBI-21846729 | 0.35 |
O14775 | Guanine nucleotide-binding protein subunit beta-5 (Gbeta5) (Transducin beta chain 5) | EBI-21871177 | 0.35 |
Q8TF40 | Folliculin-interacting protein 1 | EBI-21875885 | 0.35 |
O14879 | Interferon-induced protein with tetratricopeptide repeats 3 (IFIT-3) (CIG49) (ISG-60) (Interferon-induced 60 kDa protein) (IFI-60K) (Interferon-induced protein with tetratricopeptide repeats 4) (IFIT-4) (Retinoic acid-induced gene G protein) (P60) (RIG-G) | EBI-15606624 | 0.59 |
Q9NRI5 | Disrupted in schizophrenia 1 protein | EBI-21371075 | 0.00 |
Q92879 | CUGBP Elav-like family member 1 (CELF-1) (50 kDa nuclear polyadenylated RNA-binding protein) (Bruno-like protein 2) (CUG triplet repeat RNA-binding protein 1) (CUG-BP1) (CUG-BP- and ETR-3-like factor 1) (Deadenylation factor CUG-BP) (Embryo deadenylation element-binding protein homolog) (EDEN-BP homolog) (RNA-binding protein BRUNOL-2) | EBI-21371061 | 0.00 |
P05067 | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] | EBI-21371087 | 0.00 |
P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | EBI-21371101 | 0.00 |
O84326 | Transmembrane protein | EBI-22302779 | 0.40 |
Q15831 | Serine/threonine-protein kinase STK11 (EC 2.7.11.1) (Liver kinase B1) (LKB1) (hLKB1) (Renal carcinoma antigen NY-REN-19) | EBI-34582140 | 0.35 |
Database | Links |
UNIPROT | Q92905 O15386 Q6AW95 Q86WQ4 Q9BQ17 |
PDB | 4D10 4D18 4F7O 4WSN 5JOG 5JOH 5M5Q 6R6H 6R7F 6R7H 6R7I |
Pfam | PF18323 PF01398 |
PROSITE | PS50249 |
OMIM | 604850 |
DisGeNET | 10987 |