Nucleoporin SEH1 - Homo sapiens

Nucleoporin SEH1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Nucleoporin SEH1
Accession Code	Q96EE3
Gene	SEH1L
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 360)
MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFD RTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEIS CKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAI ATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILK GNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS

Structure Viewer (PDB: 7PEQ)

Subcellular Location

Description
Chromosome, centromere, kinetochore {Experimental EvidencePubMed:15146057, Experimental EvidencePubMed:17363900}. Nucleus, nuclear pore complex {Experimental EvidencePubMed:15146057, Experimental EvidencePubMed:17363900}. Lysosome membrane {ECO:0000269\|PubMed:28199306}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) GATOR2 Complex (GO:0061700) Kinetochore (GO:0000776) Lysosomal Membrane (GO:0005765) Nuclear Envelope (GO:0005635) Nuclear Pore (GO:0005643) Nuclear Pore Outer Ring (GO:0031080) Seh1-Associated Complex (GO:0035859)

Biology & Function

Description
Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation. This subunit plays a role in recruitment of the Nup107-160 subcomplex to the kinetochore. {Experimental EvidencePubMed:15146057, Experimental EvidencePubMed:17363900}. As a component of the GATOR subcomplex GATOR2, functions within the amino acid-sensing branch of the TORC1 signaling pathway. Indirectly activates mTORC1 and the TORC1 signaling pathway through the inhibition of the GATOR1 subcomplex (PubMed:23723238). It is negatively regulated by the upstream amino acid sensors SESN2 and CASTOR1 (PubMed:25457612, PubMed:27487210). {Experimental EvidencePubMed:23723238, Experimental EvidencePubMed:25457612, Experimental EvidencePubMed:27487210}.
Assigned Ontology terms

Biological Process	Attachment Of Mitotic Spindle Microtubules To Kinetochore (GO:0051315) Cell Division (GO:0051301) Cellular Response To Amino Acid Starvation (GO:0034198) Defense Response To Gram-Positive Bacterium (GO:0050830) Mitotic Metaphase Plate Congression (GO:0007080) MRNA Transport (GO:0051028) Negative Regulation Of TORC1 Signaling (GO:1904262) Nuclear Pore Organization (GO:0006999) Nucleocytoplasmic Transport (GO:0006913) Positive Regulation Of TOR Signaling (GO:0032008) Positive Regulation Of TORC1 Signaling (GO:1904263) Protein Transport (GO:0015031) Protein-Containing Complex Localization (GO:0031503)
Molecular Function	Structural Molecule Activity (GO:0005198)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (34 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P63165	Small ubiquitin-related modifier 1	EBI-11086798	0.35
P63279	SUMO-conjugating enzyme UBC9	EBI-11105225	0.35
Q9NRG9	Aladin	EBI-11086798	0.35
Q92905	COP9 signalosome complex subunit 5	EBI-21325777	0.35
Q8WYP5	Protein ELYS	EBI-9050503	0.49
Q53GS7	mRNA export factor GLE1	EBI-11086798	0.35
Q14974	Importin subunit beta-1	EBI-11115566	0.35
P02545	Lamin-A/C	EBI-16795756	0.27
Q9BTX1	Nucleoporin NDC1	EBI-11086798	0.35
P57740	Nuclear pore complex protein Nup107	EBI-11086798	0.35
Q8BH74	Nuclear pore complex protein Nup107	EBI-2563157	0.40
Q8WUM0	Nuclear pore complex protein Nup133	EBI-11086798	0.35
P49790	Nuclear pore complex protein Nup153	EBI-11076796	0.35
Q99P88	Nuclear pore complex protein Nup155	EBI-10997466	0.35
Q12769	Nuclear pore complex protein Nup160	EBI-11086798	0.35
Q5SRE5	Nucleoporin NUP188	EBI-11086798	0.35
Q92621	Nuclear pore complex protein Nup205	EBI-11086798	0.35
P35658	Nuclear pore complex protein Nup214	EBI-11086798	0.35
Q80U93	Nuclear pore complex protein Nup214	EBI-11014856	0.35
Q8NFH5	Nucleoporin NUP35	EBI-11086798	0.35
Q8NFH4	Nucleoporin Nup37	EBI-11086798	0.35
Q8NFH3	Nucleoporin Nup43	EBI-11086798	0.67
Q9BW27	Nuclear pore complex protein Nup85	EBI-9032422	0.70
Q99567	Nuclear pore complex protein Nup88	EBI-11086798	0.35
Q8N1F7	Nuclear pore complex protein Nup93	EBI-11086798	0.35
P52948	Nuclear pore complex protein Nup96	EBI-11086798	0.35
Q6PFD9	Nuclear pore complex protein Nup96	EBI-2563676	0.40
Q9UBU9	Nuclear RNA export factor 1	EBI-11086798	0.35
A8CG34	Nuclear envelope pore membrane protein POM 121C	EBI-11086798	0.35
Q8TEM1	Nuclear pore membrane glycoprotein 210	EBI-11086798	0.35
P46060	Ran GTPase-activating protein 1	EBI-11086798	0.35
P49792	E3 SUMO-protein ligase RanBP2	EBI-11086798	0.35
Q9ERU9	E3 SUMO-protein ligase RanBP2	EBI-10999306	0.35
P55735	Protein SEC13 homolog	EBI-11086798	0.62
Interactions with other proteins (48 interactors)

Partner (UniProt)		IntAct	Confidence score
Q1EHW4	Histone deacetylase complex subunit SAP25 (25 kDa Sin3-associated polypeptide) (Sin3 corepressor complex subunit SAP25) (mSin3A-binding protein)	EBI-922367	0.35
Q8IY92	Structure-specific endonuclease subunit SLX4 (BTB/POZ domain-containing protein 12)	EBI-2371120	0.35
P24386	Rab proteins geranylgeranyltransferase component A 1 (Choroideremia protein) (Rab escort protein 1) (REP-1) (TCD protein)	EBI-2515120	0.40
Q13573	SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein)	EBI-7950968	0.35
Q99459	Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein)	EBI-7954144	0.35
Q14457	Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]	EBI-3622591	0.35
Q93050	V-type proton ATPase 116 kDa subunit a 1 (V-ATPase 116 kDa subunit a 1) (Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit) (Vacuolar adenosine triphosphatase subunit Ac116) (Vacuolar proton pump subunit 1) (Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1)	EBI-3912272	0.37
P04578	Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]	EBI-6176529	0.46
Q9H6Z9	Prolyl hydroxylase EGLN3 (EC 1.14.11.-) (Egl nine homolog 3) (EC 1.14.11.29) (HPH-1) (Hypoxia-inducible factor prolyl hydroxylase 3) (HIF-PH3) (HIF-prolyl hydroxylase 3) (HPH-3) (Prolyl hydroxylase domain-containing protein 3) (PHD3)	EBI-12503146	0.35
P19838	Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor KBF1) (EBP-1) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) [Cleaved into: Nuclear factor NF-kappa-B p50 subunit]	EBI-11322417	0.35
E9QKK1	Centromere-associated protein E	EBI-10995761	0.35
E9PUA5	Kinesin-like protein	EBI-10999661	0.35
Q8VE37	Regulator of chromosome condensation (Chromosome condensation protein 1)	EBI-11043815	0.35
P63280	SUMO-conjugating enzyme UBC9 (EC 2.3.2.-) (RING-type E3 SUMO transferase UBC9) (SUMO-protein ligase) (Ubiquitin carrier protein 9) (mUBC9) (Ubiquitin carrier protein I) (Ubiquitin-conjugating enzyme E2 I) (Ubiquitin-protein ligase I)	EBI-11044140	0.35
Q99PL5	Ribosome-binding protein 1 (Ribosome receptor protein) (RRp) (mRRp)	EBI-11066888	0.35
O75864	Protein phosphatase 1 regulatory subunit 37 (Leucine-rich repeat-containing protein 68)	EBI-11086798	0.35
P49368	T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma) (hTRiC5)	EBI-11086798	0.35
P50991	T-complex protein 1 subunit delta (TCP-1-delta) (CCT-delta) (Stimulator of TAR RNA-binding)	EBI-11086798	0.35
E9PF10	Nuclear pore complex protein Nup155	EBI-11086798	0.35
Q6NUQ4	Transmembrane protein 214	EBI-11086798	0.35
P48643	T-complex protein 1 subunit epsilon (TCP-1-epsilon) (CCT-epsilon)	EBI-11086798	0.35
Q6PJI9	GATOR complex protein WDR59 (WD repeat-containing protein 59)	EBI-11086798	0.35
Q96SK2	Transmembrane protein 209	EBI-11086798	0.35
Q96S15	GATOR complex protein WDR24 (WD repeat-containing protein 24)	EBI-11086798	0.35
Q9NXC5	GATOR complex protein MIOS (Missing oocyte meiosis regulator homolog)	EBI-11086798	0.53
O43683	Mitotic checkpoint serine/threonine-protein kinase BUB1 (hBUB1) (EC 2.7.11.1) (BUB1A)	EBI-11086798	0.35
Q99832	T-complex protein 1 subunit eta (TCP-1-eta) (CCT-eta) (HIV-1 Nef-interacting protein) [Cleaved into: T-complex protein 1 subunit eta, N-terminally processed]	EBI-11086798	0.35
P58043	Sestrin-2 (EC 1.11.1.-)	EBI-11102804	0.35
E5LBS6	ORF10 (ORF10 protein)	EBI-14062727	0.35
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-16398399	0.35
Q68D86	Coiled-coil domain-containing protein 102B	EBI-21526180	0.35
P02511	Alpha-crystallin B chain (Alpha(B)-crystallin) (Heat shock protein beta-5) (HspB5) (Renal carcinoma antigen NY-REN-27) (Rosenthal fiber component)	EBI-21564160	0.35
Q8IYS4	Dynein axonemal assembly factor 8 (Dynein axonemal-associated protein 1)	EBI-21565697	0.35
Q99435	Protein kinase C-binding protein NELL2 (NEL-like protein 2) (Nel-related protein 2)	EBI-21661256	0.35
Q9GZP0	Platelet-derived growth factor D (PDGF-D) (Iris-expressed growth factor) (Spinal cord-derived growth factor B) (SCDGF-B) [Cleaved into: Platelet-derived growth factor D, latent form (PDGFD latent form); Platelet-derived growth factor D, receptor-binding form (PDGFD receptor-binding form)]	EBI-21663347	0.35
O15496	Group 10 secretory phospholipase A2 (EC 3.1.1.4) (Group X secretory phospholipase A2) (GX sPLA2) (sPLA2-X) (Phosphatidylcholine 2-acylhydrolase 10)	EBI-21699277	0.35
Q86XD5	Protein FAM131B	EBI-21711466	0.35
Q96RS6	NudC domain-containing protein 1 (Chronic myelogenous leukemia tumor antigen 66) (Tumor antigen CML66)	EBI-20723623	0.35
Q5T011	KICSTOR complex protein SZT2 (Seizure threshold 2 protein homolog)	EBI-16752607	0.35
O95714	E3 ubiquitin-protein ligase HERC2 (EC 2.3.2.26) (HECT domain and RCC1-like domain-containing protein 2) (HECT-type E3 ubiquitin transferase HERC2)	EBI-16811721	0.35
Q83A11	F-box domain-containing protein	EBI-21286703	0.37
P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	EBI-20798291	0.35
O14929	Histone acetyltransferase type B catalytic subunit (EC 2.3.1.48) (Histone acetyltransferase 1)	EBI-25478994	0.35
P0DTC2	Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) [Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2']	EBI-27088073	0.35
Q9NSY0	Nuclear receptor-binding protein 2 (Transformation-related gene 16 protein) (TRG-16)	EBI-28946547	0.35
Q92630	Dual specificity tyrosine-phosphorylation-regulated kinase 2 (EC 2.7.12.1)	EBI-28952196	0.27
Q93009	Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7)	EBI-30843837	0.44
Q9Y4G2	Pleckstrin homology domain-containing family M member 1 (PH domain-containing family M member 1) (162 kDa adapter protein) (AP162)	EBI-32711159	0.35

Cross-References

Database	Links
UNIPROT	Q96EE3 A8K5B1 Q8NFU6 Q96MH3 Q9C069
PDB	5A9Q 7PEQ
Pfam	PF00400
PROSITE	PS50082 PS50294
OMIM	609263
DisGeNET	81929

Nucleoporin SEH1 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 7PEQ)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (34 interactors)

Interactions with other proteins (48 interactors)

Cross-References

Database

Links

Description

Description